data_2KXI # _entry.id 2KXI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KXI pdb_00002kxi 10.2210/pdb2kxi/pdb RCSB RCSB101696 ? ? WWPDB D_1000101696 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-03-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2018-08-08 4 'Structure model' 1 3 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Experimental preparation' 4 3 'Structure model' 'Refinement description' 5 3 'Structure model' 'Source and taxonomy' 6 3 'Structure model' 'Structure summary' 7 4 'Structure model' 'Data collection' 8 4 'Structure model' 'Database references' 9 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' entity 2 3 'Structure model' entity_src_gen 3 3 'Structure model' pdbx_nmr_exptl_sample_conditions 4 3 'Structure model' pdbx_nmr_refine 5 3 'Structure model' pdbx_nmr_sample_details 6 3 'Structure model' pdbx_nmr_spectrometer 7 3 'Structure model' struct 8 4 'Structure model' chem_comp_atom 9 4 'Structure model' chem_comp_bond 10 4 'Structure model' database_2 11 4 'Structure model' pdbx_entry_details 12 4 'Structure model' pdbx_modification_feature 13 4 'Structure model' pdbx_nmr_software 14 4 'Structure model' pdbx_nmr_spectrometer 15 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_entity.pdbx_description' 2 3 'Structure model' '_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id' 3 3 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name' 4 3 'Structure model' '_pdbx_nmr_exptl_sample_conditions.label' 5 3 'Structure model' '_pdbx_nmr_exptl_sample_conditions.pH_units' 6 3 'Structure model' '_pdbx_nmr_refine.software_ordinal' 7 3 'Structure model' '_pdbx_nmr_sample_details.contents' 8 3 'Structure model' '_pdbx_nmr_sample_details.label' 9 3 'Structure model' '_pdbx_nmr_sample_details.type' 10 3 'Structure model' '_pdbx_nmr_spectrometer.manufacturer' 11 3 'Structure model' '_pdbx_nmr_spectrometer.type' 12 3 'Structure model' '_struct.pdbx_descriptor' 13 4 'Structure model' '_database_2.pdbx_DOI' 14 4 'Structure model' '_database_2.pdbx_database_accession' 15 4 'Structure model' '_pdbx_nmr_software.name' 16 4 'Structure model' '_pdbx_nmr_spectrometer.model' 17 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2011-03-02 _pdbx_database_PDB_obs_spr.pdb_id 2KXI _pdbx_database_PDB_obs_spr.replace_pdb_id 2KWR _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KXI _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2010-05-06 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Koehler, C.' 1 ? 'Carlier, L.' 2 ? 'Veggi, D.' 3 ? 'Soriani, M.' 4 ? 'Pizza, M.' 5 ? 'Boelens, R.' 6 ? 'Bonvin, A.M.J.J.' 7 ? # _citation.id primary _citation.title 'Solution NMR structure of the apoform of NarE (NMB1343)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Koehler, C.' 1 ? primary 'Carlier, L.' 2 ? primary 'Veggi, D.' 3 ? primary 'Soriani, M.' 4 ? primary 'Pizza, M.' 5 ? primary 'Boelens, R.' 6 ? primary 'Bonvin, A.M.J.J.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein' _entity.formula_weight 17429.373 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name NMB1343 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGNFLYRGISCQQDEQNNGQLKPKGNKAEVAIRYDGKFKYDGKATHGPSVKNAVYAHQIETGLYDGCYISTTTDKEIAKK FATSSGIENGYIYVLNRDLFGQYSIFEYEVEHPENPNEKEVTIRAEDCGCIPEEVIIAKELIEINLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGNFLYRGISCQQDEQNNGQLKPKGNKAEVAIRYDGKFKYDGKATHGPSVKNAVYAHQIETGLYDGCYISTTTDKEIAKK FATSSGIENGYIYVLNRDLFGQYSIFEYEVEHPENPNEKEVTIRAEDCGCIPEEVIIAKELIEINLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ASN n 1 4 PHE n 1 5 LEU n 1 6 TYR n 1 7 ARG n 1 8 GLY n 1 9 ILE n 1 10 SER n 1 11 CYS n 1 12 GLN n 1 13 GLN n 1 14 ASP n 1 15 GLU n 1 16 GLN n 1 17 ASN n 1 18 ASN n 1 19 GLY n 1 20 GLN n 1 21 LEU n 1 22 LYS n 1 23 PRO n 1 24 LYS n 1 25 GLY n 1 26 ASN n 1 27 LYS n 1 28 ALA n 1 29 GLU n 1 30 VAL n 1 31 ALA n 1 32 ILE n 1 33 ARG n 1 34 TYR n 1 35 ASP n 1 36 GLY n 1 37 LYS n 1 38 PHE n 1 39 LYS n 1 40 TYR n 1 41 ASP n 1 42 GLY n 1 43 LYS n 1 44 ALA n 1 45 THR n 1 46 HIS n 1 47 GLY n 1 48 PRO n 1 49 SER n 1 50 VAL n 1 51 LYS n 1 52 ASN n 1 53 ALA n 1 54 VAL n 1 55 TYR n 1 56 ALA n 1 57 HIS n 1 58 GLN n 1 59 ILE n 1 60 GLU n 1 61 THR n 1 62 GLY n 1 63 LEU n 1 64 TYR n 1 65 ASP n 1 66 GLY n 1 67 CYS n 1 68 TYR n 1 69 ILE n 1 70 SER n 1 71 THR n 1 72 THR n 1 73 THR n 1 74 ASP n 1 75 LYS n 1 76 GLU n 1 77 ILE n 1 78 ALA n 1 79 LYS n 1 80 LYS n 1 81 PHE n 1 82 ALA n 1 83 THR n 1 84 SER n 1 85 SER n 1 86 GLY n 1 87 ILE n 1 88 GLU n 1 89 ASN n 1 90 GLY n 1 91 TYR n 1 92 ILE n 1 93 TYR n 1 94 VAL n 1 95 LEU n 1 96 ASN n 1 97 ARG n 1 98 ASP n 1 99 LEU n 1 100 PHE n 1 101 GLY n 1 102 GLN n 1 103 TYR n 1 104 SER n 1 105 ILE n 1 106 PHE n 1 107 GLU n 1 108 TYR n 1 109 GLU n 1 110 VAL n 1 111 GLU n 1 112 HIS n 1 113 PRO n 1 114 GLU n 1 115 ASN n 1 116 PRO n 1 117 ASN n 1 118 GLU n 1 119 LYS n 1 120 GLU n 1 121 VAL n 1 122 THR n 1 123 ILE n 1 124 ARG n 1 125 ALA n 1 126 GLU n 1 127 ASP n 1 128 CYS n 1 129 GLY n 1 130 CYS n 1 131 ILE n 1 132 PRO n 1 133 GLU n 1 134 GLU n 1 135 VAL n 1 136 ILE n 1 137 ILE n 1 138 ALA n 1 139 LYS n 1 140 GLU n 1 141 LEU n 1 142 ILE n 1 143 GLU n 1 144 ILE n 1 145 ASN n 1 146 LEU n 1 147 GLU n 1 148 HIS n 1 149 HIS n 1 150 HIS n 1 151 HIS n 1 152 HIS n 1 153 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene NMB1343 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain MC58 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Neisseria meningitidis serogroup B' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 122586 _entity_src_gen.pdbx_gene_src_variant 'serogroup B' _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET21b+ _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 TYR 108 108 108 TYR TYR A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 HIS 112 112 112 HIS HIS A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 CYS 128 128 128 CYS CYS A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 CYS 130 130 130 CYS CYS A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 PRO 132 132 132 PRO PRO A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 ASN 145 145 145 ASN ASN A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 HIS 148 148 148 HIS HIS A . n A 1 149 HIS 149 149 149 HIS HIS A . n A 1 150 HIS 150 150 150 HIS HIS A . n A 1 151 HIS 151 151 151 HIS HIS A . n A 1 152 HIS 152 152 152 HIS HIS A . n A 1 153 HIS 153 153 153 HIS HIS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KXI _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KXI _struct.title 'Solution NMR structure of the apoform of NarE (NMB1343)' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KXI _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'ADP ribosyltransferase, TRANSFERASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9JZ10_NEIMB _struct_ref.pdbx_db_accession Q9JZ10 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGNFLYRGISCQQDEQNNGQLKPKGNKAEVAIRYDGKFKYDGKATHGPSVKNAVYAHQIETGLYDGCYISTTTDKEIAKK FATSSGIENGYIYVLNRDLFGQYSIFEYEVEHPENPNEKEVTIRAEDCGCIPEEVIIAKELIEIN ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KXI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 145 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9JZ10 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 145 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 145 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KXI LEU A 146 ? UNP Q9JZ10 ? ? 'expression tag' 146 1 1 2KXI GLU A 147 ? UNP Q9JZ10 ? ? 'expression tag' 147 2 1 2KXI HIS A 148 ? UNP Q9JZ10 ? ? 'expression tag' 148 3 1 2KXI HIS A 149 ? UNP Q9JZ10 ? ? 'expression tag' 149 4 1 2KXI HIS A 150 ? UNP Q9JZ10 ? ? 'expression tag' 150 5 1 2KXI HIS A 151 ? UNP Q9JZ10 ? ? 'expression tag' 151 6 1 2KXI HIS A 152 ? UNP Q9JZ10 ? ? 'expression tag' 152 7 1 2KXI HIS A 153 ? UNP Q9JZ10 ? ? 'expression tag' 153 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 11 ? GLY A 19 ? CYS A 11 GLY A 19 1 ? 9 HELX_P HELX_P2 2 VAL A 50 ? THR A 61 ? VAL A 50 THR A 61 1 ? 12 HELX_P HELX_P3 3 GLU A 76 ? SER A 85 ? GLU A 76 SER A 85 1 ? 10 HELX_P HELX_P4 4 ARG A 97 ? SER A 104 ? ARG A 97 SER A 104 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 67 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 128 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 67 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 128 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.028 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 67 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 128 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 67 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 128 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 4 ? ILE A 9 ? PHE A 4 ILE A 9 A 2 ASN A 89 ? ASN A 96 ? ASN A 89 ASN A 96 A 3 ILE A 136 ? GLU A 143 ? ILE A 136 GLU A 143 B 1 ILE A 69 ? THR A 72 ? ILE A 69 THR A 72 B 2 LYS A 119 ? ARG A 124 ? LYS A 119 ARG A 124 B 3 PHE A 106 ? GLU A 111 ? PHE A 106 GLU A 111 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 7 ? N ARG A 7 O TYR A 93 ? O TYR A 93 A 2 3 N ILE A 92 ? N ILE A 92 O GLU A 140 ? O GLU A 140 B 1 2 N ILE A 69 ? N ILE A 69 O ILE A 123 ? O ILE A 123 B 2 3 O THR A 122 ? O THR A 122 N TYR A 108 ? N TYR A 108 # _pdbx_entry_details.entry_id 2KXI _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 20 ? ? -161.54 27.90 2 1 LEU A 21 ? ? 73.57 -43.43 3 1 LYS A 27 ? ? -162.37 -154.25 4 1 ALA A 28 ? ? 74.71 -77.89 5 1 ALA A 31 ? ? -57.03 -70.17 6 1 ILE A 32 ? ? 64.64 122.20 7 1 ASP A 41 ? ? 57.40 -136.93 8 1 LYS A 43 ? ? -82.28 -80.89 9 1 ALA A 44 ? ? -177.53 -34.96 10 1 SER A 49 ? ? 67.98 117.09 11 1 VAL A 50 ? ? 61.38 -175.57 12 1 LYS A 51 ? ? 68.47 177.64 13 1 GLU A 60 ? ? -92.22 -60.25 14 1 THR A 61 ? ? -90.80 -73.25 15 1 LEU A 63 ? ? -62.46 90.97 16 1 SER A 104 ? ? 71.24 32.37 17 1 PRO A 113 ? ? -46.59 158.39 18 1 CYS A 130 ? ? 55.18 70.83 19 1 ILE A 144 ? ? 66.44 108.91 20 1 GLU A 147 ? ? 70.48 -158.15 21 1 HIS A 148 ? ? 69.56 -71.72 22 1 HIS A 152 ? ? -168.89 -42.43 23 2 ASN A 3 ? ? -177.94 -82.17 24 2 LEU A 21 ? ? 61.83 95.44 25 2 LYS A 22 ? ? 56.59 118.23 26 2 ASN A 26 ? ? -179.39 -172.55 27 2 LYS A 37 ? ? -115.86 79.13 28 2 TYR A 40 ? ? -156.24 -156.05 29 2 ASP A 41 ? ? -159.17 48.97 30 2 LYS A 43 ? ? -142.63 53.21 31 2 THR A 45 ? ? 65.22 73.75 32 2 SER A 49 ? ? 55.64 -134.66 33 2 VAL A 50 ? ? 46.78 -158.59 34 2 LYS A 51 ? ? 47.20 -127.88 35 2 THR A 61 ? ? -89.40 -71.21 36 2 LEU A 63 ? ? -152.71 47.37 37 2 GLU A 88 ? ? -32.54 -35.30 38 2 SER A 104 ? ? 70.63 34.27 39 2 PRO A 113 ? ? -46.85 164.33 40 2 VAL A 121 ? ? -69.07 95.12 41 2 CYS A 130 ? ? 58.60 72.66 42 2 GLU A 143 ? ? -118.04 68.60 43 2 ILE A 144 ? ? 63.36 119.49 44 3 LEU A 21 ? ? -79.19 49.54 45 3 ALA A 28 ? ? -162.60 78.49 46 3 GLU A 29 ? ? -68.65 88.42 47 3 ILE A 32 ? ? 64.04 155.22 48 3 ARG A 33 ? ? -175.20 97.24 49 3 ASP A 35 ? ? 62.62 -162.22 50 3 TYR A 40 ? ? 63.16 79.67 51 3 ASP A 41 ? ? -125.77 -56.78 52 3 ALA A 44 ? ? -157.13 -44.84 53 3 THR A 45 ? ? -53.06 106.52 54 3 VAL A 50 ? ? -167.85 -49.82 55 3 LYS A 51 ? ? -58.88 -99.82 56 3 LEU A 63 ? ? -159.53 76.57 57 3 TYR A 64 ? ? 45.28 -88.05 58 3 ASP A 65 ? ? 166.59 -45.32 59 3 PRO A 113 ? ? -45.67 170.53 60 3 ASN A 117 ? ? 77.50 -11.35 61 3 CYS A 130 ? ? 56.89 72.90 62 3 ILE A 144 ? ? 61.21 -76.89 63 3 ASN A 145 ? ? 54.71 71.79 64 3 HIS A 148 ? ? 72.65 -65.35 65 4 PHE A 4 ? ? 66.15 112.06 66 4 CYS A 11 ? ? 177.69 155.62 67 4 GLN A 20 ? ? 72.70 81.87 68 4 LYS A 22 ? ? 73.15 152.88 69 4 ALA A 28 ? ? -130.60 -145.04 70 4 GLU A 29 ? ? -174.67 -55.83 71 4 TYR A 34 ? ? -166.23 101.10 72 4 ASP A 41 ? ? -88.17 -96.47 73 4 ALA A 44 ? ? 69.28 -72.10 74 4 THR A 45 ? ? -155.15 -61.64 75 4 SER A 49 ? ? -68.35 91.22 76 4 VAL A 50 ? ? -175.08 -166.57 77 4 LEU A 63 ? ? -148.44 59.84 78 4 GLU A 88 ? ? -28.76 -37.60 79 4 PRO A 113 ? ? -46.91 169.80 80 4 CYS A 130 ? ? 51.57 71.52 81 4 ILE A 144 ? ? 69.45 119.27 82 4 HIS A 150 ? ? -69.05 79.52 83 4 HIS A 151 ? ? -173.36 -58.97 84 4 HIS A 152 ? ? -173.68 -36.93 85 5 CYS A 11 ? ? -97.95 53.18 86 5 LEU A 21 ? ? -79.47 44.65 87 5 LYS A 22 ? ? 49.29 73.73 88 5 ALA A 31 ? ? -157.58 -52.95 89 5 TYR A 34 ? ? -112.45 56.74 90 5 LYS A 37 ? ? -65.33 88.55 91 5 PHE A 38 ? ? -66.71 87.42 92 5 LYS A 43 ? ? -176.56 -49.76 93 5 THR A 45 ? ? -61.50 -75.51 94 5 VAL A 50 ? ? 57.46 -126.38 95 5 LYS A 51 ? ? 60.36 -166.79 96 5 GLU A 60 ? ? -93.84 -64.42 97 5 THR A 61 ? ? -93.94 -64.60 98 5 ASP A 65 ? ? 69.59 -143.98 99 5 HIS A 112 ? ? -78.42 -169.70 100 5 CYS A 130 ? ? 63.73 73.59 101 5 ILE A 144 ? ? 69.29 176.72 102 5 HIS A 151 ? ? -141.27 26.73 103 5 HIS A 152 ? ? 72.20 155.57 104 6 CYS A 11 ? ? -116.70 58.76 105 6 GLN A 20 ? ? -174.71 -169.59 106 6 LYS A 24 ? ? -115.85 -152.30 107 6 ALA A 28 ? ? -85.99 49.49 108 6 GLU A 29 ? ? 64.45 -74.05 109 6 VAL A 30 ? ? -84.90 -85.50 110 6 ALA A 31 ? ? 168.60 179.02 111 6 ILE A 32 ? ? -107.97 44.41 112 6 ARG A 33 ? ? -44.13 103.27 113 6 ASP A 35 ? ? 59.92 -77.80 114 6 LYS A 37 ? ? 59.59 13.97 115 6 TYR A 40 ? ? -79.65 45.09 116 6 ASP A 41 ? ? -99.21 31.89 117 6 ALA A 44 ? ? -170.55 84.64 118 6 VAL A 50 ? ? 165.21 168.47 119 6 LYS A 51 ? ? 50.09 -159.70 120 6 THR A 61 ? ? -64.39 -76.63 121 6 LEU A 63 ? ? 64.24 -79.11 122 6 TYR A 64 ? ? -107.22 64.22 123 6 GLU A 88 ? ? -28.52 -49.04 124 6 ILE A 144 ? ? 37.91 44.97 125 6 GLU A 147 ? ? -61.64 89.14 126 6 HIS A 150 ? ? 66.26 80.32 127 7 CYS A 11 ? ? -101.36 49.08 128 7 LYS A 22 ? ? 50.98 151.91 129 7 PRO A 23 ? ? -78.52 -164.39 130 7 LYS A 27 ? ? -155.66 70.69 131 7 GLU A 29 ? ? 57.34 -79.48 132 7 TYR A 34 ? ? 66.73 -65.27 133 7 PHE A 38 ? ? 71.85 -5.79 134 7 TYR A 40 ? ? 65.03 176.08 135 7 LYS A 43 ? ? 58.24 -90.59 136 7 HIS A 46 ? ? -106.54 44.21 137 7 SER A 49 ? ? 69.42 -176.39 138 7 VAL A 50 ? ? 55.23 -168.21 139 7 LYS A 51 ? ? 59.57 -170.94 140 7 LEU A 63 ? ? -162.07 -92.60 141 7 ASP A 65 ? ? 53.65 -155.24 142 7 GLU A 88 ? ? -33.28 -39.10 143 7 SER A 104 ? ? 72.90 38.23 144 7 PRO A 113 ? ? -49.44 159.60 145 7 PRO A 116 ? ? -44.46 -18.82 146 7 CYS A 130 ? ? 60.95 70.88 147 7 ILE A 144 ? ? 61.34 -83.06 148 7 GLU A 147 ? ? 67.59 116.37 149 7 HIS A 150 ? ? 65.98 125.55 150 8 CYS A 11 ? ? 174.88 -150.26 151 8 ASN A 26 ? ? -98.87 -75.58 152 8 LYS A 27 ? ? 152.74 161.64 153 8 ALA A 28 ? ? -177.36 -95.47 154 8 GLU A 29 ? ? 65.45 113.03 155 8 VAL A 30 ? ? -175.50 136.09 156 8 ARG A 33 ? ? -59.46 95.13 157 8 PHE A 38 ? ? 72.31 158.88 158 8 HIS A 46 ? ? 83.02 -47.47 159 8 VAL A 50 ? ? -162.51 -148.93 160 8 LYS A 51 ? ? 71.01 177.59 161 8 LEU A 63 ? ? 63.32 -75.67 162 8 SER A 104 ? ? 71.89 30.43 163 8 PRO A 113 ? ? -48.15 168.67 164 8 GLU A 114 ? ? -49.46 -70.11 165 8 PRO A 116 ? ? -39.13 -22.65 166 8 CYS A 130 ? ? 59.45 72.71 167 8 ILE A 144 ? ? 36.16 99.74 168 8 LEU A 146 ? ? -94.83 -62.22 169 9 CYS A 11 ? ? 58.90 -97.15 170 9 GLN A 20 ? ? 103.91 -144.46 171 9 LYS A 22 ? ? 68.52 131.40 172 9 ALA A 28 ? ? -113.33 -143.30 173 9 ALA A 31 ? ? -143.28 26.23 174 9 ASP A 35 ? ? -174.61 -62.36 175 9 ASP A 41 ? ? -145.98 -150.40 176 9 VAL A 50 ? ? 50.64 -175.93 177 9 LYS A 51 ? ? 72.79 175.52 178 9 LEU A 63 ? ? 44.53 22.05 179 9 TYR A 64 ? ? 54.84 17.15 180 9 ASP A 65 ? ? 36.47 47.02 181 9 PRO A 113 ? ? -45.20 168.85 182 9 PRO A 116 ? ? -37.17 -21.69 183 9 ASN A 117 ? ? 83.65 -3.94 184 9 GLU A 126 ? ? -39.44 -39.85 185 9 ILE A 144 ? ? 70.73 107.36 186 9 HIS A 148 ? ? -86.35 39.59 187 9 HIS A 149 ? ? 72.01 -12.82 188 9 HIS A 150 ? ? -170.31 109.12 189 9 HIS A 152 ? ? 77.11 -49.06 190 10 ASN A 3 ? ? 90.45 -106.61 191 10 CYS A 11 ? ? -86.02 48.88 192 10 LYS A 22 ? ? 69.65 137.11 193 10 ALA A 28 ? ? 178.81 -31.42 194 10 GLU A 29 ? ? 71.61 -64.53 195 10 VAL A 30 ? ? 69.75 147.83 196 10 ASP A 41 ? ? -82.94 -98.36 197 10 ALA A 44 ? ? 66.70 -77.75 198 10 SER A 49 ? ? 61.18 73.43 199 10 TYR A 64 ? ? -62.51 83.91 200 10 ASP A 65 ? ? -57.71 82.05 201 10 PRO A 113 ? ? -45.95 164.05 202 10 CYS A 130 ? ? 63.90 71.84 203 10 ILE A 144 ? ? 60.01 87.82 204 10 HIS A 149 ? ? 66.20 -84.88 205 10 HIS A 150 ? ? -169.24 21.78 206 10 HIS A 151 ? ? 47.96 -139.85 207 11 ASN A 3 ? ? -168.69 -97.70 208 11 CYS A 11 ? ? 60.16 -86.27 209 11 GLN A 20 ? ? 179.65 -175.91 210 11 ASN A 26 ? ? 78.93 117.09 211 11 LYS A 27 ? ? -137.33 -80.43 212 11 ALA A 28 ? ? -173.00 -85.82 213 11 GLU A 29 ? ? -136.61 -156.49 214 11 ALA A 31 ? ? -159.66 -157.33 215 11 ILE A 32 ? ? 68.14 -93.01 216 11 ARG A 33 ? ? 66.40 155.97 217 11 LYS A 37 ? ? 64.70 -74.26 218 11 PHE A 38 ? ? 61.64 68.28 219 11 LYS A 39 ? ? -84.08 44.54 220 11 SER A 49 ? ? -126.28 -146.35 221 11 VAL A 50 ? ? 60.87 -111.09 222 11 LYS A 51 ? ? 30.91 -134.79 223 11 ILE A 59 ? ? -88.77 -70.26 224 11 LEU A 63 ? ? 64.05 79.83 225 11 GLU A 88 ? ? -39.45 -34.41 226 11 PRO A 113 ? ? -45.79 163.26 227 11 ASN A 117 ? ? 70.55 30.07 228 11 CYS A 130 ? ? 57.49 71.31 229 11 LEU A 146 ? ? 64.49 -88.90 230 11 HIS A 149 ? ? 61.72 83.35 231 11 HIS A 151 ? ? 68.07 -147.02 232 12 GLN A 20 ? ? -170.93 -178.05 233 12 LEU A 21 ? ? -82.06 38.42 234 12 LYS A 24 ? ? -143.24 -138.50 235 12 LYS A 27 ? ? 65.55 -160.97 236 12 GLU A 29 ? ? -40.22 105.98 237 12 ALA A 31 ? ? -149.75 -50.77 238 12 ILE A 32 ? ? 52.41 -134.62 239 12 ARG A 33 ? ? -177.90 102.32 240 12 ASP A 41 ? ? -93.98 54.12 241 12 ALA A 44 ? ? -119.82 -106.05 242 12 THR A 45 ? ? 58.52 78.34 243 12 PRO A 48 ? ? -82.91 -133.92 244 12 SER A 49 ? ? 54.34 -161.81 245 12 VAL A 50 ? ? -93.81 -105.79 246 12 LYS A 51 ? ? 60.67 -169.42 247 12 THR A 61 ? ? -91.09 -80.57 248 12 LEU A 63 ? ? -57.33 86.06 249 12 TYR A 64 ? ? 61.55 60.27 250 12 PRO A 113 ? ? -44.28 160.91 251 12 PRO A 116 ? ? -39.37 -23.22 252 12 CYS A 130 ? ? 47.46 70.40 253 12 LEU A 146 ? ? -95.34 43.38 254 12 HIS A 152 ? ? 62.37 107.33 255 13 ASN A 3 ? ? 84.72 171.17 256 13 GLN A 20 ? ? -153.02 17.57 257 13 LEU A 21 ? ? 60.88 98.35 258 13 LYS A 22 ? ? 68.40 137.69 259 13 ASN A 26 ? ? -163.43 -64.80 260 13 GLU A 29 ? ? 72.63 -61.86 261 13 ASP A 41 ? ? -93.80 -108.73 262 13 THR A 45 ? ? 72.94 -57.18 263 13 SER A 49 ? ? -89.35 42.69 264 13 VAL A 50 ? ? -103.44 -74.33 265 13 LYS A 51 ? ? 58.26 179.13 266 13 ASP A 65 ? ? 63.16 -171.52 267 13 GLU A 88 ? ? -38.56 -37.51 268 13 PRO A 113 ? ? -50.40 170.20 269 13 ASN A 117 ? ? 72.25 -11.65 270 13 CYS A 130 ? ? 46.87 70.29 271 13 LEU A 146 ? ? -94.10 -85.40 272 13 HIS A 148 ? ? -162.37 66.58 273 13 HIS A 151 ? ? 65.91 -134.02 274 14 CYS A 11 ? ? -94.43 55.32 275 14 LEU A 21 ? ? -81.38 49.02 276 14 ASN A 26 ? ? -152.97 21.77 277 14 ALA A 28 ? ? -97.77 -110.71 278 14 VAL A 30 ? ? -65.50 86.32 279 14 TYR A 34 ? ? -69.57 73.63 280 14 PHE A 38 ? ? -77.13 30.22 281 14 ASP A 41 ? ? -68.03 78.75 282 14 LYS A 43 ? ? 67.07 179.61 283 14 ALA A 44 ? ? -104.68 -156.67 284 14 GLU A 60 ? ? -81.58 -74.86 285 14 LEU A 63 ? ? 59.97 -88.31 286 14 ASP A 65 ? ? 63.54 -74.07 287 14 GLU A 88 ? ? -29.21 -43.26 288 14 PRO A 113 ? ? -46.82 167.73 289 14 CYS A 130 ? ? 52.14 70.88 290 14 ILE A 144 ? ? 66.15 102.56 291 14 LEU A 146 ? ? -92.11 -62.84 292 15 ASN A 3 ? ? -169.86 -50.70 293 15 CYS A 11 ? ? -90.09 42.29 294 15 LEU A 21 ? ? -69.33 73.32 295 15 LYS A 22 ? ? 66.27 149.47 296 15 LYS A 27 ? ? -115.18 52.76 297 15 VAL A 30 ? ? 65.01 -3.65 298 15 ALA A 31 ? ? -89.16 47.10 299 15 ALA A 44 ? ? 53.81 -128.74 300 15 HIS A 46 ? ? 76.11 -49.47 301 15 VAL A 50 ? ? 61.25 172.70 302 15 LYS A 51 ? ? 59.05 -172.18 303 15 LEU A 63 ? ? -156.18 -157.76 304 15 ASP A 65 ? ? -60.78 91.47 305 15 SER A 104 ? ? 72.13 31.00 306 15 PRO A 113 ? ? -47.70 170.02 307 15 CYS A 130 ? ? 57.21 72.00 308 15 ILE A 144 ? ? 61.56 85.53 309 16 PHE A 4 ? ? 39.73 -170.78 310 16 CYS A 11 ? ? -99.15 35.93 311 16 GLN A 20 ? ? 174.44 158.36 312 16 LEU A 21 ? ? -65.02 97.67 313 16 LYS A 22 ? ? 69.86 154.31 314 16 ALA A 28 ? ? -168.01 112.60 315 16 ALA A 31 ? ? -150.07 -147.41 316 16 ILE A 32 ? ? 75.55 104.10 317 16 ARG A 33 ? ? -137.05 -45.61 318 16 TYR A 34 ? ? 67.49 124.79 319 16 LYS A 39 ? ? 63.27 88.78 320 16 TYR A 40 ? ? -140.16 31.44 321 16 ALA A 44 ? ? -177.27 141.75 322 16 SER A 49 ? ? -149.72 -107.15 323 16 VAL A 50 ? ? 54.51 -174.30 324 16 LYS A 51 ? ? 57.74 -154.23 325 16 TYR A 64 ? ? 33.74 46.87 326 16 THR A 73 ? ? -69.80 10.44 327 16 GLU A 88 ? ? -28.68 -39.75 328 16 GLU A 114 ? ? -47.54 -70.37 329 16 ASN A 117 ? ? 70.58 32.29 330 16 ILE A 144 ? ? -45.97 93.66 331 16 ASN A 145 ? ? 179.83 -37.87 332 16 LEU A 146 ? ? 71.24 107.43 333 16 HIS A 149 ? ? 25.47 56.04 334 16 HIS A 150 ? ? -177.24 -71.56 335 17 GLN A 20 ? ? -175.53 30.30 336 17 LYS A 22 ? ? 44.60 74.84 337 17 ALA A 28 ? ? -129.96 -69.68 338 17 GLU A 29 ? ? 171.66 -157.44 339 17 TYR A 34 ? ? -85.27 -106.72 340 17 ASP A 35 ? ? -156.19 -141.78 341 17 LYS A 39 ? ? -66.50 77.53 342 17 LYS A 43 ? ? 66.11 -71.82 343 17 THR A 45 ? ? -158.48 36.45 344 17 LYS A 51 ? ? 55.39 -157.04 345 17 TYR A 64 ? ? -91.07 38.22 346 17 GLU A 88 ? ? -37.58 -39.04 347 17 CYS A 130 ? ? 49.03 70.43 348 17 ILE A 144 ? ? 147.29 141.06 349 17 GLU A 147 ? ? 55.20 -105.78 350 17 HIS A 150 ? ? -65.99 91.11 351 18 CYS A 11 ? ? -152.89 58.98 352 18 LEU A 21 ? ? -65.03 91.58 353 18 LYS A 22 ? ? 74.70 132.12 354 18 ASN A 26 ? ? 45.92 -88.21 355 18 LYS A 27 ? ? -172.02 -172.74 356 18 ALA A 28 ? ? -179.19 -46.67 357 18 GLU A 29 ? ? 71.70 -18.27 358 18 LYS A 37 ? ? 74.47 -58.81 359 18 THR A 45 ? ? -150.33 -78.68 360 18 VAL A 50 ? ? -114.63 -127.94 361 18 LYS A 51 ? ? 59.59 -167.37 362 18 LEU A 63 ? ? -81.05 -75.87 363 18 PRO A 113 ? ? -49.76 171.02 364 18 CYS A 130 ? ? 63.26 74.82 365 18 ILE A 144 ? ? 70.34 94.32 366 18 HIS A 149 ? ? -101.99 57.17 367 18 HIS A 150 ? ? -166.28 42.11 368 18 HIS A 151 ? ? 53.49 -97.67 369 18 HIS A 152 ? ? -152.17 15.45 370 19 CYS A 11 ? ? -84.80 49.03 371 19 LEU A 21 ? ? -85.11 42.29 372 19 LYS A 24 ? ? -160.23 -135.01 373 19 LYS A 27 ? ? 71.83 115.00 374 19 VAL A 30 ? ? -164.59 -39.16 375 19 TYR A 34 ? ? 75.77 -42.36 376 19 LYS A 37 ? ? 69.48 -79.16 377 19 PHE A 38 ? ? -168.76 -99.78 378 19 LYS A 43 ? ? -93.30 52.27 379 19 ALA A 44 ? ? 70.07 -68.75 380 19 VAL A 50 ? ? 51.95 -160.15 381 19 LYS A 51 ? ? 52.90 -146.20 382 19 GLU A 60 ? ? -85.70 -74.22 383 19 THR A 61 ? ? -96.08 -64.41 384 19 LEU A 63 ? ? -175.96 -44.49 385 19 GLU A 88 ? ? -29.22 -50.41 386 19 PRO A 113 ? ? -48.37 170.08 387 19 GLU A 114 ? ? -40.79 -71.07 388 19 CYS A 130 ? ? 41.62 70.34 389 19 ILE A 144 ? ? 37.70 -133.09 390 19 GLU A 147 ? ? -142.60 -3.93 391 19 HIS A 148 ? ? 71.89 47.66 392 19 HIS A 149 ? ? -161.39 -38.92 393 19 HIS A 150 ? ? 51.49 -163.29 394 20 LYS A 22 ? ? 32.76 71.91 395 20 LYS A 24 ? ? -126.26 -54.30 396 20 ALA A 28 ? ? -171.09 -138.06 397 20 ALA A 31 ? ? -160.54 34.49 398 20 TYR A 34 ? ? -164.55 -166.47 399 20 PRO A 48 ? ? -70.21 -88.44 400 20 SER A 49 ? ? 67.62 162.17 401 20 TYR A 64 ? ? 74.31 -28.00 402 20 ASP A 65 ? ? 61.79 101.25 403 20 PRO A 113 ? ? -46.63 164.70 404 20 CYS A 130 ? ? 57.76 70.30 405 20 ILE A 144 ? ? 70.56 -66.78 406 20 ASN A 145 ? ? 54.20 77.84 407 20 LEU A 146 ? ? -153.67 -50.16 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 400 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KXI _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 4.8 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.36 _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.03 _pdbx_nmr_ensemble_rms.distance_rms_dev_error ? _pdbx_nmr_ensemble_rms.entry_id 2KXI _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KXI _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details ;0.3 mM [U-100% 15N] NMB1343, 75 mM sodium chloride, 25 mM sodium phosphate, 0.01 % sodium azide, 0.5 mM TSP, 1 mM DTT, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' sample_1 solution ? ;0.6 mM [U-100% 13C; U-100% 15N] NMB1343, 75 mM sodium chloride, 25 mM sodium phosphate, 0.01 % sodium azide, 0.5 mM TSP, 1 mM DTT, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' sample_2 solution ? ;0.8 mM [U-100% 13C; U-100% 15N] NMB1343, 75 mM sodium chloride, 25 mM sodium phosphate, 0.01 % sodium azide, 0.5 mM TSP, 1 mM DTT, 100% D2O ; 3 '100% D2O' sample_3 solution ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id NMB1343-1 0.3 ? mM '[U-100% 15N]' 1 'sodium chloride-2' 75 ? mM ? 1 'sodium phosphate-3' 25 ? mM ? 1 'sodium azide-4' 0.01 ? % ? 1 TSP-5 0.5 ? mM ? 1 DTT-6 1 ? mM ? 1 NMB1343-7 0.6 ? mM '[U-100% 13C; U-100% 15N]' 2 'sodium chloride-8' 75 ? mM ? 2 'sodium phosphate-9' 25 ? mM ? 2 'sodium azide-10' 0.01 ? % ? 2 TSP-11 0.5 ? mM ? 2 DTT-12 1 ? mM ? 2 NMB1343-13 0.8 ? mM '[U-100% 13C; U-100% 15N]' 3 'sodium chloride-14' 75 ? mM ? 3 'sodium phosphate-15' 25 ? mM ? 3 'sodium azide-16' 0.01 ? % ? 3 TSP-17 0.5 ? mM ? 3 DTT-18 1 ? mM ? 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 7.3 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.temperature_units K _pdbx_nmr_exptl_sample_conditions.label sample_conditions _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 3 '2D 1H-13C HSQC' 1 3 2 '3D CBCA(CO)NH' 1 4 2 '3D HNCACB' 1 5 2 '3D HNCO' 1 6 2 '3D HN(CA)CO' 1 7 2 '3D HNCA' 1 8 2 '3D HBHA(CO)NH' 1 9 1 '3D 1H-15N NOESY' 1 10 3 '3D 1H-13C NOESY' 1 11 3 '3D HCCH-TOCSY' 1 12 3 '2D 1H-1H TOCSY' 1 13 2 '2D 1H-1H NOESY' 1 14 1 '2D 1H-15N HSQC T1 edited' 1 15 1 '2D 1H-15N HSQC T2 edited' 1 16 1 '2D 1H-15N NOESY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KXI _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 85 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 661 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 0 _pdbx_nmr_constraints.NOE_long_range_total_count 257 _pdbx_nmr_constraints.NOE_medium_range_total_count 139 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 265 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 99 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 99 # _pdbx_nmr_refine.entry_id 2KXI _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'CNS refinement in water' _pdbx_nmr_refine.software_ordinal 7 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin ? 1 'Bruker Biospin' processing TopSpin ? 2 Goddard 'chemical shift assignment' Sparky ? 3 Goddard 'peak picking' Sparky ? 4 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 5 'Cornilescu, Delaglio and Bax' 'structure solution' TALOS ? 6 ? refinement CNS ? 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 900 Bruker AVANCE 1 'Bruker Avance' 750 Oxford AVANCE 2 'Oxford Avance' 600 Bruker AVANCE 3 'Bruker Avance' # _atom_sites.entry_id 2KXI _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_