data_2KPJ # _entry.id 2KPJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KPJ pdb_00002kpj 10.2210/pdb2kpj/pdb RCSB RCSB101412 ? ? BMRB 16557 ? ? WWPDB D_1000101412 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 16557 BMRB unspecified . ErR9 TargetDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KPJ _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-10-16 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wu, Y.' 1 'Eletsky, A.' 2 'Lee, D.' 3 'Ghosh, A.' 4 'Buchwald, W.' 5 'Zhang, Q.' 6 'Janjua, H.' 7 'Garcia, E.' 8 'Nair, R.' 9 'Sukumaran, D.' 10 'Rost, B.' 11 'Acton, T.' 12 'Xiao, R.' 13 'Everett, J.' 14 'Montelione, G.T.' 15 'Szyperski, T.' 16 'Northeast Structural Genomics Consortium (NESG)' 17 # _citation.id primary _citation.title ;Solution Structure Of Protein SOS-response transcriptional repressor, LexA From Eubacterium rectale. Northeast Structural Genomics Consortium Target ErR9A ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wu, Y.' 1 ? primary 'Eletsky, A.' 2 ? primary 'Lee, D.' 3 ? primary 'Ghosh, A.' 4 ? primary 'Buchwald, W.' 5 ? primary 'Zhang, Q.' 6 ? primary 'Janjua, H.' 7 ? primary 'Garcia, E.' 8 ? primary 'Nair, R.' 9 ? primary 'Sukumaran, D.' 10 ? primary 'Rost, B.' 11 ? primary 'Acton, T.' 12 ? primary 'Everett, J.' 13 ? primary 'Montelione, G.T.' 14 ? primary 'Szyperski, T.' 15 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'SOS-response transcriptional repressor, LexA' _entity.formula_weight 10723.237 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'sequence database residues 1-86' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVKDKQKAIFSENLNSYIAKSEKTQLEIAKSIGVSPQTFNTWCKGIAIPRMGKVQALADYFNINKSDLIEDKKLNIDTVP IESGYTLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MVKDKQKAIFSENLNSYIAKSEKTQLEIAKSIGVSPQTFNTWCKGIAIPRMGKVQALADYFNINKSDLIEDKKLNIDTVP IESGYTLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ErR9 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 LYS n 1 4 ASP n 1 5 LYS n 1 6 GLN n 1 7 LYS n 1 8 ALA n 1 9 ILE n 1 10 PHE n 1 11 SER n 1 12 GLU n 1 13 ASN n 1 14 LEU n 1 15 ASN n 1 16 SER n 1 17 TYR n 1 18 ILE n 1 19 ALA n 1 20 LYS n 1 21 SER n 1 22 GLU n 1 23 LYS n 1 24 THR n 1 25 GLN n 1 26 LEU n 1 27 GLU n 1 28 ILE n 1 29 ALA n 1 30 LYS n 1 31 SER n 1 32 ILE n 1 33 GLY n 1 34 VAL n 1 35 SER n 1 36 PRO n 1 37 GLN n 1 38 THR n 1 39 PHE n 1 40 ASN n 1 41 THR n 1 42 TRP n 1 43 CYS n 1 44 LYS n 1 45 GLY n 1 46 ILE n 1 47 ALA n 1 48 ILE n 1 49 PRO n 1 50 ARG n 1 51 MET n 1 52 GLY n 1 53 LYS n 1 54 VAL n 1 55 GLN n 1 56 ALA n 1 57 LEU n 1 58 ALA n 1 59 ASP n 1 60 TYR n 1 61 PHE n 1 62 ASN n 1 63 ILE n 1 64 ASN n 1 65 LYS n 1 66 SER n 1 67 ASP n 1 68 LEU n 1 69 ILE n 1 70 GLU n 1 71 ASP n 1 72 LYS n 1 73 LYS n 1 74 LEU n 1 75 ASN n 1 76 ILE n 1 77 ASP n 1 78 THR n 1 79 VAL n 1 80 PRO n 1 81 ILE n 1 82 GLU n 1 83 SER n 1 84 GLY n 1 85 TYR n 1 86 THR n 1 87 LEU n 1 88 GLU n 1 89 HIS n 1 90 HIS n 1 91 HIS n 1 92 HIS n 1 93 HIS n 1 94 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene EUBREC_1258 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 33656 / VPI 0990' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Eubacterium rectale ATCC 33656' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 515619 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'BL21(DE3)+Magic' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C4Z801_EUBR3 _struct_ref.pdbx_db_accession C4Z801 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVKDKQKAIFSENLNSYIAKSEKTQLEIAKSIGVSPQTFNTWCKGIAIPRMGKVQALADYFNINKSDLIEDKKLNIDTVP IESGYT ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KPJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 86 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C4Z801 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 86 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 86 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KPJ LEU A 87 ? UNP C4Z801 ? ? 'expression tag' 87 1 1 2KPJ GLU A 88 ? UNP C4Z801 ? ? 'expression tag' 88 2 1 2KPJ HIS A 89 ? UNP C4Z801 ? ? 'expression tag' 89 3 1 2KPJ HIS A 90 ? UNP C4Z801 ? ? 'expression tag' 90 4 1 2KPJ HIS A 91 ? UNP C4Z801 ? ? 'expression tag' 91 5 1 2KPJ HIS A 92 ? UNP C4Z801 ? ? 'expression tag' 92 6 1 2KPJ HIS A 93 ? UNP C4Z801 ? ? 'expression tag' 93 7 1 2KPJ HIS A 94 ? UNP C4Z801 ? ? 'expression tag' 94 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC' 1 3 1 '4,3D, GFT HNNCABCA' 1 4 1 '4,3D, GFT CABCACONNH' 1 5 1 '4,3D, GFT HCCH COSY' 1 6 1 '3D, 15N-13C RESOLVEDSIMULTANIOUS NOESY' 1 7 1 '3D HNCO' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.2 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.0 mM [U-100% 13C; U-100% 15N] protein, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1.0 mM [U-5% 13C; U-100% 15N] protein, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 800 Bruker DMX 2 'Bruker DMX' 800 Bruker DMX 3 'Bruker DMX' # _pdbx_nmr_refine.entry_id 2KPJ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KPJ _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KPJ _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign ? 1 'Huang, Tejero, Powers and Montelione' 'structure solution' AutoStructure ? 2 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 3 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 4 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 5 'Bhattacharya and Montelione' refinement PSVS ? 6 'Cornilescu, Delaglio and Bax' refinement TALOS ? 7 'Bartels et al.' 'data analysis' XEASY ? 8 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KPJ _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KPJ _struct.title ;Solution Structure Of Protein SOS-response transcriptional repressor, LexA From Eubacterium rectale. Northeast Structural Genomics Consortium Target ErR9A ; _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KPJ _struct_keywords.pdbx_keywords 'TRANSCRIPTION REGULATOR' _struct_keywords.text ;NESG, GFT, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, TRANSCRIPTION REGULATOR ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 4 ? ALA A 19 ? ASP A 4 ALA A 19 1 ? 16 HELX_P HELX_P2 2 THR A 24 ? GLY A 33 ? THR A 24 GLY A 33 1 ? 10 HELX_P HELX_P3 3 SER A 35 ? LYS A 44 ? SER A 35 LYS A 44 1 ? 10 HELX_P HELX_P4 4 ARG A 50 ? ASN A 62 ? ARG A 50 ASN A 62 1 ? 13 HELX_P HELX_P5 5 LYS A 65 ? GLU A 70 ? LYS A 65 GLU A 70 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2KPJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 HIS 89 89 89 HIS HIS A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 HIS 91 91 91 HIS HIS A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 HIS 93 93 93 HIS HIS A . n A 1 94 HIS 94 94 94 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-11-17 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-26 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' Other 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_oper_list 4 3 'Structure model' struct_ref_seq_dif 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_struct_ref_seq_dif.details' 3 4 'Structure model' '_database_2.pdbx_DOI' 4 4 'Structure model' '_database_2.pdbx_database_accession' 5 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id protein-1 1.0 ? mM '[U-100% 13C; U-100% 15N]' 1 protein-2 1.0 ? mM '[U-5% 13C; U-100% 15N]' 2 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 6 OE1 A GLU 22 ? ? HZ1 A LYS 23 ? ? 1.59 2 7 OD2 A ASP 71 ? ? HZ3 A LYS 73 ? ? 1.56 3 8 H1 A MET 1 ? ? OE1 A GLU 88 ? ? 1.57 4 9 OE1 A GLU 12 ? ? HZ2 A LYS 72 ? ? 1.59 5 19 OD2 A ASP 4 ? ? HZ1 A LYS 7 ? ? 1.55 6 19 HZ2 A LYS 20 ? ? OD2 A ASP 77 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 2 ? ? 60.38 66.72 2 1 LYS A 72 ? ? -78.83 41.53 3 1 LYS A 73 ? ? -83.68 46.93 4 1 HIS A 90 ? ? -104.23 -71.49 5 1 HIS A 91 ? ? 67.99 102.19 6 2 ASN A 62 ? ? 51.93 71.27 7 2 ASP A 77 ? ? -69.40 79.00 8 2 GLU A 82 ? ? 66.46 -177.25 9 2 SER A 83 ? ? 69.91 -175.12 10 3 LYS A 73 ? ? -88.88 31.08 11 3 ASP A 77 ? ? -166.35 112.76 12 3 HIS A 90 ? ? 54.97 88.49 13 3 HIS A 92 ? ? 61.33 -87.51 14 3 HIS A 93 ? ? -144.01 22.44 15 4 ASN A 75 ? ? 70.68 91.29 16 4 HIS A 89 ? ? 43.89 78.69 17 5 LYS A 3 ? ? -138.21 -76.75 18 5 ASN A 75 ? ? 70.49 118.48 19 5 TYR A 85 ? ? 59.48 -162.24 20 5 LEU A 87 ? ? 64.17 -161.03 21 6 GLU A 22 ? ? 73.51 -37.71 22 6 LYS A 72 ? ? -83.53 33.63 23 6 PRO A 80 ? ? -66.70 -164.74 24 6 TYR A 85 ? ? 61.08 -164.41 25 6 HIS A 90 ? ? 70.43 -68.85 26 6 HIS A 92 ? ? 65.87 78.77 27 7 VAL A 2 ? ? 75.71 117.37 28 7 LYS A 72 ? ? -78.22 33.58 29 7 PRO A 80 ? ? -73.82 -164.64 30 7 TYR A 85 ? ? 58.31 80.11 31 7 THR A 86 ? ? 65.47 82.42 32 7 HIS A 91 ? ? -102.45 -71.55 33 8 ASP A 4 ? ? 71.42 111.48 34 8 GLU A 70 ? ? -48.62 150.45 35 8 ASN A 75 ? ? 73.49 102.54 36 8 THR A 78 ? ? -48.59 107.51 37 8 HIS A 90 ? ? -116.84 -161.36 38 9 HIS A 93 ? ? -100.80 66.94 39 10 ASP A 4 ? ? -65.13 96.72 40 10 ILE A 63 ? ? -104.56 -87.31 41 10 GLU A 82 ? ? -55.59 103.21 42 10 HIS A 91 ? ? 61.75 90.89 43 11 LYS A 3 ? ? 61.74 103.23 44 11 LYS A 73 ? ? -84.49 44.23 45 11 ASN A 75 ? ? -92.98 33.17 46 11 HIS A 92 ? ? -94.14 -79.13 47 11 HIS A 93 ? ? 67.86 141.17 48 12 VAL A 2 ? ? 74.30 -58.86 49 12 LYS A 3 ? ? 66.21 176.97 50 12 HIS A 91 ? ? 63.19 -173.48 51 13 LYS A 3 ? ? 68.17 86.45 52 13 ASN A 75 ? ? 67.70 107.59 53 14 HIS A 91 ? ? -64.50 -70.56 54 14 HIS A 92 ? ? 176.94 -90.55 55 14 HIS A 93 ? ? -149.29 -58.26 56 15 LYS A 3 ? ? 66.50 -74.46 57 15 THR A 78 ? ? -67.93 -163.99 58 15 PRO A 80 ? ? -79.24 -162.74 59 15 GLU A 82 ? ? -66.02 -169.74 60 15 LEU A 87 ? ? 64.86 91.84 61 16 VAL A 2 ? ? 48.52 78.08 62 16 ASP A 4 ? ? 69.66 105.20 63 16 LEU A 74 ? ? -64.57 84.34 64 16 THR A 78 ? ? -179.02 149.55 65 16 PRO A 80 ? ? -52.35 105.93 66 16 HIS A 93 ? ? 70.75 134.16 67 17 GLU A 88 ? ? -105.88 -164.04 68 18 ASP A 4 ? ? 62.98 112.06 69 18 LYS A 73 ? ? -84.20 42.01 70 18 THR A 78 ? ? -46.61 108.09 71 18 PRO A 80 ? ? -38.71 86.49 72 18 TYR A 85 ? ? -161.50 117.67 73 18 GLU A 88 ? ? 69.73 154.42 74 18 HIS A 89 ? ? 74.06 112.70 75 18 HIS A 90 ? ? -79.70 -71.88 76 18 HIS A 91 ? ? -160.30 -98.58 77 18 HIS A 92 ? ? -173.47 -160.54 78 19 LYS A 3 ? ? -100.25 74.55 79 19 PRO A 49 ? ? -65.57 -170.42 80 19 ASP A 77 ? ? -142.40 11.25 81 19 THR A 78 ? ? -115.82 -166.40 82 19 THR A 86 ? ? -140.96 20.51 83 20 LYS A 3 ? ? 58.97 78.97 84 20 ASP A 4 ? ? 72.48 107.98 85 20 ASN A 75 ? ? -104.16 -165.14 86 20 LEU A 87 ? ? 74.22 131.47 #