data_2KP2
# 
_entry.id   2KP2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.392 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2KP2         pdb_00002kp2 10.2210/pdb2kp2/pdb 
RCSB  RCSB101395   ?            ?                   
WWPDB D_1000101395 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-10-27 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2022-03-16 
4 'Structure model' 1 3 2024-05-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Data collection'           
3 3 'Structure model' 'Database references'       
4 3 'Structure model' 'Derived calculations'      
5 4 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' database_2            
2 3 'Structure model' pdbx_nmr_software     
3 3 'Structure model' pdbx_struct_assembly  
4 3 'Structure model' pdbx_struct_oper_list 
5 3 'Structure model' struct_ref_seq_dif    
6 4 'Structure model' chem_comp_atom        
7 4 'Structure model' chem_comp_bond        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_database_2.pdbx_DOI'                
2 3 'Structure model' '_database_2.pdbx_database_accession' 
3 3 'Structure model' '_pdbx_nmr_software.name'             
4 3 'Structure model' '_struct_ref_seq_dif.details'         
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KP2 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2009-10-06 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 6971 BMRB .                  
unspecified 2KP1 PDB  
;a' domain of PDI
;
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kato, K.'      1 
'Yamaguchi, Y.' 2 
'Serve, O.'     3 
# 
_citation.id                        primary 
_citation.title                     
;Redox-Dependent Domain Rearrangement of Protein Disulfide Isomerase Coupled with Exposure of Its Substrate-Binding Hydrophobic Surface
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      2009 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           1089-8638 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19944705 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2009.11.049 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Serve, O.'       1  ? 
primary 'Kamiya, Y.'      2  ? 
primary 'Maeno, A.'       3  ? 
primary 'Nakano, M.'      4  ? 
primary 'Murakami, C.'    5  ? 
primary 'Sasakawa, H.'    6  ? 
primary 'Yamaguchi, Y.'   7  ? 
primary 'Harada, T.'      8  ? 
primary 'Kurimoto, E.'    9  ? 
primary 'Yagi-Utsumi, M.' 10 ? 
primary 'Iguchi, T.'      11 ? 
primary 'Inaba, K.'       12 ? 
primary 'Kikuchi, J.'     13 ? 
primary 'Asami, O.'       14 ? 
primary 'Kajino, T.'      15 ? 
primary 'Oka, T.'         16 ? 
primary 'Nakasako, M.'    17 ? 
primary 'Kato, K.'        18 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Protein disulfide-isomerase' 
_entity.formula_weight             14505.343 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    5.3.4.1 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              
;B' Domain, UNP residues 228-355
;
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        PDI 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLGSPLIGEIGPETYSDYMSAGIPLAYIFAETAEERKELSDKLKPIAEAQRGVINFGTIDAKAFGAHAGNLNLKTDKFP
AFAIQEVAKNQKFPFDQEKEITFEAIKAFVDDFVAGKIEPSIKSEPIPEKQEG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLGSPLIGEIGPETYSDYMSAGIPLAYIFAETAEERKELSDKLKPIAEAQRGVINFGTIDAKAFGAHAGNLNLKTDKFP
AFAIQEVAKNQKFPFDQEKEITFEAIKAFVDDFVAGKIEPSIKSEPIPEKQEG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   PRO n 
1 7   LEU n 
1 8   ILE n 
1 9   GLY n 
1 10  GLU n 
1 11  ILE n 
1 12  GLY n 
1 13  PRO n 
1 14  GLU n 
1 15  THR n 
1 16  TYR n 
1 17  SER n 
1 18  ASP n 
1 19  TYR n 
1 20  MET n 
1 21  SER n 
1 22  ALA n 
1 23  GLY n 
1 24  ILE n 
1 25  PRO n 
1 26  LEU n 
1 27  ALA n 
1 28  TYR n 
1 29  ILE n 
1 30  PHE n 
1 31  ALA n 
1 32  GLU n 
1 33  THR n 
1 34  ALA n 
1 35  GLU n 
1 36  GLU n 
1 37  ARG n 
1 38  LYS n 
1 39  GLU n 
1 40  LEU n 
1 41  SER n 
1 42  ASP n 
1 43  LYS n 
1 44  LEU n 
1 45  LYS n 
1 46  PRO n 
1 47  ILE n 
1 48  ALA n 
1 49  GLU n 
1 50  ALA n 
1 51  GLN n 
1 52  ARG n 
1 53  GLY n 
1 54  VAL n 
1 55  ILE n 
1 56  ASN n 
1 57  PHE n 
1 58  GLY n 
1 59  THR n 
1 60  ILE n 
1 61  ASP n 
1 62  ALA n 
1 63  LYS n 
1 64  ALA n 
1 65  PHE n 
1 66  GLY n 
1 67  ALA n 
1 68  HIS n 
1 69  ALA n 
1 70  GLY n 
1 71  ASN n 
1 72  LEU n 
1 73  ASN n 
1 74  LEU n 
1 75  LYS n 
1 76  THR n 
1 77  ASP n 
1 78  LYS n 
1 79  PHE n 
1 80  PRO n 
1 81  ALA n 
1 82  PHE n 
1 83  ALA n 
1 84  ILE n 
1 85  GLN n 
1 86  GLU n 
1 87  VAL n 
1 88  ALA n 
1 89  LYS n 
1 90  ASN n 
1 91  GLN n 
1 92  LYS n 
1 93  PHE n 
1 94  PRO n 
1 95  PHE n 
1 96  ASP n 
1 97  GLN n 
1 98  GLU n 
1 99  LYS n 
1 100 GLU n 
1 101 ILE n 
1 102 THR n 
1 103 PHE n 
1 104 GLU n 
1 105 ALA n 
1 106 ILE n 
1 107 LYS n 
1 108 ALA n 
1 109 PHE n 
1 110 VAL n 
1 111 ASP n 
1 112 ASP n 
1 113 PHE n 
1 114 VAL n 
1 115 ALA n 
1 116 GLY n 
1 117 LYS n 
1 118 ILE n 
1 119 GLU n 
1 120 PRO n 
1 121 SER n 
1 122 ILE n 
1 123 LYS n 
1 124 SER n 
1 125 GLU n 
1 126 PRO n 
1 127 ILE n 
1 128 PRO n 
1 129 GLU n 
1 130 LYS n 
1 131 GLN n 
1 132 GLU n 
1 133 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Humicola insolens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     34413 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              DE3 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PGEX6P-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   1   GLY GLY A . n 
A 1 2   PRO 2   2   2   PRO PRO A . n 
A 1 3   LEU 3   3   3   LEU LEU A . n 
A 1 4   GLY 4   4   4   GLY GLY A . n 
A 1 5   SER 5   5   5   SER SER A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   ILE 8   8   8   ILE ILE A . n 
A 1 9   GLY 9   9   9   GLY GLY A . n 
A 1 10  GLU 10  10  10  GLU GLU A . n 
A 1 11  ILE 11  11  11  ILE ILE A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  PRO 13  13  13  PRO PRO A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  THR 15  15  15  THR THR A . n 
A 1 16  TYR 16  16  16  TYR TYR A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  ASP 18  18  18  ASP ASP A . n 
A 1 19  TYR 19  19  19  TYR TYR A . n 
A 1 20  MET 20  20  20  MET MET A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  ALA 22  22  22  ALA ALA A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  ILE 24  24  24  ILE ILE A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  TYR 28  28  28  TYR TYR A . n 
A 1 29  ILE 29  29  29  ILE ILE A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  LYS 38  38  38  LYS LYS A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  SER 41  41  41  SER SER A . n 
A 1 42  ASP 42  42  42  ASP ASP A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  PRO 46  46  46  PRO PRO A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  ALA 48  48  48  ALA ALA A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  GLN 51  51  51  GLN GLN A . n 
A 1 52  ARG 52  52  52  ARG ARG A . n 
A 1 53  GLY 53  53  53  GLY GLY A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  ILE 55  55  55  ILE ILE A . n 
A 1 56  ASN 56  56  56  ASN ASN A . n 
A 1 57  PHE 57  57  57  PHE PHE A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  ILE 60  60  60  ILE ILE A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  HIS 68  68  68  HIS HIS A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  GLY 70  70  70  GLY GLY A . n 
A 1 71  ASN 71  71  71  ASN ASN A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  ASN 73  73  73  ASN ASN A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  THR 76  76  76  THR THR A . n 
A 1 77  ASP 77  77  77  ASP ASP A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  PHE 79  79  79  PHE PHE A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  PHE 82  82  82  PHE PHE A . n 
A 1 83  ALA 83  83  83  ALA ALA A . n 
A 1 84  ILE 84  84  84  ILE ILE A . n 
A 1 85  GLN 85  85  85  GLN GLN A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  ASN 90  90  90  ASN ASN A . n 
A 1 91  GLN 91  91  91  GLN GLN A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  PHE 93  93  93  PHE PHE A . n 
A 1 94  PRO 94  94  94  PRO PRO A . n 
A 1 95  PHE 95  95  95  PHE PHE A . n 
A 1 96  ASP 96  96  96  ASP ASP A . n 
A 1 97  GLN 97  97  97  GLN GLN A . n 
A 1 98  GLU 98  98  98  GLU GLU A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 ILE 101 101 101 ILE ILE A . n 
A 1 102 THR 102 102 102 THR THR A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 ALA 108 108 108 ALA ALA A . n 
A 1 109 PHE 109 109 109 PHE PHE A . n 
A 1 110 VAL 110 110 110 VAL VAL A . n 
A 1 111 ASP 111 111 111 ASP ASP A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 PHE 113 113 113 PHE PHE A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 LYS 117 117 117 LYS LYS A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 PRO 120 120 120 PRO PRO A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 ILE 122 122 122 ILE ILE A . n 
A 1 123 LYS 123 123 123 LYS LYS A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 PRO 126 126 126 PRO PRO A . n 
A 1 127 ILE 127 127 127 ILE ILE A . n 
A 1 128 PRO 128 128 128 PRO PRO A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 GLN 131 131 131 GLN GLN A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 GLY 133 133 133 GLY GLY A . n 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2KP2 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KP2 
_struct.title                     
;Solution structure of the b' domain of thermophilic fungal protein disulfide isomerase
;
_struct.pdbx_model_details        'fewest violations, model 10' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KP2 
_struct_keywords.pdbx_keywords   ISOMERASE 
_struct_keywords.text            'THIOREDOXIN FOLD, ISOMERASE, Disulfide bond, Endoplasmic reticulum, Redox-active center' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PDI_HUMIN 
_struct_ref.pdbx_db_accession          P55059 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PLIGEIGPETYSDYMSAGIPLAYIFAETAEERKELSDKLKPIAEAQRGVINFGTIDAKAFGAHAGNLNLKTDKFPAFAIQ
EVAKNQKFPFDQEKEITFEAIKAFVDDFVAGKIEPSIKSEPIPEKQEG
;
_struct_ref.pdbx_align_begin           228 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2KP2 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 6 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 133 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P55059 
_struct_ref_seq.db_align_beg                  228 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  355 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       6 
_struct_ref_seq.pdbx_auth_seq_align_end       133 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2KP2 GLY A 1 ? UNP P55059 ? ? 'expression tag' 1 1 
1 2KP2 PRO A 2 ? UNP P55059 ? ? 'expression tag' 2 2 
1 2KP2 LEU A 3 ? UNP P55059 ? ? 'expression tag' 3 3 
1 2KP2 GLY A 4 ? UNP P55059 ? ? 'expression tag' 4 4 
1 2KP2 SER A 5 ? UNP P55059 ? ? 'expression tag' 5 5 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 15  ? SER A 21  ? THR A 15  SER A 21  1 ? 7  
HELX_P HELX_P2 2 GLU A 36  ? ALA A 50  ? GLU A 36  ALA A 50  1 ? 15 
HELX_P HELX_P3 3 PHE A 65  ? ALA A 67  ? PHE A 65  ALA A 67  5 ? 3  
HELX_P HELX_P4 4 HIS A 68  ? ASN A 73  ? HIS A 68  ASN A 73  1 ? 6  
HELX_P HELX_P5 5 THR A 102 ? ALA A 115 ? THR A 102 ALA A 115 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 8  ? GLU A 10 ? ILE A 8  GLU A 10 
A 2 ASN A 56 ? ASP A 61 ? ASN A 56 ASP A 61 
A 3 LEU A 26 ? ALA A 31 ? LEU A 26 ALA A 31 
A 4 ALA A 81 ? GLN A 85 ? ALA A 81 GLN A 85 
A 5 LYS A 92 ? PRO A 94 ? LYS A 92 PRO A 94 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLY A 9  ? N GLY A 9  O THR A 59 ? O THR A 59 
A 2 3 O ASN A 56 ? O ASN A 56 N ALA A 27 ? N ALA A 27 
A 3 4 N LEU A 26 ? N LEU A 26 O GLN A 85 ? O GLN A 85 
A 4 5 N ILE A 84 ? N ILE A 84 O PHE A 93 ? O PHE A 93 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 6 OD2 A ASP 77  ? ? HZ2 A LYS 78  ? ? 1.59 
2 7 OD1 A ASP 112 ? ? HZ1 A LYS 117 ? ? 1.60 
3 9 OD1 A ASP 61  ? ? H   A PHE 65  ? ? 1.59 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  GLN A 51  ? ? -145.32 33.96   
2  1  ASN A 73  ? ? -176.35 -52.19  
3  1  THR A 76  ? ? 56.43   17.41   
4  1  LYS A 78  ? ? -123.49 -165.29 
5  1  LYS A 99  ? ? -113.63 -89.53  
6  1  GLU A 100 ? ? 176.39  127.33  
7  1  THR A 102 ? ? -123.42 -169.04 
8  1  ILE A 122 ? ? -146.86 -110.49 
9  1  LYS A 123 ? ? 66.22   109.81  
10 2  GLN A 51  ? ? -147.13 36.10   
11 2  VAL A 54  ? ? -138.71 -33.26  
12 2  ASN A 73  ? ? -168.07 -64.89  
13 2  LYS A 78  ? ? -117.84 -160.44 
14 2  PHE A 79  ? ? -59.99  170.66  
15 2  PRO A 80  ? ? -39.35  133.43  
16 2  GLU A 98  ? ? -146.16 18.69   
17 2  GLU A 100 ? ? 68.84   126.55  
18 2  LYS A 123 ? ? 161.62  135.37  
19 3  ASN A 73  ? ? -174.50 -56.71  
20 3  LYS A 78  ? ? -117.84 -160.84 
21 3  PRO A 80  ? ? -39.74  129.65  
22 3  GLU A 100 ? ? 69.64   117.97  
23 3  PRO A 120 ? ? -38.98  118.51  
24 3  ILE A 122 ? ? -139.77 -54.08  
25 3  LYS A 123 ? ? 58.11   72.58   
26 3  GLU A 132 ? ? 68.89   115.77  
27 4  GLN A 51  ? ? -146.64 36.28   
28 4  VAL A 54  ? ? -139.77 -33.73  
29 4  ASN A 73  ? ? -171.48 -60.12  
30 4  LYS A 78  ? ? -106.42 -162.01 
31 4  ASN A 90  ? ? 65.88   86.72   
32 4  GLU A 98  ? ? -149.31 23.66   
33 4  LYS A 99  ? ? -90.76  -81.79  
34 4  GLU A 100 ? ? 172.45  123.63  
35 4  ILE A 122 ? ? -126.83 -54.42  
36 4  GLU A 129 ? ? 69.53   151.94  
37 5  ASN A 73  ? ? 177.78  -60.03  
38 5  LYS A 78  ? ? -119.54 -159.92 
39 5  PHE A 79  ? ? -61.47  -176.37 
40 5  GLU A 98  ? ? -152.22 22.02   
41 5  GLU A 100 ? ? 70.49   133.02  
42 5  THR A 102 ? ? -110.25 -165.93 
43 5  SER A 124 ? ? -154.57 89.07   
44 5  GLU A 129 ? ? -57.07  103.63  
45 6  GLN A 51  ? ? -142.34 31.80   
46 6  VAL A 54  ? ? -130.05 -37.47  
47 6  ASN A 73  ? ? -175.80 -60.22  
48 6  PHE A 79  ? ? 60.07   -171.06 
49 6  GLU A 100 ? ? 66.68   117.31  
50 6  ILE A 122 ? ? 179.67  -45.35  
51 6  LYS A 130 ? ? 68.75   108.63  
52 7  LEU A 7   ? ? -169.73 -61.21  
53 7  ASN A 73  ? ? -169.23 -56.95  
54 7  THR A 76  ? ? 74.70   -13.13  
55 7  PHE A 79  ? ? 56.52   -175.57 
56 7  ASN A 90  ? ? 59.85   80.43   
57 7  GLU A 98  ? ? -142.30 22.63   
58 7  SER A 121 ? ? -82.88  40.00   
59 7  ILE A 122 ? ? -156.89 -82.17  
60 8  SER A 5   ? ? -134.26 -65.27  
61 8  PRO A 6   ? ? -107.63 50.06   
62 8  GLN A 51  ? ? -148.57 35.37   
63 8  VAL A 54  ? ? -138.84 -32.65  
64 8  ASN A 73  ? ? -179.96 -59.63  
65 8  PHE A 79  ? ? -69.16  -172.45 
66 8  GLU A 100 ? ? 72.95   134.00  
67 8  LYS A 123 ? ? 74.14   -157.79 
68 8  SER A 124 ? ? 69.26   126.91  
69 8  LYS A 130 ? ? -69.39  95.22   
70 9  LEU A 3   ? ? 57.10   72.29   
71 9  ASN A 73  ? ? 179.51  -56.74  
72 9  THR A 76  ? ? 59.30   5.78    
73 9  LYS A 78  ? ? -119.21 -158.68 
74 9  GLU A 98  ? ? -154.92 20.96   
75 9  GLU A 100 ? ? 74.09   120.46  
76 9  THR A 102 ? ? -126.03 -164.47 
77 9  PRO A 120 ? ? -51.90  108.67  
78 9  ILE A 122 ? ? -138.55 -50.75  
79 9  GLU A 129 ? ? 63.36   -168.33 
80 10 LEU A 7   ? ? -138.93 -59.04  
81 10 ASN A 73  ? ? -172.94 -57.88  
82 10 PHE A 79  ? ? 60.39   179.74  
83 10 ASN A 90  ? ? 56.44   75.43   
84 10 GLU A 98  ? ? -148.09 32.36   
85 10 GLU A 100 ? ? 74.24   127.69  
86 10 ILE A 122 ? ? -147.80 -41.11  
87 10 GLU A 129 ? ? 68.19   115.97  
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             10 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KP2 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    11.30 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   1.5 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_ensemble_rms.atom_type                              ? 
_pdbx_nmr_ensemble_rms.bond_angle_rms_dev                     ? 
_pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error               ? 
_pdbx_nmr_ensemble_rms.chain_range_begin                      ? 
_pdbx_nmr_ensemble_rms.chain_range_end                        ? 
_pdbx_nmr_ensemble_rms.coord_average_rmsd_method              ? 
_pdbx_nmr_ensemble_rms.covalent_bond_rms_dev                  ? 
_pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error            ? 
_pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev                ? 
_pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error          ? 
_pdbx_nmr_ensemble_rms.distance_rms_dev                       0.07 
_pdbx_nmr_ensemble_rms.distance_rms_dev_error                 ? 
_pdbx_nmr_ensemble_rms.entry_id                               2KP2 
_pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev         ? 
_pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error   ? 
_pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev              ? 
_pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error        ? 
_pdbx_nmr_ensemble_rms.residue_range_begin                    ? 
_pdbx_nmr_ensemble_rms.residue_range_end                      ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KP2 
_pdbx_nmr_representative.selection_criteria   'fewest violations' 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
;1.0mM [U-15N] PDI B'-1, 10mM sodium phosphate-2, 100mM potassium chloride-3, 10mM DTT-4, 99 % D2O
;
1 '99% D2O'         
;1.0mM [U-13C; U-15N] PDI B'-5, 10mM sodium phosphate-6, 100mM potassium chloride-7, 10mM DTT-8, 90% H2O/10% D2O
;
2 '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
;PDI B'-1
;
1.0 ? mM '[U-15N]'        1 
'sodium phosphate-2'   10  ? mM ?                1 
'potassium chloride-3' 100 ? mM ?                1 
DTT-4                  10  ? mM ?                1 
;PDI B'-5
;
1.0 ? mM '[U-13C; U-15N]' 2 
'sodium phosphate-6'   10  ? mM ?                2 
'potassium chloride-7' 100 ? mM ?                2 
DTT-8                  10  ? mM ?                2 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.16 
_pdbx_nmr_exptl_sample_conditions.pH                  6 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature         310 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 2 '2D 1H-1H NOESY'  
1 2 2 '3D 1H-15N NOESY' 
1 3 2 '3D 1H-13C NOESY' 
1 4 1 '2D 1H-15N HSQC'  
# 
_pdbx_nmr_constraints.disulfide_bond_constraints_total_count        ? 
_pdbx_nmr_constraints.entry_id                                      2KP2 
_pdbx_nmr_constraints.hydrogen_bond_constraints_total_count         ? 
_pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_beta-angle_constraints_total_count         ? 
_pdbx_nmr_constraints.NA_chi-angle_constraints_total_count          ? 
_pdbx_nmr_constraints.NA_delta-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count      ? 
_pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_other-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count       ? 
_pdbx_nmr_constraints.NOE_constraints_total                         2276 
_pdbx_nmr_constraints.NOE_interentity_total_count                   ? 
_pdbx_nmr_constraints.NOE_interproton_distance_evaluation           ? 
_pdbx_nmr_constraints.NOE_intraresidue_total_count                  464 
_pdbx_nmr_constraints.NOE_long_range_total_count                    780 
_pdbx_nmr_constraints.NOE_medium_range_total_count                  405 
_pdbx_nmr_constraints.NOE_motional_averaging_correction             ? 
_pdbx_nmr_constraints.NOE_pseudoatom_corrections                    ? 
_pdbx_nmr_constraints.NOE_sequential_total_count                    627 
_pdbx_nmr_constraints.protein_chi_angle_constraints_total_count     ? 
_pdbx_nmr_constraints.protein_other_angle_constraints_total_count   ? 
_pdbx_nmr_constraints.protein_phi_angle_constraints_total_count     70 
_pdbx_nmr_constraints.protein_psi_angle_constraints_total_count     70 
# 
_pdbx_nmr_refine.entry_id           2KP2 
_pdbx_nmr_refine.method             'DGSA-distance geometry simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Bruker Biospin'                            collection                  XwinNMR 2.6   1 
'Bruker Biospin'                            processing                  XwinNMR 2.6   2 
JEOL                                        collection                  Delta   4.3.3 3 
JEOL                                        processing                  Delta   4.3.3 4 
Goddard                                     'chemical shift assignment' Sparky  3.1   5 
Goddard                                     'peak picking'              Sparky  3.1   6 
'Guntert, Mumenthaler, Wuthrich'            'chemical shift assignment' CYANA   2.1   7 
'Guntert, Mumenthaler, Wuthrich'            'structure solution'        CYANA   2.1   8 
'Brunger, Adams, Clore, Gros, Nilges, Read' refinement                  CNS     1.2   9 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
GLN N    N N N 74  
GLN CA   C N S 75  
GLN C    C N N 76  
GLN O    O N N 77  
GLN CB   C N N 78  
GLN CG   C N N 79  
GLN CD   C N N 80  
GLN OE1  O N N 81  
GLN NE2  N N N 82  
GLN OXT  O N N 83  
GLN H    H N N 84  
GLN H2   H N N 85  
GLN HA   H N N 86  
GLN HB2  H N N 87  
GLN HB3  H N N 88  
GLN HG2  H N N 89  
GLN HG3  H N N 90  
GLN HE21 H N N 91  
GLN HE22 H N N 92  
GLN HXT  H N N 93  
GLU N    N N N 94  
GLU CA   C N S 95  
GLU C    C N N 96  
GLU O    O N N 97  
GLU CB   C N N 98  
GLU CG   C N N 99  
GLU CD   C N N 100 
GLU OE1  O N N 101 
GLU OE2  O N N 102 
GLU OXT  O N N 103 
GLU H    H N N 104 
GLU H2   H N N 105 
GLU HA   H N N 106 
GLU HB2  H N N 107 
GLU HB3  H N N 108 
GLU HG2  H N N 109 
GLU HG3  H N N 110 
GLU HE2  H N N 111 
GLU HXT  H N N 112 
GLY N    N N N 113 
GLY CA   C N N 114 
GLY C    C N N 115 
GLY O    O N N 116 
GLY OXT  O N N 117 
GLY H    H N N 118 
GLY H2   H N N 119 
GLY HA2  H N N 120 
GLY HA3  H N N 121 
GLY HXT  H N N 122 
HIS N    N N N 123 
HIS CA   C N S 124 
HIS C    C N N 125 
HIS O    O N N 126 
HIS CB   C N N 127 
HIS CG   C Y N 128 
HIS ND1  N Y N 129 
HIS CD2  C Y N 130 
HIS CE1  C Y N 131 
HIS NE2  N Y N 132 
HIS OXT  O N N 133 
HIS H    H N N 134 
HIS H2   H N N 135 
HIS HA   H N N 136 
HIS HB2  H N N 137 
HIS HB3  H N N 138 
HIS HD1  H N N 139 
HIS HD2  H N N 140 
HIS HE1  H N N 141 
HIS HE2  H N N 142 
HIS HXT  H N N 143 
ILE N    N N N 144 
ILE CA   C N S 145 
ILE C    C N N 146 
ILE O    O N N 147 
ILE CB   C N S 148 
ILE CG1  C N N 149 
ILE CG2  C N N 150 
ILE CD1  C N N 151 
ILE OXT  O N N 152 
ILE H    H N N 153 
ILE H2   H N N 154 
ILE HA   H N N 155 
ILE HB   H N N 156 
ILE HG12 H N N 157 
ILE HG13 H N N 158 
ILE HG21 H N N 159 
ILE HG22 H N N 160 
ILE HG23 H N N 161 
ILE HD11 H N N 162 
ILE HD12 H N N 163 
ILE HD13 H N N 164 
ILE HXT  H N N 165 
LEU N    N N N 166 
LEU CA   C N S 167 
LEU C    C N N 168 
LEU O    O N N 169 
LEU CB   C N N 170 
LEU CG   C N N 171 
LEU CD1  C N N 172 
LEU CD2  C N N 173 
LEU OXT  O N N 174 
LEU H    H N N 175 
LEU H2   H N N 176 
LEU HA   H N N 177 
LEU HB2  H N N 178 
LEU HB3  H N N 179 
LEU HG   H N N 180 
LEU HD11 H N N 181 
LEU HD12 H N N 182 
LEU HD13 H N N 183 
LEU HD21 H N N 184 
LEU HD22 H N N 185 
LEU HD23 H N N 186 
LEU HXT  H N N 187 
LYS N    N N N 188 
LYS CA   C N S 189 
LYS C    C N N 190 
LYS O    O N N 191 
LYS CB   C N N 192 
LYS CG   C N N 193 
LYS CD   C N N 194 
LYS CE   C N N 195 
LYS NZ   N N N 196 
LYS OXT  O N N 197 
LYS H    H N N 198 
LYS H2   H N N 199 
LYS HA   H N N 200 
LYS HB2  H N N 201 
LYS HB3  H N N 202 
LYS HG2  H N N 203 
LYS HG3  H N N 204 
LYS HD2  H N N 205 
LYS HD3  H N N 206 
LYS HE2  H N N 207 
LYS HE3  H N N 208 
LYS HZ1  H N N 209 
LYS HZ2  H N N 210 
LYS HZ3  H N N 211 
LYS HXT  H N N 212 
MET N    N N N 213 
MET CA   C N S 214 
MET C    C N N 215 
MET O    O N N 216 
MET CB   C N N 217 
MET CG   C N N 218 
MET SD   S N N 219 
MET CE   C N N 220 
MET OXT  O N N 221 
MET H    H N N 222 
MET H2   H N N 223 
MET HA   H N N 224 
MET HB2  H N N 225 
MET HB3  H N N 226 
MET HG2  H N N 227 
MET HG3  H N N 228 
MET HE1  H N N 229 
MET HE2  H N N 230 
MET HE3  H N N 231 
MET HXT  H N N 232 
PHE N    N N N 233 
PHE CA   C N S 234 
PHE C    C N N 235 
PHE O    O N N 236 
PHE CB   C N N 237 
PHE CG   C Y N 238 
PHE CD1  C Y N 239 
PHE CD2  C Y N 240 
PHE CE1  C Y N 241 
PHE CE2  C Y N 242 
PHE CZ   C Y N 243 
PHE OXT  O N N 244 
PHE H    H N N 245 
PHE H2   H N N 246 
PHE HA   H N N 247 
PHE HB2  H N N 248 
PHE HB3  H N N 249 
PHE HD1  H N N 250 
PHE HD2  H N N 251 
PHE HE1  H N N 252 
PHE HE2  H N N 253 
PHE HZ   H N N 254 
PHE HXT  H N N 255 
PRO N    N N N 256 
PRO CA   C N S 257 
PRO C    C N N 258 
PRO O    O N N 259 
PRO CB   C N N 260 
PRO CG   C N N 261 
PRO CD   C N N 262 
PRO OXT  O N N 263 
PRO H    H N N 264 
PRO HA   H N N 265 
PRO HB2  H N N 266 
PRO HB3  H N N 267 
PRO HG2  H N N 268 
PRO HG3  H N N 269 
PRO HD2  H N N 270 
PRO HD3  H N N 271 
PRO HXT  H N N 272 
SER N    N N N 273 
SER CA   C N S 274 
SER C    C N N 275 
SER O    O N N 276 
SER CB   C N N 277 
SER OG   O N N 278 
SER OXT  O N N 279 
SER H    H N N 280 
SER H2   H N N 281 
SER HA   H N N 282 
SER HB2  H N N 283 
SER HB3  H N N 284 
SER HG   H N N 285 
SER HXT  H N N 286 
THR N    N N N 287 
THR CA   C N S 288 
THR C    C N N 289 
THR O    O N N 290 
THR CB   C N R 291 
THR OG1  O N N 292 
THR CG2  C N N 293 
THR OXT  O N N 294 
THR H    H N N 295 
THR H2   H N N 296 
THR HA   H N N 297 
THR HB   H N N 298 
THR HG1  H N N 299 
THR HG21 H N N 300 
THR HG22 H N N 301 
THR HG23 H N N 302 
THR HXT  H N N 303 
TYR N    N N N 304 
TYR CA   C N S 305 
TYR C    C N N 306 
TYR O    O N N 307 
TYR CB   C N N 308 
TYR CG   C Y N 309 
TYR CD1  C Y N 310 
TYR CD2  C Y N 311 
TYR CE1  C Y N 312 
TYR CE2  C Y N 313 
TYR CZ   C Y N 314 
TYR OH   O N N 315 
TYR OXT  O N N 316 
TYR H    H N N 317 
TYR H2   H N N 318 
TYR HA   H N N 319 
TYR HB2  H N N 320 
TYR HB3  H N N 321 
TYR HD1  H N N 322 
TYR HD2  H N N 323 
TYR HE1  H N N 324 
TYR HE2  H N N 325 
TYR HH   H N N 326 
TYR HXT  H N N 327 
VAL N    N N N 328 
VAL CA   C N S 329 
VAL C    C N N 330 
VAL O    O N N 331 
VAL CB   C N N 332 
VAL CG1  C N N 333 
VAL CG2  C N N 334 
VAL OXT  O N N 335 
VAL H    H N N 336 
VAL H2   H N N 337 
VAL HA   H N N 338 
VAL HB   H N N 339 
VAL HG11 H N N 340 
VAL HG12 H N N 341 
VAL HG13 H N N 342 
VAL HG21 H N N 343 
VAL HG22 H N N 344 
VAL HG23 H N N 345 
VAL HXT  H N N 346 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
GLN N   CA   sing N N 70  
GLN N   H    sing N N 71  
GLN N   H2   sing N N 72  
GLN CA  C    sing N N 73  
GLN CA  CB   sing N N 74  
GLN CA  HA   sing N N 75  
GLN C   O    doub N N 76  
GLN C   OXT  sing N N 77  
GLN CB  CG   sing N N 78  
GLN CB  HB2  sing N N 79  
GLN CB  HB3  sing N N 80  
GLN CG  CD   sing N N 81  
GLN CG  HG2  sing N N 82  
GLN CG  HG3  sing N N 83  
GLN CD  OE1  doub N N 84  
GLN CD  NE2  sing N N 85  
GLN NE2 HE21 sing N N 86  
GLN NE2 HE22 sing N N 87  
GLN OXT HXT  sing N N 88  
GLU N   CA   sing N N 89  
GLU N   H    sing N N 90  
GLU N   H2   sing N N 91  
GLU CA  C    sing N N 92  
GLU CA  CB   sing N N 93  
GLU CA  HA   sing N N 94  
GLU C   O    doub N N 95  
GLU C   OXT  sing N N 96  
GLU CB  CG   sing N N 97  
GLU CB  HB2  sing N N 98  
GLU CB  HB3  sing N N 99  
GLU CG  CD   sing N N 100 
GLU CG  HG2  sing N N 101 
GLU CG  HG3  sing N N 102 
GLU CD  OE1  doub N N 103 
GLU CD  OE2  sing N N 104 
GLU OE2 HE2  sing N N 105 
GLU OXT HXT  sing N N 106 
GLY N   CA   sing N N 107 
GLY N   H    sing N N 108 
GLY N   H2   sing N N 109 
GLY CA  C    sing N N 110 
GLY CA  HA2  sing N N 111 
GLY CA  HA3  sing N N 112 
GLY C   O    doub N N 113 
GLY C   OXT  sing N N 114 
GLY OXT HXT  sing N N 115 
HIS N   CA   sing N N 116 
HIS N   H    sing N N 117 
HIS N   H2   sing N N 118 
HIS CA  C    sing N N 119 
HIS CA  CB   sing N N 120 
HIS CA  HA   sing N N 121 
HIS C   O    doub N N 122 
HIS C   OXT  sing N N 123 
HIS CB  CG   sing N N 124 
HIS CB  HB2  sing N N 125 
HIS CB  HB3  sing N N 126 
HIS CG  ND1  sing Y N 127 
HIS CG  CD2  doub Y N 128 
HIS ND1 CE1  doub Y N 129 
HIS ND1 HD1  sing N N 130 
HIS CD2 NE2  sing Y N 131 
HIS CD2 HD2  sing N N 132 
HIS CE1 NE2  sing Y N 133 
HIS CE1 HE1  sing N N 134 
HIS NE2 HE2  sing N N 135 
HIS OXT HXT  sing N N 136 
ILE N   CA   sing N N 137 
ILE N   H    sing N N 138 
ILE N   H2   sing N N 139 
ILE CA  C    sing N N 140 
ILE CA  CB   sing N N 141 
ILE CA  HA   sing N N 142 
ILE C   O    doub N N 143 
ILE C   OXT  sing N N 144 
ILE CB  CG1  sing N N 145 
ILE CB  CG2  sing N N 146 
ILE CB  HB   sing N N 147 
ILE CG1 CD1  sing N N 148 
ILE CG1 HG12 sing N N 149 
ILE CG1 HG13 sing N N 150 
ILE CG2 HG21 sing N N 151 
ILE CG2 HG22 sing N N 152 
ILE CG2 HG23 sing N N 153 
ILE CD1 HD11 sing N N 154 
ILE CD1 HD12 sing N N 155 
ILE CD1 HD13 sing N N 156 
ILE OXT HXT  sing N N 157 
LEU N   CA   sing N N 158 
LEU N   H    sing N N 159 
LEU N   H2   sing N N 160 
LEU CA  C    sing N N 161 
LEU CA  CB   sing N N 162 
LEU CA  HA   sing N N 163 
LEU C   O    doub N N 164 
LEU C   OXT  sing N N 165 
LEU CB  CG   sing N N 166 
LEU CB  HB2  sing N N 167 
LEU CB  HB3  sing N N 168 
LEU CG  CD1  sing N N 169 
LEU CG  CD2  sing N N 170 
LEU CG  HG   sing N N 171 
LEU CD1 HD11 sing N N 172 
LEU CD1 HD12 sing N N 173 
LEU CD1 HD13 sing N N 174 
LEU CD2 HD21 sing N N 175 
LEU CD2 HD22 sing N N 176 
LEU CD2 HD23 sing N N 177 
LEU OXT HXT  sing N N 178 
LYS N   CA   sing N N 179 
LYS N   H    sing N N 180 
LYS N   H2   sing N N 181 
LYS CA  C    sing N N 182 
LYS CA  CB   sing N N 183 
LYS CA  HA   sing N N 184 
LYS C   O    doub N N 185 
LYS C   OXT  sing N N 186 
LYS CB  CG   sing N N 187 
LYS CB  HB2  sing N N 188 
LYS CB  HB3  sing N N 189 
LYS CG  CD   sing N N 190 
LYS CG  HG2  sing N N 191 
LYS CG  HG3  sing N N 192 
LYS CD  CE   sing N N 193 
LYS CD  HD2  sing N N 194 
LYS CD  HD3  sing N N 195 
LYS CE  NZ   sing N N 196 
LYS CE  HE2  sing N N 197 
LYS CE  HE3  sing N N 198 
LYS NZ  HZ1  sing N N 199 
LYS NZ  HZ2  sing N N 200 
LYS NZ  HZ3  sing N N 201 
LYS OXT HXT  sing N N 202 
MET N   CA   sing N N 203 
MET N   H    sing N N 204 
MET N   H2   sing N N 205 
MET CA  C    sing N N 206 
MET CA  CB   sing N N 207 
MET CA  HA   sing N N 208 
MET C   O    doub N N 209 
MET C   OXT  sing N N 210 
MET CB  CG   sing N N 211 
MET CB  HB2  sing N N 212 
MET CB  HB3  sing N N 213 
MET CG  SD   sing N N 214 
MET CG  HG2  sing N N 215 
MET CG  HG3  sing N N 216 
MET SD  CE   sing N N 217 
MET CE  HE1  sing N N 218 
MET CE  HE2  sing N N 219 
MET CE  HE3  sing N N 220 
MET OXT HXT  sing N N 221 
PHE N   CA   sing N N 222 
PHE N   H    sing N N 223 
PHE N   H2   sing N N 224 
PHE CA  C    sing N N 225 
PHE CA  CB   sing N N 226 
PHE CA  HA   sing N N 227 
PHE C   O    doub N N 228 
PHE C   OXT  sing N N 229 
PHE CB  CG   sing N N 230 
PHE CB  HB2  sing N N 231 
PHE CB  HB3  sing N N 232 
PHE CG  CD1  doub Y N 233 
PHE CG  CD2  sing Y N 234 
PHE CD1 CE1  sing Y N 235 
PHE CD1 HD1  sing N N 236 
PHE CD2 CE2  doub Y N 237 
PHE CD2 HD2  sing N N 238 
PHE CE1 CZ   doub Y N 239 
PHE CE1 HE1  sing N N 240 
PHE CE2 CZ   sing Y N 241 
PHE CE2 HE2  sing N N 242 
PHE CZ  HZ   sing N N 243 
PHE OXT HXT  sing N N 244 
PRO N   CA   sing N N 245 
PRO N   CD   sing N N 246 
PRO N   H    sing N N 247 
PRO CA  C    sing N N 248 
PRO CA  CB   sing N N 249 
PRO CA  HA   sing N N 250 
PRO C   O    doub N N 251 
PRO C   OXT  sing N N 252 
PRO CB  CG   sing N N 253 
PRO CB  HB2  sing N N 254 
PRO CB  HB3  sing N N 255 
PRO CG  CD   sing N N 256 
PRO CG  HG2  sing N N 257 
PRO CG  HG3  sing N N 258 
PRO CD  HD2  sing N N 259 
PRO CD  HD3  sing N N 260 
PRO OXT HXT  sing N N 261 
SER N   CA   sing N N 262 
SER N   H    sing N N 263 
SER N   H2   sing N N 264 
SER CA  C    sing N N 265 
SER CA  CB   sing N N 266 
SER CA  HA   sing N N 267 
SER C   O    doub N N 268 
SER C   OXT  sing N N 269 
SER CB  OG   sing N N 270 
SER CB  HB2  sing N N 271 
SER CB  HB3  sing N N 272 
SER OG  HG   sing N N 273 
SER OXT HXT  sing N N 274 
THR N   CA   sing N N 275 
THR N   H    sing N N 276 
THR N   H2   sing N N 277 
THR CA  C    sing N N 278 
THR CA  CB   sing N N 279 
THR CA  HA   sing N N 280 
THR C   O    doub N N 281 
THR C   OXT  sing N N 282 
THR CB  OG1  sing N N 283 
THR CB  CG2  sing N N 284 
THR CB  HB   sing N N 285 
THR OG1 HG1  sing N N 286 
THR CG2 HG21 sing N N 287 
THR CG2 HG22 sing N N 288 
THR CG2 HG23 sing N N 289 
THR OXT HXT  sing N N 290 
TYR N   CA   sing N N 291 
TYR N   H    sing N N 292 
TYR N   H2   sing N N 293 
TYR CA  C    sing N N 294 
TYR CA  CB   sing N N 295 
TYR CA  HA   sing N N 296 
TYR C   O    doub N N 297 
TYR C   OXT  sing N N 298 
TYR CB  CG   sing N N 299 
TYR CB  HB2  sing N N 300 
TYR CB  HB3  sing N N 301 
TYR CG  CD1  doub Y N 302 
TYR CG  CD2  sing Y N 303 
TYR CD1 CE1  sing Y N 304 
TYR CD1 HD1  sing N N 305 
TYR CD2 CE2  doub Y N 306 
TYR CD2 HD2  sing N N 307 
TYR CE1 CZ   doub Y N 308 
TYR CE1 HE1  sing N N 309 
TYR CE2 CZ   sing Y N 310 
TYR CE2 HE2  sing N N 311 
TYR CZ  OH   sing N N 312 
TYR OH  HH   sing N N 313 
TYR OXT HXT  sing N N 314 
VAL N   CA   sing N N 315 
VAL N   H    sing N N 316 
VAL N   H2   sing N N 317 
VAL CA  C    sing N N 318 
VAL CA  CB   sing N N 319 
VAL CA  HA   sing N N 320 
VAL C   O    doub N N 321 
VAL C   OXT  sing N N 322 
VAL CB  CG1  sing N N 323 
VAL CB  CG2  sing N N 324 
VAL CB  HB   sing N N 325 
VAL CG1 HG11 sing N N 326 
VAL CG1 HG12 sing N N 327 
VAL CG1 HG13 sing N N 328 
VAL CG2 HG21 sing N N 329 
VAL CG2 HG22 sing N N 330 
VAL CG2 HG23 sing N N 331 
VAL OXT HXT  sing N N 332 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
800 Bruker DRX 1 'BRUKER DRX' 
920 JEOL   ECA 2 'JEOL ECA'   
# 
_atom_sites.entry_id                    2KP2 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_