data_2KUK # _entry.id 2KUK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KUK pdb_00002kuk 10.2210/pdb2kuk/pdb RCSB RCSB101590 ? ? WWPDB D_1000101590 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-01-12 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_entry_details 5 3 'Structure model' pdbx_modification_feature 6 3 'Structure model' pdbx_nmr_software 7 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KUK _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2010-02-18 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Daly, N.L.' 1 'Chen, B.' 2 'Nguyencong, P.' 3 'Craik, D.J.' 4 # _citation.id primary _citation.title 'Structure and Activity of the Leaf-Specific Cyclotide vhl-2' _citation.journal_abbrev AUST.J.CHEM. _citation.journal_volume 63 _citation.page_first 771 _citation.page_last 778 _citation.year 2010 _citation.journal_id_ASTM AJCHAS _citation.country AT _citation.journal_id_ISSN 0004-9425 _citation.journal_id_CSD 0154 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI 10.1071/CH10007 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Daly, N.L.' 1 ? primary 'Chen, B.' 2 ? primary 'Nguyencong, P.' 3 ? primary 'Craik, D.J.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'Leaf cyclotide 2' _entity.formula_weight 3200.624 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name Vhl-2 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code CGETCFTGTCYTNGCTCDPWPVCTRNGLPV _entity_poly.pdbx_seq_one_letter_code_can CGETCFTGTCYTNGCTCDPWPVCTRNGLPV _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CYS n 1 2 GLY n 1 3 GLU n 1 4 THR n 1 5 CYS n 1 6 PHE n 1 7 THR n 1 8 GLY n 1 9 THR n 1 10 CYS n 1 11 TYR n 1 12 THR n 1 13 ASN n 1 14 GLY n 1 15 CYS n 1 16 THR n 1 17 CYS n 1 18 ASP n 1 19 PRO n 1 20 TRP n 1 21 PRO n 1 22 VAL n 1 23 CYS n 1 24 THR n 1 25 ARG n 1 26 ASN n 1 27 GLY n 1 28 LEU n 1 29 PRO n 1 30 VAL n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'Australian violet' _entity_src_nat.pdbx_organism_scientific 'Viola hederacea' _entity_src_nat.pdbx_ncbi_taxonomy_id 180952 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CYS 1 1 1 CYS CYS A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 VAL 30 30 30 VAL VAL A . n # _cell.entry_id 2KUK _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2KUK _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KUK _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KUK _struct.title 'Solution structure of vhl-2' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KUK _struct_keywords.pdbx_keywords 'ANTIVIRAL PROTEIN' _struct_keywords.text 'beta strands, beta turn, Disulfide bond, Knottin, Plant defense, ANTIVIRAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP VHL2_VIOHE P85231 1 CGETCFTGTCYTNGCTCDPWPVCTRN 5 ? 2 UNP VHL2_VIOHE P85231 1 GLPV 1 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2KUK A 1 ? 26 ? P85231 5 ? 30 ? 1 26 2 2 2KUK A 27 ? 30 ? P85231 1 ? 4 ? 27 30 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 1 SG ? ? ? 1_555 A CYS 15 SG ? ? A CYS 1 A CYS 15 1_555 ? ? ? ? ? ? ? 2.034 ? ? disulf2 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 17 SG ? ? A CYS 5 A CYS 17 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf3 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 23 SG ? ? A CYS 10 A CYS 23 1_555 ? ? ? ? ? ? ? 2.035 ? ? covale1 covale both ? A CYS 1 N ? ? ? 1_555 A VAL 30 C ? ? A CYS 1 A VAL 30 1_555 ? ? ? ? ? ? ? 1.325 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 1 ? CYS A 15 ? CYS A 1 ? 1_555 CYS A 15 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 5 ? CYS A 17 ? CYS A 5 ? 1_555 CYS A 17 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 10 ? CYS A 23 ? CYS A 10 ? 1_555 CYS A 23 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 1 ? VAL A 30 ? CYS A 1 ? 1_555 VAL A 30 ? 1_555 N C . . . None 'Non-standard linkage' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TRP 20 A . ? TRP 20 A PRO 21 A ? PRO 21 A 1 0.88 2 TRP 20 A . ? TRP 20 A PRO 21 A ? PRO 21 A 2 0.72 3 TRP 20 A . ? TRP 20 A PRO 21 A ? PRO 21 A 3 0.69 4 TRP 20 A . ? TRP 20 A PRO 21 A ? PRO 21 A 4 0.99 5 TRP 20 A . ? TRP 20 A PRO 21 A ? PRO 21 A 5 0.87 6 TRP 20 A . ? TRP 20 A PRO 21 A ? PRO 21 A 6 0.98 7 TRP 20 A . ? TRP 20 A PRO 21 A ? PRO 21 A 7 0.72 8 TRP 20 A . ? TRP 20 A PRO 21 A ? PRO 21 A 8 0.87 9 TRP 20 A . ? TRP 20 A PRO 21 A ? PRO 21 A 9 0.87 10 TRP 20 A . ? TRP 20 A PRO 21 A ? PRO 21 A 10 0.95 11 TRP 20 A . ? TRP 20 A PRO 21 A ? PRO 21 A 11 0.95 12 TRP 20 A . ? TRP 20 A PRO 21 A ? PRO 21 A 12 0.80 13 TRP 20 A . ? TRP 20 A PRO 21 A ? PRO 21 A 13 0.88 14 TRP 20 A . ? TRP 20 A PRO 21 A ? PRO 21 A 14 0.99 15 TRP 20 A . ? TRP 20 A PRO 21 A ? PRO 21 A 15 0.88 16 TRP 20 A . ? TRP 20 A PRO 21 A ? PRO 21 A 16 0.93 17 TRP 20 A . ? TRP 20 A PRO 21 A ? PRO 21 A 17 0.85 18 TRP 20 A . ? TRP 20 A PRO 21 A ? PRO 21 A 18 0.88 19 TRP 20 A . ? TRP 20 A PRO 21 A ? PRO 21 A 19 0.74 20 TRP 20 A . ? TRP 20 A PRO 21 A ? PRO 21 A 20 0.90 # _pdbx_entry_details.entry_id 2KUK _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HD21 A ASN 13 ? ? H A GLY 14 ? ? 1.31 2 11 HD21 A ASN 13 ? ? H A GLY 14 ? ? 1.29 3 13 HD21 A ASN 13 ? ? H A GLY 14 ? ? 1.34 4 14 HD21 A ASN 13 ? ? H A GLY 14 ? ? 1.29 5 15 HD21 A ASN 13 ? ? H A GLY 14 ? ? 1.32 6 18 HD21 A ASN 13 ? ? H A GLY 14 ? ? 1.31 7 18 HH12 A ARG 25 ? ? HD21 A ASN 26 ? ? 1.31 8 20 HD21 A ASN 13 ? ? H A GLY 14 ? ? 1.30 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 21 ? ? -94.36 50.76 2 1 PRO A 29 ? ? -70.86 45.39 3 2 PRO A 21 ? ? -94.25 49.32 4 3 PRO A 21 ? ? -94.92 51.20 5 3 PRO A 29 ? ? -79.18 42.84 6 4 CYS A 5 ? ? -151.06 59.06 7 4 PRO A 21 ? ? -94.18 50.24 8 4 PRO A 29 ? ? -73.78 44.62 9 5 PRO A 21 ? ? -95.33 54.28 10 5 PRO A 29 ? ? -74.41 48.54 11 6 PRO A 21 ? ? -94.01 50.32 12 6 PRO A 29 ? ? -72.25 49.06 13 7 PRO A 21 ? ? -94.51 50.94 14 7 PRO A 29 ? ? -77.50 44.83 15 8 PRO A 21 ? ? -94.85 51.75 16 8 PRO A 29 ? ? -72.95 44.53 17 9 PRO A 21 ? ? -94.99 52.59 18 9 PRO A 29 ? ? -75.08 45.14 19 10 CYS A 5 ? ? -151.43 58.83 20 10 PRO A 21 ? ? -95.06 51.40 21 10 PRO A 29 ? ? -71.83 47.55 22 11 CYS A 5 ? ? -150.39 66.30 23 11 PRO A 21 ? ? -94.03 51.17 24 11 PRO A 29 ? ? -71.29 45.54 25 12 PRO A 21 ? ? -94.60 50.78 26 12 PRO A 29 ? ? -72.60 47.48 27 13 PRO A 21 ? ? -95.03 53.89 28 14 CYS A 5 ? ? -150.26 62.38 29 14 PRO A 21 ? ? -93.82 49.80 30 15 PRO A 21 ? ? -94.70 51.56 31 16 CYS A 5 ? ? -150.96 59.03 32 16 PRO A 21 ? ? -94.03 49.18 33 16 PRO A 29 ? ? -74.26 47.89 34 17 PRO A 21 ? ? -94.26 49.18 35 17 PRO A 29 ? ? -71.34 48.71 36 18 PRO A 21 ? ? -95.11 53.29 37 18 PRO A 29 ? ? -74.01 47.73 38 19 PRO A 21 ? ? -94.71 50.16 39 19 PRO A 29 ? ? -74.94 43.25 40 20 PRO A 21 ? ? -95.15 52.65 41 20 PRO A 29 ? ? -74.33 49.37 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KUK _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KUK _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '1 mM vhl-2-1, 75%H2O/5%D2O/25%ACN' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system 75%H2O/5%D2O/25%ACN # _pdbx_nmr_exptl_sample.component vhl-2-1 _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling ? _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pH 4 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D DQF-COSY' 1 2 1 '2D 1H-1H TOCSY' 1 3 1 '2D 1H-1H NOESY' # _pdbx_nmr_refine.entry_id 2KUK _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection XwinNMR ? 1 Goddard 'chemical shift assignment' Sparky ? 2 'Guntert, Braun and Wuthrich' 'structure solution' DYANA ? 3 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNSSOLVE ? 4 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNSSOLVE ? 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 ASP N N N N 45 ASP CA C N S 46 ASP C C N N 47 ASP O O N N 48 ASP CB C N N 49 ASP CG C N N 50 ASP OD1 O N N 51 ASP OD2 O N N 52 ASP OXT O N N 53 ASP H H N N 54 ASP H2 H N N 55 ASP HA H N N 56 ASP HB2 H N N 57 ASP HB3 H N N 58 ASP HD2 H N N 59 ASP HXT H N N 60 CYS N N N N 61 CYS CA C N R 62 CYS C C N N 63 CYS O O N N 64 CYS CB C N N 65 CYS SG S N N 66 CYS OXT O N N 67 CYS H H N N 68 CYS H2 H N N 69 CYS HA H N N 70 CYS HB2 H N N 71 CYS HB3 H N N 72 CYS HG H N N 73 CYS HXT H N N 74 GLU N N N N 75 GLU CA C N S 76 GLU C C N N 77 GLU O O N N 78 GLU CB C N N 79 GLU CG C N N 80 GLU CD C N N 81 GLU OE1 O N N 82 GLU OE2 O N N 83 GLU OXT O N N 84 GLU H H N N 85 GLU H2 H N N 86 GLU HA H N N 87 GLU HB2 H N N 88 GLU HB3 H N N 89 GLU HG2 H N N 90 GLU HG3 H N N 91 GLU HE2 H N N 92 GLU HXT H N N 93 GLY N N N N 94 GLY CA C N N 95 GLY C C N N 96 GLY O O N N 97 GLY OXT O N N 98 GLY H H N N 99 GLY H2 H N N 100 GLY HA2 H N N 101 GLY HA3 H N N 102 GLY HXT H N N 103 LEU N N N N 104 LEU CA C N S 105 LEU C C N N 106 LEU O O N N 107 LEU CB C N N 108 LEU CG C N N 109 LEU CD1 C N N 110 LEU CD2 C N N 111 LEU OXT O N N 112 LEU H H N N 113 LEU H2 H N N 114 LEU HA H N N 115 LEU HB2 H N N 116 LEU HB3 H N N 117 LEU HG H N N 118 LEU HD11 H N N 119 LEU HD12 H N N 120 LEU HD13 H N N 121 LEU HD21 H N N 122 LEU HD22 H N N 123 LEU HD23 H N N 124 LEU HXT H N N 125 PHE N N N N 126 PHE CA C N S 127 PHE C C N N 128 PHE O O N N 129 PHE CB C N N 130 PHE CG C Y N 131 PHE CD1 C Y N 132 PHE CD2 C Y N 133 PHE CE1 C Y N 134 PHE CE2 C Y N 135 PHE CZ C Y N 136 PHE OXT O N N 137 PHE H H N N 138 PHE H2 H N N 139 PHE HA H N N 140 PHE HB2 H N N 141 PHE HB3 H N N 142 PHE HD1 H N N 143 PHE HD2 H N N 144 PHE HE1 H N N 145 PHE HE2 H N N 146 PHE HZ H N N 147 PHE HXT H N N 148 PRO N N N N 149 PRO CA C N S 150 PRO C C N N 151 PRO O O N N 152 PRO CB C N N 153 PRO CG C N N 154 PRO CD C N N 155 PRO OXT O N N 156 PRO H H N N 157 PRO HA H N N 158 PRO HB2 H N N 159 PRO HB3 H N N 160 PRO HG2 H N N 161 PRO HG3 H N N 162 PRO HD2 H N N 163 PRO HD3 H N N 164 PRO HXT H N N 165 THR N N N N 166 THR CA C N S 167 THR C C N N 168 THR O O N N 169 THR CB C N R 170 THR OG1 O N N 171 THR CG2 C N N 172 THR OXT O N N 173 THR H H N N 174 THR H2 H N N 175 THR HA H N N 176 THR HB H N N 177 THR HG1 H N N 178 THR HG21 H N N 179 THR HG22 H N N 180 THR HG23 H N N 181 THR HXT H N N 182 TRP N N N N 183 TRP CA C N S 184 TRP C C N N 185 TRP O O N N 186 TRP CB C N N 187 TRP CG C Y N 188 TRP CD1 C Y N 189 TRP CD2 C Y N 190 TRP NE1 N Y N 191 TRP CE2 C Y N 192 TRP CE3 C Y N 193 TRP CZ2 C Y N 194 TRP CZ3 C Y N 195 TRP CH2 C Y N 196 TRP OXT O N N 197 TRP H H N N 198 TRP H2 H N N 199 TRP HA H N N 200 TRP HB2 H N N 201 TRP HB3 H N N 202 TRP HD1 H N N 203 TRP HE1 H N N 204 TRP HE3 H N N 205 TRP HZ2 H N N 206 TRP HZ3 H N N 207 TRP HH2 H N N 208 TRP HXT H N N 209 TYR N N N N 210 TYR CA C N S 211 TYR C C N N 212 TYR O O N N 213 TYR CB C N N 214 TYR CG C Y N 215 TYR CD1 C Y N 216 TYR CD2 C Y N 217 TYR CE1 C Y N 218 TYR CE2 C Y N 219 TYR CZ C Y N 220 TYR OH O N N 221 TYR OXT O N N 222 TYR H H N N 223 TYR H2 H N N 224 TYR HA H N N 225 TYR HB2 H N N 226 TYR HB3 H N N 227 TYR HD1 H N N 228 TYR HD2 H N N 229 TYR HE1 H N N 230 TYR HE2 H N N 231 TYR HH H N N 232 TYR HXT H N N 233 VAL N N N N 234 VAL CA C N S 235 VAL C C N N 236 VAL O O N N 237 VAL CB C N N 238 VAL CG1 C N N 239 VAL CG2 C N N 240 VAL OXT O N N 241 VAL H H N N 242 VAL H2 H N N 243 VAL HA H N N 244 VAL HB H N N 245 VAL HG11 H N N 246 VAL HG12 H N N 247 VAL HG13 H N N 248 VAL HG21 H N N 249 VAL HG22 H N N 250 VAL HG23 H N N 251 VAL HXT H N N 252 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 ASP N CA sing N N 43 ASP N H sing N N 44 ASP N H2 sing N N 45 ASP CA C sing N N 46 ASP CA CB sing N N 47 ASP CA HA sing N N 48 ASP C O doub N N 49 ASP C OXT sing N N 50 ASP CB CG sing N N 51 ASP CB HB2 sing N N 52 ASP CB HB3 sing N N 53 ASP CG OD1 doub N N 54 ASP CG OD2 sing N N 55 ASP OD2 HD2 sing N N 56 ASP OXT HXT sing N N 57 CYS N CA sing N N 58 CYS N H sing N N 59 CYS N H2 sing N N 60 CYS CA C sing N N 61 CYS CA CB sing N N 62 CYS CA HA sing N N 63 CYS C O doub N N 64 CYS C OXT sing N N 65 CYS CB SG sing N N 66 CYS CB HB2 sing N N 67 CYS CB HB3 sing N N 68 CYS SG HG sing N N 69 CYS OXT HXT sing N N 70 GLU N CA sing N N 71 GLU N H sing N N 72 GLU N H2 sing N N 73 GLU CA C sing N N 74 GLU CA CB sing N N 75 GLU CA HA sing N N 76 GLU C O doub N N 77 GLU C OXT sing N N 78 GLU CB CG sing N N 79 GLU CB HB2 sing N N 80 GLU CB HB3 sing N N 81 GLU CG CD sing N N 82 GLU CG HG2 sing N N 83 GLU CG HG3 sing N N 84 GLU CD OE1 doub N N 85 GLU CD OE2 sing N N 86 GLU OE2 HE2 sing N N 87 GLU OXT HXT sing N N 88 GLY N CA sing N N 89 GLY N H sing N N 90 GLY N H2 sing N N 91 GLY CA C sing N N 92 GLY CA HA2 sing N N 93 GLY CA HA3 sing N N 94 GLY C O doub N N 95 GLY C OXT sing N N 96 GLY OXT HXT sing N N 97 LEU N CA sing N N 98 LEU N H sing N N 99 LEU N H2 sing N N 100 LEU CA C sing N N 101 LEU CA CB sing N N 102 LEU CA HA sing N N 103 LEU C O doub N N 104 LEU C OXT sing N N 105 LEU CB CG sing N N 106 LEU CB HB2 sing N N 107 LEU CB HB3 sing N N 108 LEU CG CD1 sing N N 109 LEU CG CD2 sing N N 110 LEU CG HG sing N N 111 LEU CD1 HD11 sing N N 112 LEU CD1 HD12 sing N N 113 LEU CD1 HD13 sing N N 114 LEU CD2 HD21 sing N N 115 LEU CD2 HD22 sing N N 116 LEU CD2 HD23 sing N N 117 LEU OXT HXT sing N N 118 PHE N CA sing N N 119 PHE N H sing N N 120 PHE N H2 sing N N 121 PHE CA C sing N N 122 PHE CA CB sing N N 123 PHE CA HA sing N N 124 PHE C O doub N N 125 PHE C OXT sing N N 126 PHE CB CG sing N N 127 PHE CB HB2 sing N N 128 PHE CB HB3 sing N N 129 PHE CG CD1 doub Y N 130 PHE CG CD2 sing Y N 131 PHE CD1 CE1 sing Y N 132 PHE CD1 HD1 sing N N 133 PHE CD2 CE2 doub Y N 134 PHE CD2 HD2 sing N N 135 PHE CE1 CZ doub Y N 136 PHE CE1 HE1 sing N N 137 PHE CE2 CZ sing Y N 138 PHE CE2 HE2 sing N N 139 PHE CZ HZ sing N N 140 PHE OXT HXT sing N N 141 PRO N CA sing N N 142 PRO N CD sing N N 143 PRO N H sing N N 144 PRO CA C sing N N 145 PRO CA CB sing N N 146 PRO CA HA sing N N 147 PRO C O doub N N 148 PRO C OXT sing N N 149 PRO CB CG sing N N 150 PRO CB HB2 sing N N 151 PRO CB HB3 sing N N 152 PRO CG CD sing N N 153 PRO CG HG2 sing N N 154 PRO CG HG3 sing N N 155 PRO CD HD2 sing N N 156 PRO CD HD3 sing N N 157 PRO OXT HXT sing N N 158 THR N CA sing N N 159 THR N H sing N N 160 THR N H2 sing N N 161 THR CA C sing N N 162 THR CA CB sing N N 163 THR CA HA sing N N 164 THR C O doub N N 165 THR C OXT sing N N 166 THR CB OG1 sing N N 167 THR CB CG2 sing N N 168 THR CB HB sing N N 169 THR OG1 HG1 sing N N 170 THR CG2 HG21 sing N N 171 THR CG2 HG22 sing N N 172 THR CG2 HG23 sing N N 173 THR OXT HXT sing N N 174 TRP N CA sing N N 175 TRP N H sing N N 176 TRP N H2 sing N N 177 TRP CA C sing N N 178 TRP CA CB sing N N 179 TRP CA HA sing N N 180 TRP C O doub N N 181 TRP C OXT sing N N 182 TRP CB CG sing N N 183 TRP CB HB2 sing N N 184 TRP CB HB3 sing N N 185 TRP CG CD1 doub Y N 186 TRP CG CD2 sing Y N 187 TRP CD1 NE1 sing Y N 188 TRP CD1 HD1 sing N N 189 TRP CD2 CE2 doub Y N 190 TRP CD2 CE3 sing Y N 191 TRP NE1 CE2 sing Y N 192 TRP NE1 HE1 sing N N 193 TRP CE2 CZ2 sing Y N 194 TRP CE3 CZ3 doub Y N 195 TRP CE3 HE3 sing N N 196 TRP CZ2 CH2 doub Y N 197 TRP CZ2 HZ2 sing N N 198 TRP CZ3 CH2 sing Y N 199 TRP CZ3 HZ3 sing N N 200 TRP CH2 HH2 sing N N 201 TRP OXT HXT sing N N 202 TYR N CA sing N N 203 TYR N H sing N N 204 TYR N H2 sing N N 205 TYR CA C sing N N 206 TYR CA CB sing N N 207 TYR CA HA sing N N 208 TYR C O doub N N 209 TYR C OXT sing N N 210 TYR CB CG sing N N 211 TYR CB HB2 sing N N 212 TYR CB HB3 sing N N 213 TYR CG CD1 doub Y N 214 TYR CG CD2 sing Y N 215 TYR CD1 CE1 sing Y N 216 TYR CD1 HD1 sing N N 217 TYR CD2 CE2 doub Y N 218 TYR CD2 HD2 sing N N 219 TYR CE1 CZ doub Y N 220 TYR CE1 HE1 sing N N 221 TYR CE2 CZ sing Y N 222 TYR CE2 HE2 sing N N 223 TYR CZ OH sing N N 224 TYR OH HH sing N N 225 TYR OXT HXT sing N N 226 VAL N CA sing N N 227 VAL N H sing N N 228 VAL N H2 sing N N 229 VAL CA C sing N N 230 VAL CA CB sing N N 231 VAL CA HA sing N N 232 VAL C O doub N N 233 VAL C OXT sing N N 234 VAL CB CG1 sing N N 235 VAL CB CG2 sing N N 236 VAL CB HB sing N N 237 VAL CG1 HG11 sing N N 238 VAL CG1 HG12 sing N N 239 VAL CG1 HG13 sing N N 240 VAL CG2 HG21 sing N N 241 VAL CG2 HG22 sing N N 242 VAL CG2 HG23 sing N N 243 VAL OXT HXT sing N N 244 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model ARX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker ARX' # _atom_sites.entry_id 2KUK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_