data_2KN2 # _entry.id 2KN2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KN2 pdb_00002kn2 10.2210/pdb2kn2/pdb RCSB RCSB101324 ? ? WWPDB D_1000101324 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-08-25 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_conn_angle 6 3 'Structure model' pdbx_struct_oper_list 7 3 'Structure model' struct_conn 8 3 'Structure model' struct_ref_seq_dif 9 3 'Structure model' struct_site 10 4 'Structure model' chem_comp_atom 11 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.value' 16 3 'Structure model' '_struct_conn.pdbx_dist_value' 17 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 23 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 24 3 'Structure model' '_struct_ref_seq_dif.details' 25 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 26 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 27 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KN2 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-08-12 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ishida, H.' 1 'Rainaldi, M.' 2 'Vogel, H.J.' 3 # _citation.id primary _citation.title ;Structural studies of soybean calmodulin isoform 4 bound to the calmodulin-binding domain of tobacco mitogen-activated protein kinase phosphatase-1 provide insights into a sequential target binding mode. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 284 _citation.page_first 28292 _citation.page_last 28305 _citation.year 2009 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19667066 _citation.pdbx_database_id_DOI 10.1074/jbc.M109.025080 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ishida, H.' 1 ? primary 'Rainaldi, M.' 2 ? primary 'Vogel, H.J.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Calmodulin 10447.618 1 ? ? 'UNP residues 79-150' ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMDTDAEEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVEQMIKEADLDGDGQVNYEEFVKMMMTVRGGGGG NGWSRLRRKFSS ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMDTDAEEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVEQMIKEADLDGDGQVNYEEFVKMMMTVRGGGGG NGWSRLRRKFSS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 ASP n 1 5 THR n 1 6 ASP n 1 7 ALA n 1 8 GLU n 1 9 GLU n 1 10 GLU n 1 11 LEU n 1 12 LYS n 1 13 GLU n 1 14 ALA n 1 15 PHE n 1 16 LYS n 1 17 VAL n 1 18 PHE n 1 19 ASP n 1 20 LYS n 1 21 ASP n 1 22 GLN n 1 23 ASN n 1 24 GLY n 1 25 TYR n 1 26 ILE n 1 27 SER n 1 28 ALA n 1 29 SER n 1 30 GLU n 1 31 LEU n 1 32 ARG n 1 33 HIS n 1 34 VAL n 1 35 MET n 1 36 ILE n 1 37 ASN n 1 38 LEU n 1 39 GLY n 1 40 GLU n 1 41 LYS n 1 42 LEU n 1 43 THR n 1 44 ASP n 1 45 GLU n 1 46 GLU n 1 47 VAL n 1 48 GLU n 1 49 GLN n 1 50 MET n 1 51 ILE n 1 52 LYS n 1 53 GLU n 1 54 ALA n 1 55 ASP n 1 56 LEU n 1 57 ASP n 1 58 GLY n 1 59 ASP n 1 60 GLY n 1 61 GLN n 1 62 VAL n 1 63 ASN n 1 64 TYR n 1 65 GLU n 1 66 GLU n 1 67 PHE n 1 68 VAL n 1 69 LYS n 1 70 MET n 1 71 MET n 1 72 MET n 1 73 THR n 1 74 VAL n 1 75 ARG n 1 76 GLY n 1 77 GLY n 1 78 GLY n 1 79 GLY n 1 80 GLY n 1 81 ASN n 1 82 GLY n 1 83 TRP n 1 84 SER n 1 85 ARG n 1 86 LEU n 1 87 ARG n 1 88 ARG n 1 89 LYS n 1 90 PHE n 1 91 SER n 1 92 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name soybeans _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SCaM-4 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Glycine max' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3847 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET30b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'SUMO fusion' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 HIS 2 2 2 HIS HIS A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 MET 35 35 35 MET MET A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 MET 50 50 50 MET MET A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 TRP 83 83 83 TRP TRP A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 SER 92 92 92 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 196 196 CA CA A . C 2 CA 1 209 209 CA CA A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KN2 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KN2 _struct.title 'Solution structure of the C-terminal domain of soybean calmodulin isoform 4 fused with the calmodulin-binding domain of NtMKP1' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KN2 _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'Calmodulin, Calmodulin-target complex, Soybean calmodulin, sCaM4, MAPK phosphatase 1, NtMKP1, Tobacco MKP1, METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q39890_SOYBN _struct_ref.pdbx_db_accession Q39890 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DTDAEEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVEQMIKEADLDGDGQVNYEEFVKMMMTVR _struct_ref.pdbx_align_begin 79 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KN2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 75 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q39890 _struct_ref_seq.db_align_beg 79 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 150 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 75 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KN2 GLY A 1 ? UNP Q39890 ? ? 'expression tag' 1 1 1 2KN2 HIS A 2 ? UNP Q39890 ? ? 'expression tag' 2 2 1 2KN2 MET A 3 ? UNP Q39890 ? ? 'expression tag' 3 3 1 2KN2 GLY A 76 ? UNP Q39890 ? ? 'expression tag' 76 4 1 2KN2 GLY A 77 ? UNP Q39890 ? ? 'expression tag' 77 5 1 2KN2 GLY A 78 ? UNP Q39890 ? ? 'expression tag' 78 6 1 2KN2 GLY A 79 ? UNP Q39890 ? ? 'expression tag' 79 7 1 2KN2 GLY A 80 ? UNP Q39890 ? ? 'expression tag' 80 8 1 2KN2 ASN A 81 ? UNP Q39890 ? ? 'expression tag' 81 9 1 2KN2 GLY A 82 ? UNP Q39890 ? ? 'expression tag' 82 10 1 2KN2 TRP A 83 ? UNP Q39890 ? ? 'expression tag' 83 11 1 2KN2 SER A 84 ? UNP Q39890 ? ? 'expression tag' 84 12 1 2KN2 ARG A 85 ? UNP Q39890 ? ? 'expression tag' 85 13 1 2KN2 LEU A 86 ? UNP Q39890 ? ? 'expression tag' 86 14 1 2KN2 ARG A 87 ? UNP Q39890 ? ? 'expression tag' 87 15 1 2KN2 ARG A 88 ? UNP Q39890 ? ? 'expression tag' 88 16 1 2KN2 LYS A 89 ? UNP Q39890 ? ? 'expression tag' 89 17 1 2KN2 PHE A 90 ? UNP Q39890 ? ? 'expression tag' 90 18 1 2KN2 SER A 91 ? UNP Q39890 ? ? 'expression tag' 91 19 1 2KN2 SER A 92 ? UNP Q39890 ? ? 'expression tag' 92 20 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 5 ? ASP A 19 ? THR A 5 ASP A 19 1 ? 15 HELX_P HELX_P2 2 SER A 27 ? LEU A 38 ? SER A 27 LEU A 38 1 ? 12 HELX_P HELX_P3 3 THR A 43 ? ASP A 55 ? THR A 43 ASP A 55 1 ? 13 HELX_P HELX_P4 4 TYR A 64 ? ARG A 75 ? TYR A 64 ARG A 75 1 ? 12 HELX_P HELX_P5 5 GLY A 80 ? SER A 91 ? GLY A 80 SER A 91 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 19 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 19 A CA 196 1_555 ? ? ? ? ? ? ? 2.594 ? ? metalc2 metalc ? ? A ASP 21 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 21 A CA 196 1_555 ? ? ? ? ? ? ? 4.591 ? ? metalc3 metalc ? ? A ASP 21 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 21 A CA 196 1_555 ? ? ? ? ? ? ? 2.601 ? ? metalc4 metalc ? ? A ASN 23 OD1 ? ? ? 1_555 B CA . CA ? ? A ASN 23 A CA 196 1_555 ? ? ? ? ? ? ? 2.573 ? ? metalc5 metalc ? ? A ASN 23 ND2 ? ? ? 1_555 B CA . CA ? ? A ASN 23 A CA 196 1_555 ? ? ? ? ? ? ? 2.668 ? ? metalc6 metalc ? ? A TYR 25 O ? ? ? 1_555 B CA . CA ? ? A TYR 25 A CA 196 1_555 ? ? ? ? ? ? ? 2.575 ? ? metalc7 metalc ? ? A GLU 30 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 30 A CA 196 1_555 ? ? ? ? ? ? ? 2.625 ? ? metalc8 metalc ? ? A GLU 30 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 30 A CA 196 1_555 ? ? ? ? ? ? ? 2.600 ? ? metalc9 metalc ? ? A ASP 55 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 55 A CA 209 1_555 ? ? ? ? ? ? ? 3.289 ? ? metalc10 metalc ? ? A ASP 55 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 55 A CA 209 1_555 ? ? ? ? ? ? ? 2.579 ? ? metalc11 metalc ? ? A ASP 57 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 57 A CA 209 1_555 ? ? ? ? ? ? ? 2.596 ? ? metalc12 metalc ? ? A ASP 57 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 57 A CA 209 1_555 ? ? ? ? ? ? ? 3.103 ? ? metalc13 metalc ? ? A ASP 59 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 59 A CA 209 1_555 ? ? ? ? ? ? ? 2.953 ? ? metalc14 metalc ? ? A ASP 59 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 59 A CA 209 1_555 ? ? ? ? ? ? ? 2.569 ? ? metalc15 metalc ? ? A GLN 61 O ? ? ? 1_555 C CA . CA ? ? A GLN 61 A CA 209 1_555 ? ? ? ? ? ? ? 2.599 ? ? metalc16 metalc ? ? A GLU 66 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 66 A CA 209 1_555 ? ? ? ? ? ? ? 2.582 ? ? metalc17 metalc ? ? A GLU 66 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 66 A CA 209 1_555 ? ? ? ? ? ? ? 2.586 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 19 ? A ASP 19 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 OD1 ? A ASP 21 ? A ASP 21 ? 1_555 96.2 ? 2 OD1 ? A ASP 19 ? A ASP 19 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 105.0 ? 3 OD1 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 13.9 ? 4 OD1 ? A ASP 19 ? A ASP 19 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 OD1 ? A ASN 23 ? A ASN 23 ? 1_555 104.9 ? 5 OD1 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 OD1 ? A ASN 23 ? A ASN 23 ? 1_555 104.5 ? 6 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 OD1 ? A ASN 23 ? A ASN 23 ? 1_555 111.5 ? 7 OD1 ? A ASP 19 ? A ASP 19 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 ND2 ? A ASN 23 ? A ASN 23 ? 1_555 57.1 ? 8 OD1 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 ND2 ? A ASN 23 ? A ASN 23 ? 1_555 118.8 ? 9 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 ND2 ? A ASN 23 ? A ASN 23 ? 1_555 132.6 ? 10 OD1 ? A ASN 23 ? A ASN 23 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 ND2 ? A ASN 23 ? A ASN 23 ? 1_555 49.6 ? 11 OD1 ? A ASP 19 ? A ASP 19 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 O ? A TYR 25 ? A TYR 25 ? 1_555 84.3 ? 12 OD1 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 O ? A TYR 25 ? A TYR 25 ? 1_555 175.8 ? 13 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 O ? A TYR 25 ? A TYR 25 ? 1_555 162.5 ? 14 OD1 ? A ASN 23 ? A ASN 23 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 O ? A TYR 25 ? A TYR 25 ? 1_555 79.3 ? 15 ND2 ? A ASN 23 ? A ASN 23 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 O ? A TYR 25 ? A TYR 25 ? 1_555 64.9 ? 16 OD1 ? A ASP 19 ? A ASP 19 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 OE2 ? A GLU 30 ? A GLU 30 ? 1_555 63.7 ? 17 OD1 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 OE2 ? A GLU 30 ? A GLU 30 ? 1_555 55.1 ? 18 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 OE2 ? A GLU 30 ? A GLU 30 ? 1_555 53.6 ? 19 OD1 ? A ASN 23 ? A ASN 23 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 OE2 ? A GLU 30 ? A GLU 30 ? 1_555 152.2 ? 20 ND2 ? A ASN 23 ? A ASN 23 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 OE2 ? A GLU 30 ? A GLU 30 ? 1_555 119.4 ? 21 O ? A TYR 25 ? A TYR 25 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 OE2 ? A GLU 30 ? A GLU 30 ? 1_555 121.9 ? 22 OD1 ? A ASP 19 ? A ASP 19 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 OE1 ? A GLU 30 ? A GLU 30 ? 1_555 74.7 ? 23 OD1 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 OE1 ? A GLU 30 ? A GLU 30 ? 1_555 98.3 ? 24 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 OE1 ? A GLU 30 ? A GLU 30 ? 1_555 90.3 ? 25 OD1 ? A ASN 23 ? A ASN 23 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 OE1 ? A GLU 30 ? A GLU 30 ? 1_555 157.0 ? 26 ND2 ? A ASN 23 ? A ASN 23 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 OE1 ? A GLU 30 ? A GLU 30 ? 1_555 120.0 ? 27 O ? A TYR 25 ? A TYR 25 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 OE1 ? A GLU 30 ? A GLU 30 ? 1_555 77.8 ? 28 OE2 ? A GLU 30 ? A GLU 30 ? 1_555 CA ? B CA . ? A CA 196 ? 1_555 OE1 ? A GLU 30 ? A GLU 30 ? 1_555 48.6 ? 29 OD2 ? A ASP 55 ? A ASP 55 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OD1 ? A ASP 55 ? A ASP 55 ? 1_555 40.9 ? 30 OD2 ? A ASP 55 ? A ASP 55 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OD1 ? A ASP 57 ? A ASP 57 ? 1_555 66.4 ? 31 OD1 ? A ASP 55 ? A ASP 55 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OD1 ? A ASP 57 ? A ASP 57 ? 1_555 54.1 ? 32 OD2 ? A ASP 55 ? A ASP 55 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OD2 ? A ASP 57 ? A ASP 57 ? 1_555 108.8 ? 33 OD1 ? A ASP 55 ? A ASP 55 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OD2 ? A ASP 57 ? A ASP 57 ? 1_555 82.6 ? 34 OD1 ? A ASP 57 ? A ASP 57 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OD2 ? A ASP 57 ? A ASP 57 ? 1_555 43.3 ? 35 OD2 ? A ASP 55 ? A ASP 55 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OD2 ? A ASP 59 ? A ASP 59 ? 1_555 89.8 ? 36 OD1 ? A ASP 55 ? A ASP 55 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OD2 ? A ASP 59 ? A ASP 59 ? 1_555 112.7 ? 37 OD1 ? A ASP 57 ? A ASP 57 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OD2 ? A ASP 59 ? A ASP 59 ? 1_555 66.8 ? 38 OD2 ? A ASP 57 ? A ASP 57 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OD2 ? A ASP 59 ? A ASP 59 ? 1_555 74.5 ? 39 OD2 ? A ASP 55 ? A ASP 55 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OD1 ? A ASP 59 ? A ASP 59 ? 1_555 45.3 ? 40 OD1 ? A ASP 55 ? A ASP 55 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OD1 ? A ASP 59 ? A ASP 59 ? 1_555 78.5 ? 41 OD1 ? A ASP 57 ? A ASP 57 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OD1 ? A ASP 59 ? A ASP 59 ? 1_555 62.4 ? 42 OD2 ? A ASP 57 ? A ASP 57 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OD1 ? A ASP 59 ? A ASP 59 ? 1_555 98.1 ? 43 OD2 ? A ASP 59 ? A ASP 59 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OD1 ? A ASP 59 ? A ASP 59 ? 1_555 45.2 ? 44 OD2 ? A ASP 55 ? A ASP 55 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 O ? A GLN 61 ? A GLN 61 ? 1_555 75.3 ? 45 OD1 ? A ASP 55 ? A ASP 55 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 O ? A GLN 61 ? A GLN 61 ? 1_555 115.7 ? 46 OD1 ? A ASP 57 ? A ASP 57 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 O ? A GLN 61 ? A GLN 61 ? 1_555 115.8 ? 47 OD2 ? A ASP 57 ? A ASP 57 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 O ? A GLN 61 ? A GLN 61 ? 1_555 137.8 ? 48 OD2 ? A ASP 59 ? A ASP 59 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 O ? A GLN 61 ? A GLN 61 ? 1_555 63.5 ? 49 OD1 ? A ASP 59 ? A ASP 59 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 O ? A GLN 61 ? A GLN 61 ? 1_555 54.0 ? 50 OD2 ? A ASP 55 ? A ASP 55 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OE2 ? A GLU 66 ? A GLU 66 ? 1_555 125.4 ? 51 OD1 ? A ASP 55 ? A ASP 55 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OE2 ? A GLU 66 ? A GLU 66 ? 1_555 87.0 ? 52 OD1 ? A ASP 57 ? A ASP 57 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OE2 ? A GLU 66 ? A GLU 66 ? 1_555 99.5 ? 53 OD2 ? A ASP 57 ? A ASP 57 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OE2 ? A GLU 66 ? A GLU 66 ? 1_555 68.0 ? 54 OD2 ? A ASP 59 ? A ASP 59 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OE2 ? A GLU 66 ? A GLU 66 ? 1_555 134.7 ? 55 OD1 ? A ASP 59 ? A ASP 59 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OE2 ? A GLU 66 ? A GLU 66 ? 1_555 161.3 ? 56 O ? A GLN 61 ? A GLN 61 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OE2 ? A GLU 66 ? A GLU 66 ? 1_555 144.6 ? 57 OD2 ? A ASP 55 ? A ASP 55 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OE1 ? A GLU 66 ? A GLU 66 ? 1_555 118.2 ? 58 OD1 ? A ASP 55 ? A ASP 55 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OE1 ? A GLU 66 ? A GLU 66 ? 1_555 105.6 ? 59 OD1 ? A ASP 57 ? A ASP 57 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OE1 ? A GLU 66 ? A GLU 66 ? 1_555 146.5 ? 60 OD2 ? A ASP 57 ? A ASP 57 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OE1 ? A GLU 66 ? A GLU 66 ? 1_555 115.4 ? 61 OD2 ? A ASP 59 ? A ASP 59 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OE1 ? A GLU 66 ? A GLU 66 ? 1_555 141.5 ? 62 OD1 ? A ASP 59 ? A ASP 59 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OE1 ? A GLU 66 ? A GLU 66 ? 1_555 146.5 ? 63 O ? A GLN 61 ? A GLN 61 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OE1 ? A GLU 66 ? A GLU 66 ? 1_555 96.7 ? 64 OE2 ? A GLU 66 ? A GLU 66 ? 1_555 CA ? C CA . ? A CA 209 ? 1_555 OE1 ? A GLU 66 ? A GLU 66 ? 1_555 49.3 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 25 ? ILE A 26 ? TYR A 25 ILE A 26 A 2 VAL A 62 ? ASN A 63 ? VAL A 62 ASN A 63 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 26 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 26 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 62 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 62 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 196 ? 5 'BINDING SITE FOR RESIDUE CA A 196' AC2 Software A CA 209 ? 6 'BINDING SITE FOR RESIDUE CA A 209' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 19 ? ASP A 19 . ? 1_555 ? 2 AC1 5 ASP A 21 ? ASP A 21 . ? 1_555 ? 3 AC1 5 ASN A 23 ? ASN A 23 . ? 1_555 ? 4 AC1 5 TYR A 25 ? TYR A 25 . ? 1_555 ? 5 AC1 5 GLU A 30 ? GLU A 30 . ? 1_555 ? 6 AC2 6 ASP A 55 ? ASP A 55 . ? 1_555 ? 7 AC2 6 ASP A 57 ? ASP A 57 . ? 1_555 ? 8 AC2 6 ASP A 59 ? ASP A 59 . ? 1_555 ? 9 AC2 6 GLN A 61 ? GLN A 61 . ? 1_555 ? 10 AC2 6 ASN A 63 ? ASN A 63 . ? 1_555 ? 11 AC2 6 GLU A 66 ? GLU A 66 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ILE 51 ? ? H A ASP 55 ? ? 1.53 2 1 OD1 A ASN 63 ? ? H A GLU 66 ? ? 1.57 3 3 O A ILE 51 ? ? H A ASP 55 ? ? 1.57 4 4 O A ILE 51 ? ? H A ASP 55 ? ? 1.49 5 4 OD1 A ASN 63 ? ? H A GLU 66 ? ? 1.54 6 6 O A ILE 51 ? ? H A ASP 55 ? ? 1.57 7 9 HD21 A ASN 63 ? ? H A GLU 65 ? ? 1.18 8 9 HG A SER 27 ? ? H A ALA 28 ? ? 1.27 9 11 O A ILE 51 ? ? H A ASP 55 ? ? 1.54 10 13 HD22 A ASN 23 ? ? O A TYR 25 ? ? 1.56 11 13 O A ILE 51 ? ? H A ASP 55 ? ? 1.57 12 13 O A MET 35 ? ? H A GLU 40 ? ? 1.57 13 14 O A ILE 51 ? ? H A ASP 55 ? ? 1.52 14 14 O A GLU 10 ? ? H A ALA 14 ? ? 1.53 15 15 OD1 A ASP 21 ? ? H A ASN 23 ? ? 1.55 16 15 O A ILE 51 ? ? H A ASP 55 ? ? 1.59 17 17 H3 A GLY 1 ? ? H A HIS 2 ? ? 1.27 18 17 O A ILE 51 ? ? H A ASP 55 ? ? 1.55 19 19 O A ILE 51 ? ? H A ASP 55 ? ? 1.52 20 21 HD22 A ASN 23 ? ? O A TYR 25 ? ? 1.52 21 21 O A ILE 51 ? ? H A ASP 55 ? ? 1.54 22 23 OD1 A ASP 55 ? ? H A ASP 57 ? ? 1.60 23 24 O A THR 73 ? ? H A GLY 77 ? ? 1.55 24 25 HD21 A ASN 63 ? ? H A GLU 65 ? ? 1.21 25 25 OD1 A ASP 21 ? ? H A ASN 23 ? ? 1.51 26 25 O A ILE 51 ? ? H A ASP 55 ? ? 1.59 27 27 O A ILE 51 ? ? H A ASP 55 ? ? 1.60 28 28 O A ILE 51 ? ? H A ASP 55 ? ? 1.50 29 28 OD1 A ASN 63 ? ? H A GLU 66 ? ? 1.56 30 28 O A ASP 4 ? ? H A ALA 7 ? ? 1.56 31 30 O A ILE 51 ? ? H A ASP 55 ? ? 1.55 32 30 O A ASP 6 ? ? H A GLU 10 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 2 ? ? 40.38 25.59 2 1 ASP A 4 ? ? 65.51 -145.35 3 1 THR A 5 ? ? 77.90 -29.14 4 1 ASP A 6 ? ? -46.22 -17.78 5 1 PHE A 90 ? ? -80.77 -96.49 6 1 SER A 91 ? ? -73.14 -73.51 7 2 ASP A 4 ? ? -163.81 -127.64 8 2 THR A 5 ? ? -62.04 86.63 9 2 PHE A 90 ? ? -99.22 42.98 10 3 GLN A 22 ? ? 77.00 32.67 11 3 PHE A 90 ? ? -94.36 45.81 12 3 SER A 91 ? ? 61.63 139.03 13 4 ASP A 4 ? ? -50.15 -89.79 14 4 SER A 27 ? ? -111.97 -166.05 15 4 ARG A 75 ? ? -46.93 -19.05 16 5 SER A 27 ? ? -110.57 -169.18 17 5 VAL A 68 ? ? -60.72 -70.04 18 5 SER A 91 ? ? -15.55 -77.59 19 6 HIS A 2 ? ? 52.85 77.94 20 6 PHE A 90 ? ? -84.79 -82.70 21 7 MET A 3 ? ? -46.76 -84.96 22 7 ASP A 4 ? ? -176.89 76.33 23 7 SER A 27 ? ? -125.48 -163.38 24 7 PHE A 90 ? ? -95.71 41.57 25 8 ALA A 28 ? ? -39.75 -39.16 26 8 PHE A 90 ? ? -72.04 -78.81 27 8 SER A 91 ? ? 49.03 -124.94 28 9 MET A 3 ? ? 45.55 73.25 29 9 THR A 5 ? ? -56.22 92.13 30 9 SER A 27 ? ? -110.64 -162.87 31 9 PHE A 90 ? ? -161.09 -69.40 32 10 LEU A 42 ? ? -109.34 -167.21 33 10 ARG A 87 ? ? -92.73 -61.75 34 10 PHE A 90 ? ? -101.74 51.11 35 11 ASP A 4 ? ? -172.00 -83.57 36 11 SER A 91 ? ? -176.36 -103.99 37 12 HIS A 2 ? ? -97.46 31.03 38 12 ASP A 4 ? ? -19.23 -90.26 39 12 SER A 27 ? ? -124.13 -167.76 40 12 LYS A 89 ? ? -57.99 -95.73 41 12 PHE A 90 ? ? 10.60 -106.70 42 13 MET A 3 ? ? -82.75 -158.48 43 13 THR A 5 ? ? -41.21 91.54 44 13 SER A 27 ? ? -106.36 -166.98 45 13 VAL A 74 ? ? -47.44 -11.83 46 13 LYS A 89 ? ? -67.44 -101.64 47 13 PHE A 90 ? ? 28.66 37.33 48 14 ASP A 4 ? ? 60.37 74.98 49 14 THR A 5 ? ? -56.66 97.30 50 14 GLN A 22 ? ? 39.50 40.14 51 14 SER A 27 ? ? -118.90 -169.22 52 14 LYS A 89 ? ? -56.50 -93.00 53 14 PHE A 90 ? ? 28.93 38.01 54 14 SER A 91 ? ? 49.35 -96.97 55 15 HIS A 2 ? ? 44.09 -165.72 56 15 PHE A 90 ? ? -167.97 62.76 57 16 HIS A 2 ? ? 41.03 -165.45 58 16 MET A 3 ? ? 52.02 13.09 59 16 ASP A 4 ? ? -152.82 -22.13 60 16 THR A 5 ? ? -59.58 100.76 61 16 GLN A 22 ? ? 71.71 38.17 62 16 MET A 72 ? ? -91.43 -63.99 63 16 ARG A 75 ? ? -67.98 83.71 64 16 LYS A 89 ? ? -52.54 -92.65 65 16 PHE A 90 ? ? 0.59 -105.16 66 16 SER A 91 ? ? 45.82 -143.28 67 17 HIS A 2 ? ? -166.82 65.34 68 17 THR A 5 ? ? -48.34 91.41 69 17 SER A 27 ? ? -103.51 -169.54 70 17 ARG A 75 ? ? -38.63 117.53 71 17 SER A 91 ? ? 58.26 146.47 72 18 MET A 3 ? ? 55.88 159.20 73 18 ASP A 4 ? ? -140.69 -105.25 74 18 SER A 27 ? ? -120.10 -163.23 75 18 VAL A 74 ? ? -57.77 -9.78 76 18 ARG A 75 ? ? -34.47 95.60 77 18 PHE A 90 ? ? -105.45 -102.54 78 18 SER A 91 ? ? 38.26 31.67 79 19 MET A 3 ? ? 40.67 87.96 80 19 PHE A 90 ? ? -76.33 -87.88 81 19 SER A 91 ? ? -141.94 44.06 82 20 PHE A 90 ? ? -74.53 -75.98 83 20 SER A 91 ? ? 44.07 -131.84 84 21 MET A 3 ? ? -174.24 60.92 85 21 ASP A 4 ? ? 50.36 179.68 86 21 PHE A 90 ? ? -87.15 47.77 87 21 SER A 91 ? ? 57.32 154.07 88 22 SER A 27 ? ? -124.58 -158.86 89 22 LYS A 89 ? ? -51.23 -90.09 90 22 SER A 91 ? ? -94.45 -156.25 91 23 ASP A 4 ? ? 11.79 79.47 92 23 PHE A 90 ? ? -84.80 -99.05 93 23 SER A 91 ? ? 46.59 73.75 94 24 MET A 3 ? ? 46.86 85.72 95 24 ASP A 4 ? ? -165.45 24.57 96 24 VAL A 74 ? ? -32.06 -31.46 97 24 ARG A 75 ? ? -51.46 -9.01 98 24 PHE A 90 ? ? -82.61 -97.11 99 25 HIS A 2 ? ? 69.05 -21.58 100 25 VAL A 74 ? ? -55.33 -7.60 101 25 ARG A 75 ? ? -35.55 96.06 102 25 PHE A 90 ? ? -101.54 42.16 103 26 HIS A 2 ? ? 71.05 -47.89 104 26 GLN A 22 ? ? 72.17 30.06 105 26 SER A 27 ? ? -121.63 -161.34 106 26 LYS A 89 ? ? -58.15 -96.25 107 26 PHE A 90 ? ? 28.60 36.35 108 26 SER A 91 ? ? -146.67 29.84 109 27 HIS A 2 ? ? -156.49 -83.02 110 27 ASP A 4 ? ? 17.20 -82.46 111 27 THR A 5 ? ? -31.07 121.55 112 27 SER A 91 ? ? -23.78 -82.64 113 28 HIS A 2 ? ? 52.56 -165.45 114 28 MET A 3 ? ? 51.27 103.50 115 28 THR A 5 ? ? -28.47 -34.81 116 28 ASP A 6 ? ? -46.44 -16.19 117 28 ARG A 88 ? ? -38.67 -32.50 118 28 PHE A 90 ? ? -131.70 -159.61 119 29 HIS A 2 ? ? 50.39 11.49 120 29 ASP A 4 ? ? -174.84 42.93 121 29 SER A 27 ? ? -117.20 -167.76 122 29 TYR A 64 ? ? -50.43 -74.38 123 29 VAL A 68 ? ? -60.14 -70.48 124 29 PHE A 90 ? ? -126.64 -147.47 125 30 ASP A 4 ? ? -162.25 5.91 126 30 THR A 5 ? ? -66.92 96.94 127 30 PHE A 90 ? ? -84.40 -93.41 128 30 SER A 91 ? ? 50.22 72.23 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KN2 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KN2 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.5 mM [U-99% 13C; U-99% 15N] sCaM4-1, 100 mM potassium chloride-2, 5 mM calcium chloride-3, 20 mM Bis-Tris-4, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.5 mM [U-99% 13C; U-99% 15N] sCaM4-5, 100 mM potassium chloride-6, 5 mM calcium chloride-7, 20 mM Bis-Tris-8, 99.9% D2O' 2 '99.9% D2O' ;0.5 mM [U-99% 15N] sCaM4-9, 300 mM potassium chloride-10, 5 mM calcium chloride-11, 20 mM Bis-Tris-12, 16 mg/ml Pf1 phage-13, 90% H2O/10% D2O ; 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id sCaM4-1 0.5 ? mM '[U-99% 13C; U-99% 15N]' 1 'potassium chloride-2' 100 ? mM ? 1 'calcium chloride-3' 5 ? mM ? 1 Bis-Tris-4 20 ? mM ? 1 sCaM4-5 0.5 ? mM '[U-99% 13C; U-99% 15N]' 2 'potassium chloride-6' 100 ? mM ? 2 'calcium chloride-7' 5 ? mM ? 2 Bis-Tris-8 20 ? mM ? 2 sCaM4-9 0.5 ? mM '[U-99% 15N]' 3 'potassium chloride-10' 300 ? mM ? 3 'calcium chloride-11' 5 ? mM ? 3 Bis-Tris-12 20 ? mM ? 3 'Pf1 phage-13' 16 ? mg/mL ? 3 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.temperature_units 1 100 6.8 ambient ? 303 K 2 300 6.8 ? ? 303 K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D CBCANH' 1 4 1 '3D HNCO' 1 5 1 '3D HN(CA)CO' 1 6 1 '3D C(CO)NH' 1 7 1 '3D H(CCO)NH' 1 8 1 '3D HBHA(CO)NH' 1 9 1 '3D 1H-13C NOESY' 1 10 2 '3D 1H-15N NOESY' 2 11 3 '2D IPAP-1H-15N HSQC' # _pdbx_nmr_refine.entry_id 2KN2 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.0 1 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' 2.19 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 ILE N N N N 145 ILE CA C N S 146 ILE C C N N 147 ILE O O N N 148 ILE CB C N S 149 ILE CG1 C N N 150 ILE CG2 C N N 151 ILE CD1 C N N 152 ILE OXT O N N 153 ILE H H N N 154 ILE H2 H N N 155 ILE HA H N N 156 ILE HB H N N 157 ILE HG12 H N N 158 ILE HG13 H N N 159 ILE HG21 H N N 160 ILE HG22 H N N 161 ILE HG23 H N N 162 ILE HD11 H N N 163 ILE HD12 H N N 164 ILE HD13 H N N 165 ILE HXT H N N 166 LEU N N N N 167 LEU CA C N S 168 LEU C C N N 169 LEU O O N N 170 LEU CB C N N 171 LEU CG C N N 172 LEU CD1 C N N 173 LEU CD2 C N N 174 LEU OXT O N N 175 LEU H H N N 176 LEU H2 H N N 177 LEU HA H N N 178 LEU HB2 H N N 179 LEU HB3 H N N 180 LEU HG H N N 181 LEU HD11 H N N 182 LEU HD12 H N N 183 LEU HD13 H N N 184 LEU HD21 H N N 185 LEU HD22 H N N 186 LEU HD23 H N N 187 LEU HXT H N N 188 LYS N N N N 189 LYS CA C N S 190 LYS C C N N 191 LYS O O N N 192 LYS CB C N N 193 LYS CG C N N 194 LYS CD C N N 195 LYS CE C N N 196 LYS NZ N N N 197 LYS OXT O N N 198 LYS H H N N 199 LYS H2 H N N 200 LYS HA H N N 201 LYS HB2 H N N 202 LYS HB3 H N N 203 LYS HG2 H N N 204 LYS HG3 H N N 205 LYS HD2 H N N 206 LYS HD3 H N N 207 LYS HE2 H N N 208 LYS HE3 H N N 209 LYS HZ1 H N N 210 LYS HZ2 H N N 211 LYS HZ3 H N N 212 LYS HXT H N N 213 MET N N N N 214 MET CA C N S 215 MET C C N N 216 MET O O N N 217 MET CB C N N 218 MET CG C N N 219 MET SD S N N 220 MET CE C N N 221 MET OXT O N N 222 MET H H N N 223 MET H2 H N N 224 MET HA H N N 225 MET HB2 H N N 226 MET HB3 H N N 227 MET HG2 H N N 228 MET HG3 H N N 229 MET HE1 H N N 230 MET HE2 H N N 231 MET HE3 H N N 232 MET HXT H N N 233 PHE N N N N 234 PHE CA C N S 235 PHE C C N N 236 PHE O O N N 237 PHE CB C N N 238 PHE CG C Y N 239 PHE CD1 C Y N 240 PHE CD2 C Y N 241 PHE CE1 C Y N 242 PHE CE2 C Y N 243 PHE CZ C Y N 244 PHE OXT O N N 245 PHE H H N N 246 PHE H2 H N N 247 PHE HA H N N 248 PHE HB2 H N N 249 PHE HB3 H N N 250 PHE HD1 H N N 251 PHE HD2 H N N 252 PHE HE1 H N N 253 PHE HE2 H N N 254 PHE HZ H N N 255 PHE HXT H N N 256 SER N N N N 257 SER CA C N S 258 SER C C N N 259 SER O O N N 260 SER CB C N N 261 SER OG O N N 262 SER OXT O N N 263 SER H H N N 264 SER H2 H N N 265 SER HA H N N 266 SER HB2 H N N 267 SER HB3 H N N 268 SER HG H N N 269 SER HXT H N N 270 THR N N N N 271 THR CA C N S 272 THR C C N N 273 THR O O N N 274 THR CB C N R 275 THR OG1 O N N 276 THR CG2 C N N 277 THR OXT O N N 278 THR H H N N 279 THR H2 H N N 280 THR HA H N N 281 THR HB H N N 282 THR HG1 H N N 283 THR HG21 H N N 284 THR HG22 H N N 285 THR HG23 H N N 286 THR HXT H N N 287 TRP N N N N 288 TRP CA C N S 289 TRP C C N N 290 TRP O O N N 291 TRP CB C N N 292 TRP CG C Y N 293 TRP CD1 C Y N 294 TRP CD2 C Y N 295 TRP NE1 N Y N 296 TRP CE2 C Y N 297 TRP CE3 C Y N 298 TRP CZ2 C Y N 299 TRP CZ3 C Y N 300 TRP CH2 C Y N 301 TRP OXT O N N 302 TRP H H N N 303 TRP H2 H N N 304 TRP HA H N N 305 TRP HB2 H N N 306 TRP HB3 H N N 307 TRP HD1 H N N 308 TRP HE1 H N N 309 TRP HE3 H N N 310 TRP HZ2 H N N 311 TRP HZ3 H N N 312 TRP HH2 H N N 313 TRP HXT H N N 314 TYR N N N N 315 TYR CA C N S 316 TYR C C N N 317 TYR O O N N 318 TYR CB C N N 319 TYR CG C Y N 320 TYR CD1 C Y N 321 TYR CD2 C Y N 322 TYR CE1 C Y N 323 TYR CE2 C Y N 324 TYR CZ C Y N 325 TYR OH O N N 326 TYR OXT O N N 327 TYR H H N N 328 TYR H2 H N N 329 TYR HA H N N 330 TYR HB2 H N N 331 TYR HB3 H N N 332 TYR HD1 H N N 333 TYR HD2 H N N 334 TYR HE1 H N N 335 TYR HE2 H N N 336 TYR HH H N N 337 TYR HXT H N N 338 VAL N N N N 339 VAL CA C N S 340 VAL C C N N 341 VAL O O N N 342 VAL CB C N N 343 VAL CG1 C N N 344 VAL CG2 C N N 345 VAL OXT O N N 346 VAL H H N N 347 VAL H2 H N N 348 VAL HA H N N 349 VAL HB H N N 350 VAL HG11 H N N 351 VAL HG12 H N N 352 VAL HG13 H N N 353 VAL HG21 H N N 354 VAL HG22 H N N 355 VAL HG23 H N N 356 VAL HXT H N N 357 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 SER N CA sing N N 245 SER N H sing N N 246 SER N H2 sing N N 247 SER CA C sing N N 248 SER CA CB sing N N 249 SER CA HA sing N N 250 SER C O doub N N 251 SER C OXT sing N N 252 SER CB OG sing N N 253 SER CB HB2 sing N N 254 SER CB HB3 sing N N 255 SER OG HG sing N N 256 SER OXT HXT sing N N 257 THR N CA sing N N 258 THR N H sing N N 259 THR N H2 sing N N 260 THR CA C sing N N 261 THR CA CB sing N N 262 THR CA HA sing N N 263 THR C O doub N N 264 THR C OXT sing N N 265 THR CB OG1 sing N N 266 THR CB CG2 sing N N 267 THR CB HB sing N N 268 THR OG1 HG1 sing N N 269 THR CG2 HG21 sing N N 270 THR CG2 HG22 sing N N 271 THR CG2 HG23 sing N N 272 THR OXT HXT sing N N 273 TRP N CA sing N N 274 TRP N H sing N N 275 TRP N H2 sing N N 276 TRP CA C sing N N 277 TRP CA CB sing N N 278 TRP CA HA sing N N 279 TRP C O doub N N 280 TRP C OXT sing N N 281 TRP CB CG sing N N 282 TRP CB HB2 sing N N 283 TRP CB HB3 sing N N 284 TRP CG CD1 doub Y N 285 TRP CG CD2 sing Y N 286 TRP CD1 NE1 sing Y N 287 TRP CD1 HD1 sing N N 288 TRP CD2 CE2 doub Y N 289 TRP CD2 CE3 sing Y N 290 TRP NE1 CE2 sing Y N 291 TRP NE1 HE1 sing N N 292 TRP CE2 CZ2 sing Y N 293 TRP CE3 CZ3 doub Y N 294 TRP CE3 HE3 sing N N 295 TRP CZ2 CH2 doub Y N 296 TRP CZ2 HZ2 sing N N 297 TRP CZ3 CH2 sing Y N 298 TRP CZ3 HZ3 sing N N 299 TRP CH2 HH2 sing N N 300 TRP OXT HXT sing N N 301 TYR N CA sing N N 302 TYR N H sing N N 303 TYR N H2 sing N N 304 TYR CA C sing N N 305 TYR CA CB sing N N 306 TYR CA HA sing N N 307 TYR C O doub N N 308 TYR C OXT sing N N 309 TYR CB CG sing N N 310 TYR CB HB2 sing N N 311 TYR CB HB3 sing N N 312 TYR CG CD1 doub Y N 313 TYR CG CD2 sing Y N 314 TYR CD1 CE1 sing Y N 315 TYR CD1 HD1 sing N N 316 TYR CD2 CE2 doub Y N 317 TYR CD2 HD2 sing N N 318 TYR CE1 CZ doub Y N 319 TYR CE1 HE1 sing N N 320 TYR CE2 CZ sing Y N 321 TYR CE2 HE2 sing N N 322 TYR CZ OH sing N N 323 TYR OH HH sing N N 324 TYR OXT HXT sing N N 325 VAL N CA sing N N 326 VAL N H sing N N 327 VAL N H2 sing N N 328 VAL CA C sing N N 329 VAL CA CB sing N N 330 VAL CA HA sing N N 331 VAL C O doub N N 332 VAL C OXT sing N N 333 VAL CB CG1 sing N N 334 VAL CB CG2 sing N N 335 VAL CB HB sing N N 336 VAL CG1 HG11 sing N N 337 VAL CG1 HG12 sing N N 338 VAL CG1 HG13 sing N N 339 VAL CG2 HG21 sing N N 340 VAL CG2 HG22 sing N N 341 VAL CG2 HG23 sing N N 342 VAL OXT HXT sing N N 343 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 700 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2KN2 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_