data_2KUH # _entry.id 2KUH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KUH pdb_00002kuh 10.2210/pdb2kuh/pdb RCSB RCSB101587 ? ? WWPDB D_1000101587 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-03-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2013-12-11 4 'Structure model' 1 3 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_nmr_spectrometer 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_spectrometer.model' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.value' 17 4 'Structure model' '_struct_conn.pdbx_dist_value' 18 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 25 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 26 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 27 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KUH _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-02-17 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2KUG PDB 'N-terminal domain of the same complex' unspecified 16765 BMRB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Juranic, N.' 1 'Macura, S.' 2 'Simeonov, M.V.' 3 'Jones, K.A.' 4 'Penheiter, A.R.' 5 'Hock, T.J.' 6 'Streiff, J.H.' 7 # _citation.id primary _citation.title 'Halothane binds to druggable sites in the [Ca2+]4-calmodulin (CaM) complex, but does not inhibit [Ca2+]4-CaM activation of kinase.' _citation.journal_abbrev 'J. Serb. Chem. Soc.' _citation.journal_volume 78 _citation.page_first 1655 _citation.page_last 1670 _citation.year 2013 _citation.journal_id_ASTM ? _citation.country RS _citation.journal_id_ISSN 0352-5139 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Juranic, N.O.' 1 ? primary 'Jones, K.A.' 2 ? primary 'Penheiter, A.R.' 3 ? primary 'Hock, T.J.' 4 ? primary 'Streiff, J.H.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Calmodulin 7737.468 1 ? ? 'C-TERMINAL DOMAIN EF-hands 3 and 4' ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 3 non-polymer syn 2-BROMO-2-CHLORO-1,1,1-TRIFLUOROETHANE 197.382 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name CaM # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code EEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK _entity_poly.pdbx_seq_one_letter_code_can EEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 2-BROMO-2-CHLORO-1,1,1-TRIFLUOROETHANE HLT # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 GLU n 1 3 GLU n 1 4 ILE n 1 5 ARG n 1 6 GLU n 1 7 ALA n 1 8 PHE n 1 9 ARG n 1 10 VAL n 1 11 PHE n 1 12 ASP n 1 13 LYS n 1 14 ASP n 1 15 GLY n 1 16 ASN n 1 17 GLY n 1 18 TYR n 1 19 ILE n 1 20 SER n 1 21 ALA n 1 22 ALA n 1 23 GLU n 1 24 LEU n 1 25 ARG n 1 26 HIS n 1 27 VAL n 1 28 MET n 1 29 THR n 1 30 ASN n 1 31 LEU n 1 32 GLY n 1 33 GLU n 1 34 LYS n 1 35 LEU n 1 36 THR n 1 37 ASP n 1 38 GLU n 1 39 GLU n 1 40 VAL n 1 41 ASP n 1 42 GLU n 1 43 MET n 1 44 ILE n 1 45 ARG n 1 46 GLU n 1 47 ALA n 1 48 ASP n 1 49 ILE n 1 50 ASP n 1 51 GLY n 1 52 ASP n 1 53 GLY n 1 54 GLN n 1 55 VAL n 1 56 ASN n 1 57 TYR n 1 58 GLU n 1 59 GLU n 1 60 PHE n 1 61 VAL n 1 62 GLN n 1 63 MET n 1 64 MET n 1 65 THR n 1 66 ALA n 1 67 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CALM1, CALM, CAM, CAM1, CALM2, CAM2, CAMB, CALM3, CALML2, CAM3, CAMC, CAMIII' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)-pLysS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'pET 15b' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HLT non-polymer . 2-BROMO-2-CHLORO-1,1,1-TRIFLUOROETHANE ? 'C2 H Br Cl F3' 197.382 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 82 82 GLU GLU A . n A 1 2 GLU 2 83 83 GLU GLU A . n A 1 3 GLU 3 84 84 GLU GLU A . n A 1 4 ILE 4 85 85 ILE ILE A . n A 1 5 ARG 5 86 86 ARG ARG A . n A 1 6 GLU 6 87 87 GLU GLU A . n A 1 7 ALA 7 88 88 ALA ALA A . n A 1 8 PHE 8 89 89 PHE PHE A . n A 1 9 ARG 9 90 90 ARG ARG A . n A 1 10 VAL 10 91 91 VAL VAL A . n A 1 11 PHE 11 92 92 PHE PHE A . n A 1 12 ASP 12 93 93 ASP ASP A . n A 1 13 LYS 13 94 94 LYS LYS A . n A 1 14 ASP 14 95 95 ASP ASP A . n A 1 15 GLY 15 96 96 GLY GLY A . n A 1 16 ASN 16 97 97 ASN ASN A . n A 1 17 GLY 17 98 98 GLY GLY A . n A 1 18 TYR 18 99 99 TYR TYR A . n A 1 19 ILE 19 100 100 ILE ILE A . n A 1 20 SER 20 101 101 SER SER A . n A 1 21 ALA 21 102 102 ALA ALA A . n A 1 22 ALA 22 103 103 ALA ALA A . n A 1 23 GLU 23 104 104 GLU GLU A . n A 1 24 LEU 24 105 105 LEU LEU A . n A 1 25 ARG 25 106 106 ARG ARG A . n A 1 26 HIS 26 107 107 HIS HIS A . n A 1 27 VAL 27 108 108 VAL VAL A . n A 1 28 MET 28 109 109 MET MET A . n A 1 29 THR 29 110 110 THR THR A . n A 1 30 ASN 30 111 111 ASN ASN A . n A 1 31 LEU 31 112 112 LEU LEU A . n A 1 32 GLY 32 113 113 GLY GLY A . n A 1 33 GLU 33 114 114 GLU GLU A . n A 1 34 LYS 34 115 115 LYS LYS A . n A 1 35 LEU 35 116 116 LEU LEU A . n A 1 36 THR 36 117 117 THR THR A . n A 1 37 ASP 37 118 118 ASP ASP A . n A 1 38 GLU 38 119 119 GLU GLU A . n A 1 39 GLU 39 120 120 GLU GLU A . n A 1 40 VAL 40 121 121 VAL VAL A . n A 1 41 ASP 41 122 122 ASP ASP A . n A 1 42 GLU 42 123 123 GLU GLU A . n A 1 43 MET 43 124 124 MET MET A . n A 1 44 ILE 44 125 125 ILE ILE A . n A 1 45 ARG 45 126 126 ARG ARG A . n A 1 46 GLU 46 127 127 GLU GLU A . n A 1 47 ALA 47 128 128 ALA ALA A . n A 1 48 ASP 48 129 129 ASP ASP A . n A 1 49 ILE 49 130 130 ILE ILE A . n A 1 50 ASP 50 131 131 ASP ASP A . n A 1 51 GLY 51 132 132 GLY GLY A . n A 1 52 ASP 52 133 133 ASP ASP A . n A 1 53 GLY 53 134 134 GLY GLY A . n A 1 54 GLN 54 135 135 GLN GLN A . n A 1 55 VAL 55 136 136 VAL VAL A . n A 1 56 ASN 56 137 137 ASN ASN A . n A 1 57 TYR 57 138 138 TYR TYR A . n A 1 58 GLU 58 139 139 GLU GLU A . n A 1 59 GLU 59 140 140 GLU GLU A . n A 1 60 PHE 60 141 141 PHE PHE A . n A 1 61 VAL 61 142 142 VAL VAL A . n A 1 62 GLN 62 143 143 GLN GLN A . n A 1 63 MET 63 144 144 MET MET A . n A 1 64 MET 64 145 145 MET MET A . n A 1 65 THR 65 146 146 THR THR A . n A 1 66 ALA 66 147 147 ALA ALA A . n A 1 67 LYS 67 148 148 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 992 992 CA CA A . C 2 CA 1 993 993 CA CA A . D 3 HLT 1 150 150 HLT HLT A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ;The mechanism(s) of volatile anesthetic effects are poorly understood. We examined whether VA binding to druggable sites in calmodulin would effect [Ca2+]4-CaM dependent activity of enzymes. We used high resolution NMR spectroscopy to determine the structure of the halothane [Ca2+]4-CaM complex, determining that the halothane molecules bind in the druggable sites. We used fluorescence assays to determine that VA mediate [Ca2+]4-CaM activation of smMLCK, but not the kd of [Ca2+]4-CaM binding to skMLCK. These results suggest that VA do not mediate [Ca2+]4-CaM dependent MLCK activity via direct interactions with druggable sites on [Ca2+]4-CaM. ; _exptl.entry_id 2KUH _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KUH _struct.title 'Halothane binds to druggable sites in calcium-calmodulin: Solution structure of halothane-CaM C-terminal domain' _struct.pdbx_model_details 'closest to the average, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KUH _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text ;CALMODULIN, CALCIUM BINDING, VOLATILE ANESTHETIC, HALOTHANE, Cytoskeleton, Isopeptide bond, Methylation, Phosphoprotein, METAL BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CALM_HUMAN _struct_ref.pdbx_db_accession P62158 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK _struct_ref.pdbx_align_begin 83 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KUH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 67 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P62158 _struct_ref_seq.db_align_beg 83 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 149 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 82 _struct_ref_seq.pdbx_auth_seq_align_end 148 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 1 ? ASP A 12 ? GLU A 82 ASP A 93 1 ? 12 HELX_P HELX_P2 2 SER A 20 ? GLY A 32 ? SER A 101 GLY A 113 1 ? 13 HELX_P HELX_P3 3 THR A 36 ? ASP A 48 ? THR A 117 ASP A 129 1 ? 13 HELX_P HELX_P4 4 TYR A 57 ? THR A 65 ? TYR A 138 THR A 146 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 12 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 93 A CA 992 1_555 ? ? ? ? ? ? ? 2.633 ? ? metalc2 metalc ? ? A ASP 14 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 95 A CA 992 1_555 ? ? ? ? ? ? ? 2.803 ? ? metalc3 metalc ? ? A ASN 16 OD1 ? ? ? 1_555 B CA . CA ? ? A ASN 97 A CA 992 1_555 ? ? ? ? ? ? ? 2.513 ? ? metalc4 metalc ? ? A TYR 18 O ? ? ? 1_555 B CA . CA ? ? A TYR 99 A CA 992 1_555 ? ? ? ? ? ? ? 2.552 ? ? metalc5 metalc ? ? A GLU 23 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 104 A CA 992 1_555 ? ? ? ? ? ? ? 2.562 ? ? metalc6 metalc ? ? A GLU 23 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 104 A CA 992 1_555 ? ? ? ? ? ? ? 2.634 ? ? metalc7 metalc ? ? A ASP 48 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 129 A CA 993 1_555 ? ? ? ? ? ? ? 2.558 ? ? metalc8 metalc ? ? A ASP 50 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 131 A CA 993 1_555 ? ? ? ? ? ? ? 2.561 ? ? metalc9 metalc ? ? A ASP 50 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 131 A CA 993 1_555 ? ? ? ? ? ? ? 2.575 ? ? metalc10 metalc ? ? A ASP 52 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 133 A CA 993 1_555 ? ? ? ? ? ? ? 2.499 ? ? metalc11 metalc ? ? A ASP 52 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 133 A CA 993 1_555 ? ? ? ? ? ? ? 2.868 ? ? metalc12 metalc ? ? A GLN 54 O ? ? ? 1_555 C CA . CA ? ? A GLN 135 A CA 993 1_555 ? ? ? ? ? ? ? 2.483 ? ? metalc13 metalc ? ? A GLU 59 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 140 A CA 993 1_555 ? ? ? ? ? ? ? 2.581 ? ? metalc14 metalc ? ? A GLU 59 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 140 A CA 993 1_555 ? ? ? ? ? ? ? 2.587 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 12 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 992 ? 1_555 OD1 ? A ASP 14 ? A ASP 95 ? 1_555 54.7 ? 2 OD1 ? A ASP 12 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 992 ? 1_555 OD1 ? A ASN 16 ? A ASN 97 ? 1_555 100.5 ? 3 OD1 ? A ASP 14 ? A ASP 95 ? 1_555 CA ? B CA . ? A CA 992 ? 1_555 OD1 ? A ASN 16 ? A ASN 97 ? 1_555 72.8 ? 4 OD1 ? A ASP 12 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 992 ? 1_555 O ? A TYR 18 ? A TYR 99 ? 1_555 88.3 ? 5 OD1 ? A ASP 14 ? A ASP 95 ? 1_555 CA ? B CA . ? A CA 992 ? 1_555 O ? A TYR 18 ? A TYR 99 ? 1_555 131.4 ? 6 OD1 ? A ASN 16 ? A ASN 97 ? 1_555 CA ? B CA . ? A CA 992 ? 1_555 O ? A TYR 18 ? A TYR 99 ? 1_555 86.6 ? 7 OD1 ? A ASP 12 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 992 ? 1_555 OE1 ? A GLU 23 ? A GLU 104 ? 1_555 81.0 ? 8 OD1 ? A ASP 14 ? A ASP 95 ? 1_555 CA ? B CA . ? A CA 992 ? 1_555 OE1 ? A GLU 23 ? A GLU 104 ? 1_555 114.7 ? 9 OD1 ? A ASN 16 ? A ASN 97 ? 1_555 CA ? B CA . ? A CA 992 ? 1_555 OE1 ? A GLU 23 ? A GLU 104 ? 1_555 170.9 ? 10 O ? A TYR 18 ? A TYR 99 ? 1_555 CA ? B CA . ? A CA 992 ? 1_555 OE1 ? A GLU 23 ? A GLU 104 ? 1_555 84.5 ? 11 OD1 ? A ASP 12 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 992 ? 1_555 OE2 ? A GLU 23 ? A GLU 104 ? 1_555 81.9 ? 12 OD1 ? A ASP 14 ? A ASP 95 ? 1_555 CA ? B CA . ? A CA 992 ? 1_555 OE2 ? A GLU 23 ? A GLU 104 ? 1_555 76.7 ? 13 OD1 ? A ASN 16 ? A ASN 97 ? 1_555 CA ? B CA . ? A CA 992 ? 1_555 OE2 ? A GLU 23 ? A GLU 104 ? 1_555 139.9 ? 14 O ? A TYR 18 ? A TYR 99 ? 1_555 CA ? B CA . ? A CA 992 ? 1_555 OE2 ? A GLU 23 ? A GLU 104 ? 1_555 133.4 ? 15 OE1 ? A GLU 23 ? A GLU 104 ? 1_555 CA ? B CA . ? A CA 992 ? 1_555 OE2 ? A GLU 23 ? A GLU 104 ? 1_555 49.1 ? 16 OD1 ? A ASP 48 ? A ASP 129 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 OD1 ? A ASP 50 ? A ASP 131 ? 1_555 68.0 ? 17 OD1 ? A ASP 48 ? A ASP 129 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 OD2 ? A ASP 50 ? A ASP 131 ? 1_555 107.3 ? 18 OD1 ? A ASP 50 ? A ASP 131 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 OD2 ? A ASP 50 ? A ASP 131 ? 1_555 49.8 ? 19 OD1 ? A ASP 48 ? A ASP 129 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 OD1 ? A ASP 52 ? A ASP 133 ? 1_555 74.8 ? 20 OD1 ? A ASP 50 ? A ASP 131 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 OD1 ? A ASP 52 ? A ASP 133 ? 1_555 80.7 ? 21 OD2 ? A ASP 50 ? A ASP 131 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 OD1 ? A ASP 52 ? A ASP 133 ? 1_555 119.9 ? 22 OD1 ? A ASP 48 ? A ASP 129 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 OD2 ? A ASP 52 ? A ASP 133 ? 1_555 119.2 ? 23 OD1 ? A ASP 50 ? A ASP 131 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 OD2 ? A ASP 52 ? A ASP 133 ? 1_555 85.0 ? 24 OD2 ? A ASP 50 ? A ASP 131 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 OD2 ? A ASP 52 ? A ASP 133 ? 1_555 91.5 ? 25 OD1 ? A ASP 52 ? A ASP 133 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 OD2 ? A ASP 52 ? A ASP 133 ? 1_555 46.8 ? 26 OD1 ? A ASP 48 ? A ASP 129 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 O ? A GLN 54 ? A GLN 135 ? 1_555 73.0 ? 27 OD1 ? A ASP 50 ? A ASP 131 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 O ? A GLN 54 ? A GLN 135 ? 1_555 135.4 ? 28 OD2 ? A ASP 50 ? A ASP 131 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 O ? A GLN 54 ? A GLN 135 ? 1_555 171.3 ? 29 OD1 ? A ASP 52 ? A ASP 133 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 O ? A GLN 54 ? A GLN 135 ? 1_555 68.7 ? 30 OD2 ? A ASP 52 ? A ASP 133 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 O ? A GLN 54 ? A GLN 135 ? 1_555 95.9 ? 31 OD1 ? A ASP 48 ? A ASP 129 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 OE2 ? A GLU 59 ? A GLU 140 ? 1_555 61.3 ? 32 OD1 ? A ASP 50 ? A ASP 131 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 OE2 ? A GLU 59 ? A GLU 140 ? 1_555 66.6 ? 33 OD2 ? A ASP 50 ? A ASP 131 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 OE2 ? A GLU 59 ? A GLU 140 ? 1_555 62.1 ? 34 OD1 ? A ASP 52 ? A ASP 133 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 OE2 ? A GLU 59 ? A GLU 140 ? 1_555 132.2 ? 35 OD2 ? A ASP 52 ? A ASP 133 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 OE2 ? A GLU 59 ? A GLU 140 ? 1_555 149.5 ? 36 O ? A GLN 54 ? A GLN 135 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 OE2 ? A GLU 59 ? A GLU 140 ? 1_555 111.8 ? 37 OD1 ? A ASP 48 ? A ASP 129 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 OE1 ? A GLU 59 ? A GLU 140 ? 1_555 82.9 ? 38 OD1 ? A ASP 50 ? A ASP 131 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 OE1 ? A GLU 59 ? A GLU 140 ? 1_555 115.8 ? 39 OD2 ? A ASP 50 ? A ASP 131 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 OE1 ? A GLU 59 ? A GLU 140 ? 1_555 92.4 ? 40 OD1 ? A ASP 52 ? A ASP 133 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 OE1 ? A GLU 59 ? A GLU 140 ? 1_555 144.8 ? 41 OD2 ? A ASP 52 ? A ASP 133 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 OE1 ? A GLU 59 ? A GLU 140 ? 1_555 155.1 ? 42 O ? A GLN 54 ? A GLN 135 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 OE1 ? A GLU 59 ? A GLU 140 ? 1_555 79.0 ? 43 OE2 ? A GLU 59 ? A GLU 140 ? 1_555 CA ? C CA . ? A CA 993 ? 1_555 OE1 ? A GLU 59 ? A GLU 140 ? 1_555 49.3 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 18 ? ILE A 19 ? TYR A 99 ILE A 100 A 2 VAL A 55 ? ASN A 56 ? VAL A 136 ASN A 137 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 19 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 100 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 55 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 136 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 992 ? 5 'BINDING SITE FOR RESIDUE CA A 992' AC2 Software A CA 993 ? 5 'BINDING SITE FOR RESIDUE CA A 993' AC3 Software A HLT 150 ? 4 'BINDING SITE FOR RESIDUE HLT A 150' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 12 ? ASP A 93 . ? 1_555 ? 2 AC1 5 ASP A 14 ? ASP A 95 . ? 1_555 ? 3 AC1 5 ASN A 16 ? ASN A 97 . ? 1_555 ? 4 AC1 5 TYR A 18 ? TYR A 99 . ? 1_555 ? 5 AC1 5 GLU A 23 ? GLU A 104 . ? 1_555 ? 6 AC2 5 ASP A 48 ? ASP A 129 . ? 1_555 ? 7 AC2 5 ASP A 50 ? ASP A 131 . ? 1_555 ? 8 AC2 5 ASP A 52 ? ASP A 133 . ? 1_555 ? 9 AC2 5 GLN A 54 ? GLN A 135 . ? 1_555 ? 10 AC2 5 GLU A 59 ? GLU A 140 . ? 1_555 ? 11 AC3 4 MET A 28 ? MET A 109 . ? 1_555 ? 12 AC3 4 MET A 43 ? MET A 124 . ? 1_555 ? 13 AC3 4 GLU A 46 ? GLU A 127 . ? 1_555 ? 14 AC3 4 MET A 63 ? MET A 144 . ? 1_555 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 5 _pdbx_validate_close_contact.auth_atom_id_1 NH2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 106 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OD1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ASP _pdbx_validate_close_contact.auth_seq_id_2 118 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.99 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 NE A ARG 86 ? ? CZ A ARG 86 ? ? NH2 A ARG 86 ? ? 116.68 120.30 -3.62 0.50 N 2 5 NE A ARG 86 ? ? CZ A ARG 86 ? ? NH2 A ARG 86 ? ? 117.09 120.30 -3.21 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 147 ? ? 56.25 -167.21 2 2 ALA A 147 ? ? 57.03 -163.63 3 3 ALA A 147 ? ? 52.66 -159.09 4 4 ALA A 147 ? ? 56.62 -168.70 5 5 ALA A 147 ? ? 56.68 -162.41 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 5 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KUH _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KUH _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;2 mM [U-99% 13C; U-99% 15N] CALCIUM ION, 20 mM CALCIUM ION, 20 mM N-{[2-({[1-(4-CARBOXYBUTANOYL)AMINO]-2-PHENYLETHYL}-HYDROXYPHOSPHINYL)OXY]ACETYL}-2-PHENYLETHYLAMINE, 95% H2O/5% D2O ; 1 '95% H2O/5% D2O' ;2 mM [U-99% 15N] CALCIUM ION, 20 mM CALCIUM ION, 20 mM N-{[2-({[1-(4-CARBOXYBUTANOYL)AMINO]-2-PHENYLETHYL}-HYDROXYPHOSPHINYL)OXY]ACETYL}-2-PHENYLETHYLAMINE, 95% H2O/5% D2O ; 2 '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'CALCIUM ION-1' 2 ? mM '[U-99% 13C; U-99% 15N]' 1 'CALCIUM ION-2' 20 ? mM ? 1 'N-{[2-({[1-(4-CARBOXYBUTANOYL)AMINO]-2-PHENYLETHYL}-HYDROXYPHOSPHINYL)OXY]ACETYL}-2-PHENYLETHYLAMINE-3' 20 ? mM ? 1 'CALCIUM ION-4' 2 ? mM '[U-99% 15N]' 2 'CALCIUM ION-5' 20 ? mM ? 2 'N-{[2-({[1-(4-CARBOXYBUTANOYL)AMINO]-2-PHENYLETHYL}-HYDROXYPHOSPHINYL)OXY]ACETYL}-2-PHENYLETHYLAMINE-6' 20 ? mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 7.2 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D HNCO' 1 2 1 '3D HNCA' 1 3 1 '3D HNCACB' 1 4 1 '3D HBHA(CO)NH' 1 5 1 '3D H(CCO)NH' 1 6 1 '3D HCCH-TOCSY' 1 7 1 '3D HCCH-COSY' 1 8 1 '3D 1H-15N NOESY' 1 9 1 '3D 1H-13C NOESY' 1 10 2 '3D HNHA' 1 11 2 '2D 1H-15N NOE' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KUH _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 46 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 808 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 337 _pdbx_nmr_constraints.NOE_long_range_total_count 137 _pdbx_nmr_constraints.NOE_medium_range_total_count 137 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 188 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 65 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 65 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 65 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 65 # _pdbx_nmr_refine.entry_id 2KUH _pdbx_nmr_refine.method 'simulated annealing, CHARMm22 energy minimization' _pdbx_nmr_refine.details 'XPLOR, 100 steps steepest descend - final refinement' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Brunger 'geometry optimization' X-PLOR 'MSI XPLOR 3.843' 1 Brunger refinement X-PLOR 'MSI XPLOR 3.843' 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 HLT F1 F N N 145 HLT C2 C N N 146 HLT F2 F N N 147 HLT F3 F N N 148 HLT C1 C N R 149 HLT BR BR N N 150 HLT CL CL N N 151 HLT HC1 H N N 152 ILE N N N N 153 ILE CA C N S 154 ILE C C N N 155 ILE O O N N 156 ILE CB C N S 157 ILE CG1 C N N 158 ILE CG2 C N N 159 ILE CD1 C N N 160 ILE OXT O N N 161 ILE H H N N 162 ILE H2 H N N 163 ILE HA H N N 164 ILE HB H N N 165 ILE HG12 H N N 166 ILE HG13 H N N 167 ILE HG21 H N N 168 ILE HG22 H N N 169 ILE HG23 H N N 170 ILE HD11 H N N 171 ILE HD12 H N N 172 ILE HD13 H N N 173 ILE HXT H N N 174 LEU N N N N 175 LEU CA C N S 176 LEU C C N N 177 LEU O O N N 178 LEU CB C N N 179 LEU CG C N N 180 LEU CD1 C N N 181 LEU CD2 C N N 182 LEU OXT O N N 183 LEU H H N N 184 LEU H2 H N N 185 LEU HA H N N 186 LEU HB2 H N N 187 LEU HB3 H N N 188 LEU HG H N N 189 LEU HD11 H N N 190 LEU HD12 H N N 191 LEU HD13 H N N 192 LEU HD21 H N N 193 LEU HD22 H N N 194 LEU HD23 H N N 195 LEU HXT H N N 196 LYS N N N N 197 LYS CA C N S 198 LYS C C N N 199 LYS O O N N 200 LYS CB C N N 201 LYS CG C N N 202 LYS CD C N N 203 LYS CE C N N 204 LYS NZ N N N 205 LYS OXT O N N 206 LYS H H N N 207 LYS H2 H N N 208 LYS HA H N N 209 LYS HB2 H N N 210 LYS HB3 H N N 211 LYS HG2 H N N 212 LYS HG3 H N N 213 LYS HD2 H N N 214 LYS HD3 H N N 215 LYS HE2 H N N 216 LYS HE3 H N N 217 LYS HZ1 H N N 218 LYS HZ2 H N N 219 LYS HZ3 H N N 220 LYS HXT H N N 221 MET N N N N 222 MET CA C N S 223 MET C C N N 224 MET O O N N 225 MET CB C N N 226 MET CG C N N 227 MET SD S N N 228 MET CE C N N 229 MET OXT O N N 230 MET H H N N 231 MET H2 H N N 232 MET HA H N N 233 MET HB2 H N N 234 MET HB3 H N N 235 MET HG2 H N N 236 MET HG3 H N N 237 MET HE1 H N N 238 MET HE2 H N N 239 MET HE3 H N N 240 MET HXT H N N 241 PHE N N N N 242 PHE CA C N S 243 PHE C C N N 244 PHE O O N N 245 PHE CB C N N 246 PHE CG C Y N 247 PHE CD1 C Y N 248 PHE CD2 C Y N 249 PHE CE1 C Y N 250 PHE CE2 C Y N 251 PHE CZ C Y N 252 PHE OXT O N N 253 PHE H H N N 254 PHE H2 H N N 255 PHE HA H N N 256 PHE HB2 H N N 257 PHE HB3 H N N 258 PHE HD1 H N N 259 PHE HD2 H N N 260 PHE HE1 H N N 261 PHE HE2 H N N 262 PHE HZ H N N 263 PHE HXT H N N 264 SER N N N N 265 SER CA C N S 266 SER C C N N 267 SER O O N N 268 SER CB C N N 269 SER OG O N N 270 SER OXT O N N 271 SER H H N N 272 SER H2 H N N 273 SER HA H N N 274 SER HB2 H N N 275 SER HB3 H N N 276 SER HG H N N 277 SER HXT H N N 278 THR N N N N 279 THR CA C N S 280 THR C C N N 281 THR O O N N 282 THR CB C N R 283 THR OG1 O N N 284 THR CG2 C N N 285 THR OXT O N N 286 THR H H N N 287 THR H2 H N N 288 THR HA H N N 289 THR HB H N N 290 THR HG1 H N N 291 THR HG21 H N N 292 THR HG22 H N N 293 THR HG23 H N N 294 THR HXT H N N 295 TYR N N N N 296 TYR CA C N S 297 TYR C C N N 298 TYR O O N N 299 TYR CB C N N 300 TYR CG C Y N 301 TYR CD1 C Y N 302 TYR CD2 C Y N 303 TYR CE1 C Y N 304 TYR CE2 C Y N 305 TYR CZ C Y N 306 TYR OH O N N 307 TYR OXT O N N 308 TYR H H N N 309 TYR H2 H N N 310 TYR HA H N N 311 TYR HB2 H N N 312 TYR HB3 H N N 313 TYR HD1 H N N 314 TYR HD2 H N N 315 TYR HE1 H N N 316 TYR HE2 H N N 317 TYR HH H N N 318 TYR HXT H N N 319 VAL N N N N 320 VAL CA C N S 321 VAL C C N N 322 VAL O O N N 323 VAL CB C N N 324 VAL CG1 C N N 325 VAL CG2 C N N 326 VAL OXT O N N 327 VAL H H N N 328 VAL H2 H N N 329 VAL HA H N N 330 VAL HB H N N 331 VAL HG11 H N N 332 VAL HG12 H N N 333 VAL HG13 H N N 334 VAL HG21 H N N 335 VAL HG22 H N N 336 VAL HG23 H N N 337 VAL HXT H N N 338 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HLT F1 C2 sing N N 137 HLT C2 F2 sing N N 138 HLT C2 F3 sing N N 139 HLT C2 C1 sing N N 140 HLT C1 BR sing N N 141 HLT C1 CL sing N N 142 HLT C1 HC1 sing N N 143 ILE N CA sing N N 144 ILE N H sing N N 145 ILE N H2 sing N N 146 ILE CA C sing N N 147 ILE CA CB sing N N 148 ILE CA HA sing N N 149 ILE C O doub N N 150 ILE C OXT sing N N 151 ILE CB CG1 sing N N 152 ILE CB CG2 sing N N 153 ILE CB HB sing N N 154 ILE CG1 CD1 sing N N 155 ILE CG1 HG12 sing N N 156 ILE CG1 HG13 sing N N 157 ILE CG2 HG21 sing N N 158 ILE CG2 HG22 sing N N 159 ILE CG2 HG23 sing N N 160 ILE CD1 HD11 sing N N 161 ILE CD1 HD12 sing N N 162 ILE CD1 HD13 sing N N 163 ILE OXT HXT sing N N 164 LEU N CA sing N N 165 LEU N H sing N N 166 LEU N H2 sing N N 167 LEU CA C sing N N 168 LEU CA CB sing N N 169 LEU CA HA sing N N 170 LEU C O doub N N 171 LEU C OXT sing N N 172 LEU CB CG sing N N 173 LEU CB HB2 sing N N 174 LEU CB HB3 sing N N 175 LEU CG CD1 sing N N 176 LEU CG CD2 sing N N 177 LEU CG HG sing N N 178 LEU CD1 HD11 sing N N 179 LEU CD1 HD12 sing N N 180 LEU CD1 HD13 sing N N 181 LEU CD2 HD21 sing N N 182 LEU CD2 HD22 sing N N 183 LEU CD2 HD23 sing N N 184 LEU OXT HXT sing N N 185 LYS N CA sing N N 186 LYS N H sing N N 187 LYS N H2 sing N N 188 LYS CA C sing N N 189 LYS CA CB sing N N 190 LYS CA HA sing N N 191 LYS C O doub N N 192 LYS C OXT sing N N 193 LYS CB CG sing N N 194 LYS CB HB2 sing N N 195 LYS CB HB3 sing N N 196 LYS CG CD sing N N 197 LYS CG HG2 sing N N 198 LYS CG HG3 sing N N 199 LYS CD CE sing N N 200 LYS CD HD2 sing N N 201 LYS CD HD3 sing N N 202 LYS CE NZ sing N N 203 LYS CE HE2 sing N N 204 LYS CE HE3 sing N N 205 LYS NZ HZ1 sing N N 206 LYS NZ HZ2 sing N N 207 LYS NZ HZ3 sing N N 208 LYS OXT HXT sing N N 209 MET N CA sing N N 210 MET N H sing N N 211 MET N H2 sing N N 212 MET CA C sing N N 213 MET CA CB sing N N 214 MET CA HA sing N N 215 MET C O doub N N 216 MET C OXT sing N N 217 MET CB CG sing N N 218 MET CB HB2 sing N N 219 MET CB HB3 sing N N 220 MET CG SD sing N N 221 MET CG HG2 sing N N 222 MET CG HG3 sing N N 223 MET SD CE sing N N 224 MET CE HE1 sing N N 225 MET CE HE2 sing N N 226 MET CE HE3 sing N N 227 MET OXT HXT sing N N 228 PHE N CA sing N N 229 PHE N H sing N N 230 PHE N H2 sing N N 231 PHE CA C sing N N 232 PHE CA CB sing N N 233 PHE CA HA sing N N 234 PHE C O doub N N 235 PHE C OXT sing N N 236 PHE CB CG sing N N 237 PHE CB HB2 sing N N 238 PHE CB HB3 sing N N 239 PHE CG CD1 doub Y N 240 PHE CG CD2 sing Y N 241 PHE CD1 CE1 sing Y N 242 PHE CD1 HD1 sing N N 243 PHE CD2 CE2 doub Y N 244 PHE CD2 HD2 sing N N 245 PHE CE1 CZ doub Y N 246 PHE CE1 HE1 sing N N 247 PHE CE2 CZ sing Y N 248 PHE CE2 HE2 sing N N 249 PHE CZ HZ sing N N 250 PHE OXT HXT sing N N 251 SER N CA sing N N 252 SER N H sing N N 253 SER N H2 sing N N 254 SER CA C sing N N 255 SER CA CB sing N N 256 SER CA HA sing N N 257 SER C O doub N N 258 SER C OXT sing N N 259 SER CB OG sing N N 260 SER CB HB2 sing N N 261 SER CB HB3 sing N N 262 SER OG HG sing N N 263 SER OXT HXT sing N N 264 THR N CA sing N N 265 THR N H sing N N 266 THR N H2 sing N N 267 THR CA C sing N N 268 THR CA CB sing N N 269 THR CA HA sing N N 270 THR C O doub N N 271 THR C OXT sing N N 272 THR CB OG1 sing N N 273 THR CB CG2 sing N N 274 THR CB HB sing N N 275 THR OG1 HG1 sing N N 276 THR CG2 HG21 sing N N 277 THR CG2 HG22 sing N N 278 THR CG2 HG23 sing N N 279 THR OXT HXT sing N N 280 TYR N CA sing N N 281 TYR N H sing N N 282 TYR N H2 sing N N 283 TYR CA C sing N N 284 TYR CA CB sing N N 285 TYR CA HA sing N N 286 TYR C O doub N N 287 TYR C OXT sing N N 288 TYR CB CG sing N N 289 TYR CB HB2 sing N N 290 TYR CB HB3 sing N N 291 TYR CG CD1 doub Y N 292 TYR CG CD2 sing Y N 293 TYR CD1 CE1 sing Y N 294 TYR CD1 HD1 sing N N 295 TYR CD2 CE2 doub Y N 296 TYR CD2 HD2 sing N N 297 TYR CE1 CZ doub Y N 298 TYR CE1 HE1 sing N N 299 TYR CE2 CZ sing Y N 300 TYR CE2 HE2 sing N N 301 TYR CZ OH sing N N 302 TYR OH HH sing N N 303 TYR OXT HXT sing N N 304 VAL N CA sing N N 305 VAL N H sing N N 306 VAL N H2 sing N N 307 VAL CA C sing N N 308 VAL CA CB sing N N 309 VAL CA HA sing N N 310 VAL C O doub N N 311 VAL C OXT sing N N 312 VAL CB CG1 sing N N 313 VAL CB CG2 sing N N 314 VAL CB HB sing N N 315 VAL CG1 HG11 sing N N 316 VAL CG1 HG12 sing N N 317 VAL CG1 HG13 sing N N 318 VAL CG2 HG21 sing N N 319 VAL CG2 HG22 sing N N 320 VAL CG2 HG23 sing N N 321 VAL OXT HXT sing N N 322 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 700 Bruker AVANCE 1 'Bruker Avance' 500 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2KUH _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol BR C CA CL F H N O S # loop_