data_2KX0 # _entry.id 2KX0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KX0 pdb_00002kx0 10.2210/pdb2kx0/pdb RCSB RCSB101678 ? ? BMRB 16895 ? ? WWPDB D_1000101678 ? ? # _pdbx_database_related.db_id 16895 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KX0 _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2010-04-22 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # _audit_author.name 'Ko, S.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'the solution structure of UBB+1, frameshift mutant of ubiquitin B' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # _citation_author.citation_id primary _citation_author.name 'Ko, S.' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ubiquitin B' _entity.formula_weight 11538.959 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name UBB+1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSLVPRGSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSEYNIQKESTLHLVLR LRGYADLREDPDRQDHHPGSGAQ ; _entity_poly.pdbx_seq_one_letter_code_can ;GSLVPRGSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSEYNIQKESTLHLVLR LRGYADLREDPDRQDHHPGSGAQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 LEU n 1 4 VAL n 1 5 PRO n 1 6 ARG n 1 7 GLY n 1 8 SER n 1 9 MET n 1 10 GLN n 1 11 ILE n 1 12 PHE n 1 13 VAL n 1 14 LYS n 1 15 THR n 1 16 LEU n 1 17 THR n 1 18 GLY n 1 19 LYS n 1 20 THR n 1 21 ILE n 1 22 THR n 1 23 LEU n 1 24 GLU n 1 25 VAL n 1 26 GLU n 1 27 PRO n 1 28 SER n 1 29 ASP n 1 30 THR n 1 31 ILE n 1 32 GLU n 1 33 ASN n 1 34 VAL n 1 35 LYS n 1 36 ALA n 1 37 LYS n 1 38 ILE n 1 39 GLN n 1 40 ASP n 1 41 LYS n 1 42 GLU n 1 43 GLY n 1 44 ILE n 1 45 PRO n 1 46 PRO n 1 47 ASP n 1 48 GLN n 1 49 GLN n 1 50 ARG n 1 51 LEU n 1 52 ILE n 1 53 PHE n 1 54 ALA n 1 55 GLY n 1 56 LYS n 1 57 GLN n 1 58 LEU n 1 59 GLU n 1 60 ASP n 1 61 GLY n 1 62 ARG n 1 63 THR n 1 64 LEU n 1 65 SER n 1 66 GLU n 1 67 TYR n 1 68 ASN n 1 69 ILE n 1 70 GLN n 1 71 LYS n 1 72 GLU n 1 73 SER n 1 74 THR n 1 75 LEU n 1 76 HIS n 1 77 LEU n 1 78 VAL n 1 79 LEU n 1 80 ARG n 1 81 LEU n 1 82 ARG n 1 83 GLY n 1 84 TYR n 1 85 ALA n 1 86 ASP n 1 87 LEU n 1 88 ARG n 1 89 GLU n 1 90 ASP n 1 91 PRO n 1 92 ASP n 1 93 ARG n 1 94 GLN n 1 95 ASP n 1 96 HIS n 1 97 HIS n 1 98 PRO n 1 99 GLY n 1 100 SER n 1 101 GLY n 1 102 ALA n 1 103 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 DE3' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET15b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2KX0 _struct_ref.pdbx_db_accession 2KX0 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KX0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 103 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2KX0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 103 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 103 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 2 '3D CBCA(CO)NH' 1 2 2 '3D HNCO' 1 3 2 '3D HNCA' 1 4 2 '3D HNCACB' 1 5 2 '3D HBHA(CO)NH' 1 6 1 '3D 1H-15N NOESY' 1 7 3 '3D HCCH-TOCSY' 1 8 3 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-99% 15N] UBB+1-1, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM [U-100% 13C] UBB+1-2, 100% D2O' 2 '100% D2O' '1 mM [U-99% 13C; U-99% 15N] UBB+1-3, 90% H2O/10% D2O' 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker DRX 1 'Bruker DRX' 900 Bruker DRX 2 'Bruker DRX' # _pdbx_nmr_refine.entry_id 2KX0 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KX0 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KX0 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'P.GUNTERT ET AL.' refinement CYANA 2.2.5 1 'P.GUNTERT ET AL.' 'structure solution' CYANA 2.2.5 2 'P.GUNTERT ET AL.' 'chemical shift assignment' CYANA 2.2.5 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'data analysis' NMRDraw ? 4 'Bruker Biospin' collection XwinNMR ? 5 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 6 Goddard 'peak picking' Sparky ? 7 'Laskowski and MacArthur' 'geometry optimization' ProcheckNMR ? 8 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 9 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign ? 10 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KX0 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KX0 _struct.title 'the solution structure of UBB+1, frameshift mutant of ubiquitin B' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KX0 _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text 'ubiquitin, E2-25K, frame shift mutant, alzheimer disease, UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 30 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 42 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 30 _struct_conf.end_auth_comp_id GLU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 42 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 20 ? VAL A 25 ? THR A 20 VAL A 25 A 2 MET A 9 ? LYS A 14 ? MET A 9 LYS A 14 A 3 THR A 74 ? LEU A 77 ? THR A 74 LEU A 77 A 4 LEU A 51 ? PHE A 53 ? LEU A 51 PHE A 53 A 5 LYS A 56 ? GLN A 57 ? LYS A 56 GLN A 57 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 23 ? O LEU A 23 N ILE A 11 ? N ILE A 11 A 2 3 N LYS A 14 ? N LYS A 14 O LEU A 75 ? O LEU A 75 A 3 4 O HIS A 76 ? O HIS A 76 N ILE A 52 ? N ILE A 52 A 4 5 N PHE A 53 ? N PHE A 53 O LYS A 56 ? O LYS A 56 # _atom_sites.entry_id 2KX0 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 GLN 103 103 103 GLN GLN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-09-08 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-26 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' Other 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_nmr_software 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 4 'Structure model' '_database_2.pdbx_DOI' 4 4 'Structure model' '_database_2.pdbx_database_accession' 5 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_entry_details.entry_id 2KX0 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;A SEQUENCE DATABASE REFERENCE FOR THIS PROTEIN DOES NOT CURRENTLY EXIST IN UNIPROT. THE AUTHOR STATES THAT THE SEQUENCE IS FRAME SHIFT MUTANT OF UBIQUITIN WHICH OBSERVED IN ALZHEIMER PATIENTS. THE LAST 20 RESIDUES (Y84-Q103) ARE EXPRESSION TAGS. ; _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id UBB+1-1 1 ? mM '[U-99% 15N]' 1 UBB+1-2 1 ? mM '[U-100% 13C]' 2 UBB+1-3 1 ? mM '[U-99% 13C; U-99% 15N]' 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 60 ? ? -63.86 -170.47 2 1 GLU A 89 ? ? -161.00 116.86 3 1 PRO A 91 ? ? -69.79 -170.36 4 1 PRO A 98 ? ? -69.75 -175.13 5 2 PRO A 5 ? ? -69.80 83.33 6 2 SER A 73 ? ? -69.31 -175.80 7 2 ALA A 85 ? ? -174.84 127.27 8 2 ASP A 90 ? ? -163.46 69.37 9 2 ASP A 92 ? ? -124.12 -52.28 10 2 PRO A 98 ? ? -69.75 -171.61 11 3 ASP A 60 ? ? -65.90 -171.26 12 3 LEU A 81 ? ? -69.47 -73.96 13 3 LEU A 87 ? ? -57.92 176.94 14 3 PRO A 91 ? ? -69.70 -171.24 15 3 ASP A 95 ? ? -173.55 141.79 16 3 PRO A 98 ? ? -69.75 96.43 17 4 PRO A 5 ? ? -69.79 87.33 18 4 SER A 8 ? ? -175.65 148.49 19 4 ALA A 85 ? ? -174.75 109.75 20 4 ASP A 90 ? ? -164.02 70.82 21 4 PRO A 91 ? ? -69.76 -171.19 22 4 ASP A 92 ? ? -179.71 101.06 23 4 PRO A 98 ? ? -69.76 -172.90 24 5 PRO A 5 ? ? -69.75 91.96 25 5 SER A 8 ? ? -178.67 139.31 26 5 TYR A 84 ? ? -174.12 124.59 27 5 ALA A 85 ? ? -173.72 125.53 28 5 PRO A 91 ? ? -69.77 -171.26 29 6 SER A 8 ? ? -179.26 128.05 30 6 PRO A 91 ? ? -69.74 91.05 31 6 ASP A 92 ? ? -67.31 -70.85 32 6 HIS A 97 ? ? 56.81 71.14 33 6 PRO A 98 ? ? -69.81 92.33 34 7 ASP A 60 ? ? -58.21 -178.00 35 7 GLN A 70 ? ? -111.21 -168.48 36 7 PRO A 91 ? ? -69.70 -172.59 37 7 ASP A 92 ? ? 61.84 90.09 38 8 PRO A 5 ? ? -69.76 -171.08 39 8 ARG A 6 ? ? -77.72 -70.78 40 8 ASP A 60 ? ? -58.72 179.40 41 8 ARG A 82 ? ? -177.86 130.61 42 8 TYR A 84 ? ? -175.92 -39.91 43 8 ALA A 85 ? ? -178.31 82.54 44 8 HIS A 97 ? ? -113.38 74.47 45 9 SER A 8 ? ? -175.74 146.08 46 9 ARG A 80 ? ? -96.63 -66.07 47 9 TYR A 84 ? ? -173.95 142.40 48 9 ARG A 88 ? ? -174.11 132.05 49 9 HIS A 97 ? ? -169.94 68.97 50 10 ASP A 60 ? ? -56.68 177.99 51 10 GLN A 70 ? ? -76.84 -169.48 52 10 SER A 73 ? ? -62.93 -176.09 53 10 TYR A 84 ? ? -126.64 -66.02 54 10 ARG A 88 ? ? -171.42 145.59 55 10 ASP A 90 ? ? 62.56 161.52 56 10 ASP A 92 ? ? -114.70 53.18 57 10 HIS A 97 ? ? -173.83 70.87 58 10 PRO A 98 ? ? -69.81 -171.20 59 11 ARG A 50 ? ? -161.66 116.40 60 11 LEU A 81 ? ? -155.73 25.70 61 11 ASP A 92 ? ? -157.95 -73.66 62 11 ARG A 93 ? ? -172.57 -37.12 63 12 ASP A 60 ? ? -56.32 175.68 64 12 GLN A 70 ? ? -109.77 -168.83 65 12 ALA A 85 ? ? -173.29 131.20 66 12 PRO A 91 ? ? -69.75 -178.97 67 12 ASP A 92 ? ? -172.00 89.47 68 12 HIS A 96 ? ? -160.91 93.85 69 12 ALA A 102 ? ? -173.60 -176.62 70 13 GLU A 89 ? ? -56.67 170.16 71 13 PRO A 91 ? ? -69.74 -175.18 72 13 ASP A 92 ? ? -171.43 94.01 73 13 ARG A 93 ? ? -53.05 173.37 74 13 GLN A 94 ? ? -161.37 119.00 75 13 ASP A 95 ? ? -65.56 91.21 76 13 HIS A 96 ? ? -172.02 129.63 77 13 ALA A 102 ? ? -117.28 -71.77 78 14 THR A 17 ? ? -95.29 30.10 79 14 ARG A 88 ? ? -171.68 146.52 80 14 HIS A 97 ? ? -150.50 69.35 81 14 ALA A 102 ? ? -173.94 -178.84 82 15 ARG A 6 ? ? -99.00 -71.95 83 15 ARG A 82 ? ? -102.30 55.31 84 15 ASP A 90 ? ? -158.51 69.88 85 15 HIS A 97 ? ? -171.92 68.81 86 16 PRO A 5 ? ? -69.71 -173.49 87 16 ASP A 90 ? ? 63.40 160.56 88 16 PRO A 91 ? ? -69.77 -177.71 89 16 HIS A 97 ? ? -119.94 68.60 90 17 PRO A 5 ? ? -69.79 -175.21 91 17 SER A 8 ? ? -176.54 133.89 92 17 SER A 73 ? ? -64.43 -173.69 93 17 ALA A 85 ? ? -55.71 -74.89 94 17 ASP A 86 ? ? -172.59 149.59 95 17 ARG A 88 ? ? -171.13 113.67 96 17 ASP A 90 ? ? -158.15 69.94 97 17 PRO A 91 ? ? -69.81 83.73 98 17 GLN A 94 ? ? -119.81 62.76 99 17 ASP A 95 ? ? -58.06 178.55 100 17 HIS A 97 ? ? 53.52 72.47 101 18 PRO A 5 ? ? -69.73 93.82 102 18 SER A 8 ? ? -172.60 136.06 103 18 ASP A 60 ? ? -58.23 -179.18 104 18 ASP A 90 ? ? -163.47 68.99 105 18 ASP A 92 ? ? -138.56 -68.45 106 18 GLN A 94 ? ? -101.81 40.69 107 18 ASP A 95 ? ? -130.18 -55.23 108 19 SER A 2 ? ? -59.74 -179.65 109 19 PRO A 5 ? ? -69.77 -173.25 110 19 ASP A 60 ? ? -57.74 171.54 111 19 GLU A 89 ? ? -155.33 86.64 112 19 PRO A 91 ? ? -69.80 -173.48 113 20 SER A 2 ? ? -66.80 -177.16 114 20 THR A 17 ? ? -94.98 30.41 115 20 ARG A 80 ? ? -117.82 -70.25 116 20 ARG A 88 ? ? -170.93 115.13 117 20 PRO A 91 ? ? -69.80 -174.61 118 20 ASP A 92 ? ? -174.54 92.65 119 20 PRO A 98 ? ? -69.85 -177.68 120 20 SER A 100 ? ? -173.36 119.30 #