data_2KXG # _entry.id 2KXG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KXG pdb_00002kxg 10.2210/pdb2kxg/pdb RCSB RCSB101694 ? ? WWPDB D_1000101694 ? ? BMRB 16913 ? ? # _pdbx_database_related.db_id 16913 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KXG _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2010-05-05 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Headey, S.J.' 1 'Macaskill, U.K.' 2 'Wright, M.' 3 'Claridge, J.K.' 4 'Edwards, P.J.B.' 5 'Farley, P.C.' 6 'Christeller, J.T.' 7 'Laing, W.A.' 8 'Pascal, S.M.' 9 # _citation.id primary _citation.title 'Solution structure of the squash aspartic acid proteinase inhibitor (SQAPI) and mutational analysis of pepsin inhibition.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 285 _citation.page_first 27019 _citation.page_last 27025 _citation.year 2010 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20538608 _citation.pdbx_database_id_DOI 10.1074/jbc.M110.137018 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Headey, S.J.' 1 ? primary 'Macaskill, U.K.' 2 ? primary 'Wright, M.A.' 3 ? primary 'Claridge, J.K.' 4 ? primary 'Edwards, P.J.B.' 5 ? primary 'Farley, P.C.' 6 ? primary 'Christeller, J.T.' 7 ? primary 'Laing, W.A.' 8 ? primary 'Pascal, S.M.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Aspartic protease inhibitor' _entity.formula_weight 10420.930 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP RESIDUES 8-102' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPGPAIGEVIGISVNDPRVKEIAEFALKQHAEQNLILAGVDAGQIIKGIPHWDNYYNLILSAKHSPHEFSKFYNVVVLEK ASDNSLKLVAFVPLF ; _entity_poly.pdbx_seq_one_letter_code_can ;GPGPAIGEVIGISVNDPRVKEIAEFALKQHAEQNLILAGVDAGQIIKGIPHWDNYYNLILSAKHSPHEFSKFYNVVVLEK ASDNSLKLVAFVPLF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 PRO n 1 5 ALA n 1 6 ILE n 1 7 GLY n 1 8 GLU n 1 9 VAL n 1 10 ILE n 1 11 GLY n 1 12 ILE n 1 13 SER n 1 14 VAL n 1 15 ASN n 1 16 ASP n 1 17 PRO n 1 18 ARG n 1 19 VAL n 1 20 LYS n 1 21 GLU n 1 22 ILE n 1 23 ALA n 1 24 GLU n 1 25 PHE n 1 26 ALA n 1 27 LEU n 1 28 LYS n 1 29 GLN n 1 30 HIS n 1 31 ALA n 1 32 GLU n 1 33 GLN n 1 34 ASN n 1 35 LEU n 1 36 ILE n 1 37 LEU n 1 38 ALA n 1 39 GLY n 1 40 VAL n 1 41 ASP n 1 42 ALA n 1 43 GLY n 1 44 GLN n 1 45 ILE n 1 46 ILE n 1 47 LYS n 1 48 GLY n 1 49 ILE n 1 50 PRO n 1 51 HIS n 1 52 TRP n 1 53 ASP n 1 54 ASN n 1 55 TYR n 1 56 TYR n 1 57 ASN n 1 58 LEU n 1 59 ILE n 1 60 LEU n 1 61 SER n 1 62 ALA n 1 63 LYS n 1 64 HIS n 1 65 SER n 1 66 PRO n 1 67 HIS n 1 68 GLU n 1 69 PHE n 1 70 SER n 1 71 LYS n 1 72 PHE n 1 73 TYR n 1 74 ASN n 1 75 VAL n 1 76 VAL n 1 77 VAL n 1 78 LEU n 1 79 GLU n 1 80 LYS n 1 81 ALA n 1 82 SER n 1 83 ASP n 1 84 ASN n 1 85 SER n 1 86 LEU n 1 87 LYS n 1 88 LEU n 1 89 VAL n 1 90 ALA n 1 91 PHE n 1 92 VAL n 1 93 PRO n 1 94 LEU n 1 95 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'great pumpkin' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Cucurbita maxima' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3661 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant pLysS _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pRSETA _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6DLC9_CUCMA _struct_ref.pdbx_db_accession Q6DLC9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GPGPAIGEVIGISVNDPRVKEIAEFALKQHAEQNLILAGVDAGQIIKGIPHWDNYYNLILSAKHSPHEFSKFYNVVVLEK ASDNSLKLVAFVPLF ; _struct_ref.pdbx_align_begin 8 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KXG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 95 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6DLC9 _struct_ref_seq.db_align_beg 8 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 102 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 95 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '2D 1H-1H NOESY' 1 4 1 '3D HNCACB' 1 5 1 '3D HNCA' 1 6 1 '3D HNCO' 1 7 1 '3D HN(CA)CO' 1 8 1 '3D HN(COCA)CB' 1 9 1 '3D HCCCONH TOCSY' 1 10 1 '3D HBHA(CO)NH' 1 11 1 '3D HCCH-TOCSY' 1 12 1 '2D (HB)CB(CGCD)HD' 1 13 1 '2D (HB)CB(CGCDCE)HE' 1 14 1 '3D 1H-13C NOESYHSQC' 1 15 1 '3D 1H-15N NOESYHSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 3 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 323 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.6mM [U-98% 13C; U-98% 15N] SQAPI-1, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2KXG _pdbx_nmr_refine.method 'torsion angle dynamics, simulated annealing, simulated annealing' _pdbx_nmr_refine.details ;beginning with extended conformer, beginning with folded structure using Cartesian dynamics, final refinement using Cartesian dynamics in a layer of TIP3 water molecules ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KXG _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KXG _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' processing TopSpin 2.0 1 'Bartels et al.' 'data analysis' XEASY 1.4 2 ? refinement CNS ? 3 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KXG _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KXG _struct.title 'The solution structure of the squash aspartic acid proteinase inhibitor (SQAPI)' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KXG _struct_keywords.pdbx_keywords 'HYDROLASE INHIBITOR' _struct_keywords.text 'SQAPI, protein, aspartic protease inhibitor, HYDROLASE INHIBITOR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 16 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id HIS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 30 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 16 _struct_conf.end_auth_comp_id HIS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 30 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 36 ? ILE A 46 ? ILE A 36 ILE A 46 A 2 TYR A 55 ? LYS A 63 ? TYR A 55 LYS A 63 A 3 LYS A 71 ? LYS A 80 ? LYS A 71 LYS A 80 A 4 SER A 85 ? PRO A 93 ? SER A 85 PRO A 93 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ALA A 42 ? N ALA A 42 O ILE A 59 ? O ILE A 59 A 2 3 N TYR A 56 ? N TYR A 56 O VAL A 77 ? O VAL A 77 A 3 4 N LEU A 78 ? N LEU A 78 O LYS A 87 ? O LYS A 87 # _atom_sites.entry_id 2KXG _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 TRP 52 52 52 TRP TRP A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 PHE 95 95 95 PHE PHE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-06-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2013-01-30 4 'Structure model' 1 3 2020-02-26 5 'Structure model' 1 4 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other 6 5 'Structure model' 'Database references' 7 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_nmr_spectrometer 5 5 'Structure model' database_2 6 5 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.status_code_cs' 2 4 'Structure model' '_pdbx_nmr_software.name' 3 4 'Structure model' '_pdbx_nmr_spectrometer.model' 4 5 'Structure model' '_database_2.pdbx_DOI' 5 5 'Structure model' '_database_2.pdbx_database_accession' 6 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_nmr_exptl_sample.component SQAPI-1 _pdbx_nmr_exptl_sample.concentration 0.6 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-98% 13C; U-98% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 2 _pdbx_validate_close_contact.auth_atom_id_1 H _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLN _pdbx_validate_close_contact.auth_seq_id_1 44 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ASN _pdbx_validate_close_contact.auth_seq_id_2 57 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.54 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 6 ? ? -138.54 -49.33 2 1 ALA A 31 ? ? -167.50 45.43 3 1 ASN A 34 ? ? 50.93 83.07 4 1 ASP A 41 ? ? -106.10 -63.33 5 1 SER A 85 ? ? -165.99 -169.06 6 2 ALA A 31 ? ? -171.57 44.30 7 2 ASN A 34 ? ? 61.29 96.89 8 2 ASP A 41 ? ? -92.40 -65.74 9 2 TRP A 52 ? ? 76.51 31.97 10 3 ILE A 6 ? ? -127.22 -55.18 11 3 ALA A 31 ? ? -174.63 36.48 12 3 ASN A 34 ? ? 74.79 91.65 13 3 ASP A 41 ? ? -109.68 -66.50 14 3 TRP A 52 ? ? 76.69 31.49 15 3 LEU A 94 ? ? -109.65 40.87 16 4 ALA A 5 ? ? -130.53 -60.31 17 4 ALA A 31 ? ? -172.67 43.47 18 4 ASN A 34 ? ? 65.64 97.13 19 4 ASP A 41 ? ? -100.76 -62.78 20 4 TRP A 52 ? ? 75.14 33.02 21 4 SER A 85 ? ? -172.27 -175.53 22 5 ALA A 5 ? ? -92.82 -66.02 23 5 ILE A 6 ? ? -147.08 57.39 24 5 HIS A 30 ? ? -75.03 -118.60 25 5 ASN A 34 ? ? 69.47 95.98 26 5 TRP A 52 ? ? 72.75 33.89 27 5 ASN A 84 ? ? 72.46 31.33 28 5 SER A 85 ? ? 178.56 -165.15 29 5 LEU A 94 ? ? -98.85 32.52 30 6 ILE A 6 ? ? -143.85 56.00 31 6 HIS A 30 ? ? -71.56 -103.94 32 6 ASN A 34 ? ? 68.15 86.89 33 6 ASP A 41 ? ? -106.10 -67.90 34 6 TRP A 52 ? ? 71.87 32.93 35 6 PHE A 69 ? ? -64.77 -176.40 36 6 SER A 85 ? ? -174.47 -163.19 37 6 LEU A 94 ? ? -109.68 44.78 38 7 ALA A 31 ? ? -162.71 40.81 39 7 ASN A 34 ? ? 72.62 91.58 40 7 TRP A 52 ? ? 72.08 38.28 41 7 SER A 85 ? ? -174.04 -169.00 42 8 ALA A 5 ? ? -132.93 -45.34 43 8 ALA A 31 ? ? -170.28 41.18 44 8 ASN A 34 ? ? 52.78 88.14 45 8 ASP A 41 ? ? -103.61 -65.32 46 8 TRP A 52 ? ? 72.97 31.85 47 8 SER A 85 ? ? 177.96 -177.99 48 9 HIS A 30 ? ? -65.03 -95.53 49 9 ASN A 34 ? ? 67.51 91.94 50 9 ASP A 41 ? ? -91.02 -62.63 51 9 TRP A 52 ? ? 73.70 33.40 52 9 SER A 85 ? ? -171.49 -173.95 53 10 ALA A 31 ? ? -168.63 43.74 54 10 ASN A 34 ? ? 63.73 99.54 55 10 SER A 85 ? ? -173.80 -174.30 #