data_2KYB # _entry.id 2KYB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KYB pdb_00002kyb 10.2210/pdb2kyb/pdb RCSB RCSB101725 ? ? BMRB 16944 ? 10.13018/BMR16944 WWPDB D_1000101725 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-06-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-05 4 'Structure model' 1 3 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Experimental preparation' 6 3 'Structure model' Other 7 4 'Structure model' 'Data collection' 8 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_nmr_sample_details 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond 9 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_sample_details.contents' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KYB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-05-21 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 16944 BMRB unspecified . CpR82G TargetDB unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mobley, C.K.' 1 'Lee, H.' 2 'Lee, D.' 3 'Ciccosanti, C.' 4 'Janjua, H.' 5 'Acton, T.B.' 6 'Xiao, R.' 7 'Everrett, J.K.' 8 'Montelione, G.T.' 9 'Prestegard, J.H.' 10 'Northeast Structural Genomics Consortium (NESG)' 11 # _citation.id primary _citation.title 'Solution Structure of CpR82G' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mobley, C.K.' 1 ? primary 'Lee, H.' 2 ? primary 'Montelione, G.T.' 3 ? primary 'Prestegard, J.H.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase domain protein, possible enterotoxin' _entity.formula_weight 6339.147 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'sequence database residues 300-358' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MKTGIVNVSSSLNVRSSASTSSKVIGSLSGNTKVTIVGEEGAFYKIEYKGSHGYVAKEYI _entity_poly.pdbx_seq_one_letter_code_can MKTGIVNVSSSLNVRSSASTSSKVIGSLSGNTKVTIVGEEGAFYKIEYKGSHGYVAKEYI _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier CpR82G # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 THR n 1 4 GLY n 1 5 ILE n 1 6 VAL n 1 7 ASN n 1 8 VAL n 1 9 SER n 1 10 SER n 1 11 SER n 1 12 LEU n 1 13 ASN n 1 14 VAL n 1 15 ARG n 1 16 SER n 1 17 SER n 1 18 ALA n 1 19 SER n 1 20 THR n 1 21 SER n 1 22 SER n 1 23 LYS n 1 24 VAL n 1 25 ILE n 1 26 GLY n 1 27 SER n 1 28 LEU n 1 29 SER n 1 30 GLY n 1 31 ASN n 1 32 THR n 1 33 LYS n 1 34 VAL n 1 35 THR n 1 36 ILE n 1 37 VAL n 1 38 GLY n 1 39 GLU n 1 40 GLU n 1 41 GLY n 1 42 ALA n 1 43 PHE n 1 44 TYR n 1 45 LYS n 1 46 ILE n 1 47 GLU n 1 48 TYR n 1 49 LYS n 1 50 GLY n 1 51 SER n 1 52 HIS n 1 53 GLY n 1 54 TYR n 1 55 VAL n 1 56 ALA n 1 57 LYS n 1 58 GLU n 1 59 TYR n 1 60 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'entD, CPF_1439' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 13124, NCTC 8237, Type A' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Clostridium perfringens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 195103 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'pET 21-23C' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 ILE 60 60 60 ILE ILE A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KYB _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KYB _struct.title 'Solution structure of CpR82G from Clostridium perfringens. North East Structural Genomics Consortium Target CpR82g' _struct.pdbx_model_details 'fewest violations, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KYB _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q0TR56_CLOP1 _struct_ref.pdbx_db_accession Q0TR56 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KTGIVNVSSSLNVRSSASTSSKVIGSLSGNTKVTIVGEEGAFYKIEYKGSHGYVAKEY _struct_ref.pdbx_align_begin 300 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KYB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 59 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q0TR56 _struct_ref_seq.db_align_beg 300 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 357 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 59 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KYB MET A 1 ? UNP Q0TR56 ? ? 'expression tag' 1 1 1 2KYB ILE A 60 ? UNP Q0TR56 ? ? 'expression tag' 60 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 19 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 23 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 19 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 23 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? C ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 4 ? ILE A 5 ? GLY A 4 ILE A 5 A 2 LYS A 33 ? VAL A 34 ? LYS A 33 VAL A 34 B 1 ASN A 13 ? VAL A 14 ? ASN A 13 VAL A 14 B 2 GLY A 26 ? SER A 27 ? GLY A 26 SER A 27 C 1 GLU A 39 ? GLU A 40 ? GLU A 39 GLU A 40 C 2 PHE A 43 ? LYS A 45 ? PHE A 43 LYS A 45 C 3 TYR A 54 ? ALA A 56 ? TYR A 54 ALA A 56 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 4 ? N GLY A 4 O VAL A 34 ? O VAL A 34 B 1 2 N VAL A 14 ? N VAL A 14 O GLY A 26 ? O GLY A 26 C 1 2 N GLU A 40 ? N GLU A 40 O PHE A 43 ? O PHE A 43 C 2 3 N TYR A 44 ? N TYR A 44 O VAL A 55 ? O VAL A 55 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 H A SER 27 ? ? HZ1 A LYS 49 ? ? 1.27 2 3 H A GLU 40 ? ? O A PHE 43 ? ? 1.50 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 7 ? ? -55.77 109.18 2 1 VAL A 8 ? ? -66.40 72.28 3 1 SER A 9 ? ? -85.39 -104.59 4 1 SER A 10 ? ? -157.29 -28.02 5 1 ALA A 18 ? ? -72.97 40.40 6 1 LYS A 23 ? ? 71.14 -177.20 7 1 ILE A 25 ? ? -148.82 -22.43 8 1 ILE A 36 ? ? -34.49 145.66 9 1 VAL A 37 ? ? -154.30 67.54 10 1 ALA A 42 ? ? -77.47 38.87 11 2 ASN A 7 ? ? -56.31 83.42 12 2 VAL A 8 ? ? 47.71 -126.25 13 2 SER A 9 ? ? 57.78 136.69 14 2 SER A 17 ? ? -176.28 -173.17 15 2 ALA A 18 ? ? -61.81 17.24 16 2 LYS A 23 ? ? 66.05 -163.27 17 3 ASN A 7 ? ? 8.72 -109.27 18 3 VAL A 8 ? ? -143.02 -52.25 19 3 SER A 9 ? ? -170.14 77.75 20 3 SER A 17 ? ? 175.86 38.85 21 3 ALA A 18 ? ? 76.07 45.39 22 3 LYS A 23 ? ? 80.43 -170.58 23 3 ILE A 36 ? ? -50.53 171.57 24 3 VAL A 37 ? ? -139.29 -92.42 25 3 ALA A 42 ? ? 76.46 30.41 26 3 LYS A 49 ? ? 47.49 27.47 27 4 SER A 10 ? ? 69.54 -171.80 28 4 SER A 22 ? ? -58.90 -173.82 29 4 ILE A 36 ? ? -34.47 146.94 30 4 LYS A 49 ? ? 56.69 10.86 31 5 SER A 9 ? ? -52.08 105.97 32 5 SER A 10 ? ? 60.42 -122.38 33 5 ILE A 36 ? ? -43.02 160.06 34 5 VAL A 37 ? ? -123.34 -92.50 35 5 ALA A 42 ? ? -84.90 30.37 36 5 LYS A 49 ? ? 59.18 16.49 37 6 LYS A 2 ? ? -63.84 -79.80 38 6 SER A 9 ? ? -168.59 -78.88 39 6 SER A 10 ? ? -131.15 -133.74 40 6 SER A 17 ? ? 175.80 -177.95 41 6 ALA A 18 ? ? -97.11 42.97 42 6 ASN A 31 ? ? 164.61 16.30 43 6 VAL A 37 ? ? -127.40 -97.86 44 6 GLU A 47 ? ? -95.75 58.73 45 7 ASN A 7 ? ? -59.63 102.28 46 7 SER A 17 ? ? -176.74 -178.13 47 7 LYS A 23 ? ? -163.24 109.90 48 7 VAL A 24 ? ? 62.06 135.92 49 7 ILE A 25 ? ? -152.57 -17.14 50 7 ILE A 36 ? ? -36.75 147.17 51 8 LYS A 2 ? ? 52.43 98.09 52 8 SER A 9 ? ? -49.42 109.28 53 8 SER A 10 ? ? 61.67 -125.42 54 8 ALA A 18 ? ? -83.72 47.33 55 8 SER A 22 ? ? -76.71 21.07 56 8 LYS A 23 ? ? 48.13 167.25 57 8 ILE A 36 ? ? -47.23 163.83 58 8 VAL A 37 ? ? -129.25 -94.18 59 8 LYS A 49 ? ? 53.53 17.55 60 9 LYS A 2 ? ? -77.44 26.81 61 9 SER A 9 ? ? -170.51 -55.98 62 9 SER A 10 ? ? -148.79 -110.98 63 9 ALA A 18 ? ? -101.30 53.61 64 9 VAL A 37 ? ? -131.91 -96.00 65 9 LYS A 49 ? ? 52.92 18.47 66 10 LYS A 2 ? ? 51.76 92.09 67 10 ASN A 7 ? ? -49.20 96.83 68 10 SER A 22 ? ? -60.47 -172.02 69 10 ILE A 36 ? ? -48.49 167.00 70 10 VAL A 37 ? ? -128.07 -91.86 71 10 LYS A 49 ? ? 54.11 17.56 # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KYB _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KYB _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1.01 mM [U-100% 13C; U-100% 15N] CpR82G-1, 0.02 % sodium azide-2, 100 mM DTT-3, 5 mM Calcium Chloride-4, 100 mM sodium chloride-5, 20 mM MES-6, 95% H2O/5% D2O ; 1 '95% H2O/5% D2O' ;0.98 mM U-5% 13C; U-100% 15N CpR82G-7, 0.02 % sodium azide-8, 100 mM DTT-9, 5 mM Calcium Chloride-10, 100 mM sodium chloride-11, 20 mM MES-12, 95% H2O/5% D2O ; 2 '95% H2O/5% D2O' ;0.67 mM [U-100% 13C; U-100% 15N] CpR82G-13, 0.016 % sodium azide-14, 81.73 mM DTT-15, 4.09 mM Calcium Chloride-16, 81.73 mM sodium chloride-17, 16.35 mM MES-18, 4 % C12E5 PEG-19, 1.25 % Hexanol-20, 82.88% H2O/17.12% D2O ; 3 '82.88% H2O/17.12% D2O' ;0.92 mM CpR82G-21, 0.018 % sodium azide-22, 91.67 mM DTT-23, 4.58 mM Calcium Chloride-24, 91.67 mM sodium chloride-25, 18.32 mM MES-26, 7 % Positively Charged Compressed Polyacrylamide Gel-27, 91.3% H2O/8.7% D2O ; 4 '91.3% H2O/8.7% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id CpR82G-1 1.01 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium azide-2' 0.02 ? % ? 1 DTT-3 100 ? mM ? 1 'Calcium Chloride-4' 5 ? mM ? 1 'sodium chloride-5' 100 ? mM ? 1 MES-6 20 ? mM ? 1 CpR82G-7 0.98 ? mM 'U-5% 13C; U-100% 15N' 2 'sodium azide-8' 0.02 ? % ? 2 DTT-9 100 ? mM ? 2 'Calcium Chloride-10' 5 ? mM ? 2 'sodium chloride-11' 100 ? mM ? 2 MES-12 20 ? mM ? 2 CpR82G-13 0.67 ? mM '[U-100% 13C; U-100% 15N]' 3 'sodium azide-14' 0.016 ? % ? 3 DTT-15 81.73 ? mM ? 3 'Calcium Chloride-16' 4.09 ? mM ? 3 'sodium chloride-17' 81.73 ? mM ? 3 MES-18 16.35 ? mM ? 3 'C12E5 PEG-19' 4 ? % ? 3 Hexanol-20 1.25 ? % ? 3 CpR82G-21 0.92 ? mM ? 4 'sodium azide-22' 0.018 ? % ? 4 DTT-23 91.67 ? mM ? 4 'Calcium Chloride-24' 4.58 ? mM ? 4 'sodium chloride-25' 91.67 ? mM ? 4 MES-26 18.32 ? mM ? 4 'Positively Charged Compressed Polyacrylamide Gel-27' 7 ? % ? 4 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 205 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D C(CO)NH' 1 2 1 '3D 1H-15N NOESY' 1 3 1 '3D 1H-13C NOESY' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '2D 1H-13C HSQC' 1 6 1 '2D 1H-15N HSQC' 1 7 1 '3D HBHA(CO)NH' 1 8 1 '3D HCCH-TOCSY' 1 9 1 '3D H(CCO)NH' 1 10 1 '3D HNCACB' 1 11 2 '2D 1H-13C HSQC CT 28ms delay' 1 12 2 '2D 1H-13C HSQC CT 42ms delay' 1 13 2 '2D 1H-13C HSQC CT 56ms delay' 1 14 3 NH-J-modulation 1 15 4 NH-J-modulation 1 16 1 '3D HNCO' 1 17 1 hbcbcgcdhdA 1 18 1 hbcbcgcdceheA 1 19 1 '2D 1H-13C HSQC aromatic' # _pdbx_nmr_refine.entry_id 2KYB _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1.5 1 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' 2.18 2 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRViewJ 8.0.b17 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 4 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'data analysis' NMRDraw ? 5 'Bhattacharya and Montelione' 'data analysis' PSVS ? 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 GLU N N N N 58 GLU CA C N S 59 GLU C C N N 60 GLU O O N N 61 GLU CB C N N 62 GLU CG C N N 63 GLU CD C N N 64 GLU OE1 O N N 65 GLU OE2 O N N 66 GLU OXT O N N 67 GLU H H N N 68 GLU H2 H N N 69 GLU HA H N N 70 GLU HB2 H N N 71 GLU HB3 H N N 72 GLU HG2 H N N 73 GLU HG3 H N N 74 GLU HE2 H N N 75 GLU HXT H N N 76 GLY N N N N 77 GLY CA C N N 78 GLY C C N N 79 GLY O O N N 80 GLY OXT O N N 81 GLY H H N N 82 GLY H2 H N N 83 GLY HA2 H N N 84 GLY HA3 H N N 85 GLY HXT H N N 86 HIS N N N N 87 HIS CA C N S 88 HIS C C N N 89 HIS O O N N 90 HIS CB C N N 91 HIS CG C Y N 92 HIS ND1 N Y N 93 HIS CD2 C Y N 94 HIS CE1 C Y N 95 HIS NE2 N Y N 96 HIS OXT O N N 97 HIS H H N N 98 HIS H2 H N N 99 HIS HA H N N 100 HIS HB2 H N N 101 HIS HB3 H N N 102 HIS HD1 H N N 103 HIS HD2 H N N 104 HIS HE1 H N N 105 HIS HE2 H N N 106 HIS HXT H N N 107 ILE N N N N 108 ILE CA C N S 109 ILE C C N N 110 ILE O O N N 111 ILE CB C N S 112 ILE CG1 C N N 113 ILE CG2 C N N 114 ILE CD1 C N N 115 ILE OXT O N N 116 ILE H H N N 117 ILE H2 H N N 118 ILE HA H N N 119 ILE HB H N N 120 ILE HG12 H N N 121 ILE HG13 H N N 122 ILE HG21 H N N 123 ILE HG22 H N N 124 ILE HG23 H N N 125 ILE HD11 H N N 126 ILE HD12 H N N 127 ILE HD13 H N N 128 ILE HXT H N N 129 LEU N N N N 130 LEU CA C N S 131 LEU C C N N 132 LEU O O N N 133 LEU CB C N N 134 LEU CG C N N 135 LEU CD1 C N N 136 LEU CD2 C N N 137 LEU OXT O N N 138 LEU H H N N 139 LEU H2 H N N 140 LEU HA H N N 141 LEU HB2 H N N 142 LEU HB3 H N N 143 LEU HG H N N 144 LEU HD11 H N N 145 LEU HD12 H N N 146 LEU HD13 H N N 147 LEU HD21 H N N 148 LEU HD22 H N N 149 LEU HD23 H N N 150 LEU HXT H N N 151 LYS N N N N 152 LYS CA C N S 153 LYS C C N N 154 LYS O O N N 155 LYS CB C N N 156 LYS CG C N N 157 LYS CD C N N 158 LYS CE C N N 159 LYS NZ N N N 160 LYS OXT O N N 161 LYS H H N N 162 LYS H2 H N N 163 LYS HA H N N 164 LYS HB2 H N N 165 LYS HB3 H N N 166 LYS HG2 H N N 167 LYS HG3 H N N 168 LYS HD2 H N N 169 LYS HD3 H N N 170 LYS HE2 H N N 171 LYS HE3 H N N 172 LYS HZ1 H N N 173 LYS HZ2 H N N 174 LYS HZ3 H N N 175 LYS HXT H N N 176 MET N N N N 177 MET CA C N S 178 MET C C N N 179 MET O O N N 180 MET CB C N N 181 MET CG C N N 182 MET SD S N N 183 MET CE C N N 184 MET OXT O N N 185 MET H H N N 186 MET H2 H N N 187 MET HA H N N 188 MET HB2 H N N 189 MET HB3 H N N 190 MET HG2 H N N 191 MET HG3 H N N 192 MET HE1 H N N 193 MET HE2 H N N 194 MET HE3 H N N 195 MET HXT H N N 196 PHE N N N N 197 PHE CA C N S 198 PHE C C N N 199 PHE O O N N 200 PHE CB C N N 201 PHE CG C Y N 202 PHE CD1 C Y N 203 PHE CD2 C Y N 204 PHE CE1 C Y N 205 PHE CE2 C Y N 206 PHE CZ C Y N 207 PHE OXT O N N 208 PHE H H N N 209 PHE H2 H N N 210 PHE HA H N N 211 PHE HB2 H N N 212 PHE HB3 H N N 213 PHE HD1 H N N 214 PHE HD2 H N N 215 PHE HE1 H N N 216 PHE HE2 H N N 217 PHE HZ H N N 218 PHE HXT H N N 219 SER N N N N 220 SER CA C N S 221 SER C C N N 222 SER O O N N 223 SER CB C N N 224 SER OG O N N 225 SER OXT O N N 226 SER H H N N 227 SER H2 H N N 228 SER HA H N N 229 SER HB2 H N N 230 SER HB3 H N N 231 SER HG H N N 232 SER HXT H N N 233 THR N N N N 234 THR CA C N S 235 THR C C N N 236 THR O O N N 237 THR CB C N R 238 THR OG1 O N N 239 THR CG2 C N N 240 THR OXT O N N 241 THR H H N N 242 THR H2 H N N 243 THR HA H N N 244 THR HB H N N 245 THR HG1 H N N 246 THR HG21 H N N 247 THR HG22 H N N 248 THR HG23 H N N 249 THR HXT H N N 250 TYR N N N N 251 TYR CA C N S 252 TYR C C N N 253 TYR O O N N 254 TYR CB C N N 255 TYR CG C Y N 256 TYR CD1 C Y N 257 TYR CD2 C Y N 258 TYR CE1 C Y N 259 TYR CE2 C Y N 260 TYR CZ C Y N 261 TYR OH O N N 262 TYR OXT O N N 263 TYR H H N N 264 TYR H2 H N N 265 TYR HA H N N 266 TYR HB2 H N N 267 TYR HB3 H N N 268 TYR HD1 H N N 269 TYR HD2 H N N 270 TYR HE1 H N N 271 TYR HE2 H N N 272 TYR HH H N N 273 TYR HXT H N N 274 VAL N N N N 275 VAL CA C N S 276 VAL C C N N 277 VAL O O N N 278 VAL CB C N N 279 VAL CG1 C N N 280 VAL CG2 C N N 281 VAL OXT O N N 282 VAL H H N N 283 VAL H2 H N N 284 VAL HA H N N 285 VAL HB H N N 286 VAL HG11 H N N 287 VAL HG12 H N N 288 VAL HG13 H N N 289 VAL HG21 H N N 290 VAL HG22 H N N 291 VAL HG23 H N N 292 VAL HXT H N N 293 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 GLU N CA sing N N 55 GLU N H sing N N 56 GLU N H2 sing N N 57 GLU CA C sing N N 58 GLU CA CB sing N N 59 GLU CA HA sing N N 60 GLU C O doub N N 61 GLU C OXT sing N N 62 GLU CB CG sing N N 63 GLU CB HB2 sing N N 64 GLU CB HB3 sing N N 65 GLU CG CD sing N N 66 GLU CG HG2 sing N N 67 GLU CG HG3 sing N N 68 GLU CD OE1 doub N N 69 GLU CD OE2 sing N N 70 GLU OE2 HE2 sing N N 71 GLU OXT HXT sing N N 72 GLY N CA sing N N 73 GLY N H sing N N 74 GLY N H2 sing N N 75 GLY CA C sing N N 76 GLY CA HA2 sing N N 77 GLY CA HA3 sing N N 78 GLY C O doub N N 79 GLY C OXT sing N N 80 GLY OXT HXT sing N N 81 HIS N CA sing N N 82 HIS N H sing N N 83 HIS N H2 sing N N 84 HIS CA C sing N N 85 HIS CA CB sing N N 86 HIS CA HA sing N N 87 HIS C O doub N N 88 HIS C OXT sing N N 89 HIS CB CG sing N N 90 HIS CB HB2 sing N N 91 HIS CB HB3 sing N N 92 HIS CG ND1 sing Y N 93 HIS CG CD2 doub Y N 94 HIS ND1 CE1 doub Y N 95 HIS ND1 HD1 sing N N 96 HIS CD2 NE2 sing Y N 97 HIS CD2 HD2 sing N N 98 HIS CE1 NE2 sing Y N 99 HIS CE1 HE1 sing N N 100 HIS NE2 HE2 sing N N 101 HIS OXT HXT sing N N 102 ILE N CA sing N N 103 ILE N H sing N N 104 ILE N H2 sing N N 105 ILE CA C sing N N 106 ILE CA CB sing N N 107 ILE CA HA sing N N 108 ILE C O doub N N 109 ILE C OXT sing N N 110 ILE CB CG1 sing N N 111 ILE CB CG2 sing N N 112 ILE CB HB sing N N 113 ILE CG1 CD1 sing N N 114 ILE CG1 HG12 sing N N 115 ILE CG1 HG13 sing N N 116 ILE CG2 HG21 sing N N 117 ILE CG2 HG22 sing N N 118 ILE CG2 HG23 sing N N 119 ILE CD1 HD11 sing N N 120 ILE CD1 HD12 sing N N 121 ILE CD1 HD13 sing N N 122 ILE OXT HXT sing N N 123 LEU N CA sing N N 124 LEU N H sing N N 125 LEU N H2 sing N N 126 LEU CA C sing N N 127 LEU CA CB sing N N 128 LEU CA HA sing N N 129 LEU C O doub N N 130 LEU C OXT sing N N 131 LEU CB CG sing N N 132 LEU CB HB2 sing N N 133 LEU CB HB3 sing N N 134 LEU CG CD1 sing N N 135 LEU CG CD2 sing N N 136 LEU CG HG sing N N 137 LEU CD1 HD11 sing N N 138 LEU CD1 HD12 sing N N 139 LEU CD1 HD13 sing N N 140 LEU CD2 HD21 sing N N 141 LEU CD2 HD22 sing N N 142 LEU CD2 HD23 sing N N 143 LEU OXT HXT sing N N 144 LYS N CA sing N N 145 LYS N H sing N N 146 LYS N H2 sing N N 147 LYS CA C sing N N 148 LYS CA CB sing N N 149 LYS CA HA sing N N 150 LYS C O doub N N 151 LYS C OXT sing N N 152 LYS CB CG sing N N 153 LYS CB HB2 sing N N 154 LYS CB HB3 sing N N 155 LYS CG CD sing N N 156 LYS CG HG2 sing N N 157 LYS CG HG3 sing N N 158 LYS CD CE sing N N 159 LYS CD HD2 sing N N 160 LYS CD HD3 sing N N 161 LYS CE NZ sing N N 162 LYS CE HE2 sing N N 163 LYS CE HE3 sing N N 164 LYS NZ HZ1 sing N N 165 LYS NZ HZ2 sing N N 166 LYS NZ HZ3 sing N N 167 LYS OXT HXT sing N N 168 MET N CA sing N N 169 MET N H sing N N 170 MET N H2 sing N N 171 MET CA C sing N N 172 MET CA CB sing N N 173 MET CA HA sing N N 174 MET C O doub N N 175 MET C OXT sing N N 176 MET CB CG sing N N 177 MET CB HB2 sing N N 178 MET CB HB3 sing N N 179 MET CG SD sing N N 180 MET CG HG2 sing N N 181 MET CG HG3 sing N N 182 MET SD CE sing N N 183 MET CE HE1 sing N N 184 MET CE HE2 sing N N 185 MET CE HE3 sing N N 186 MET OXT HXT sing N N 187 PHE N CA sing N N 188 PHE N H sing N N 189 PHE N H2 sing N N 190 PHE CA C sing N N 191 PHE CA CB sing N N 192 PHE CA HA sing N N 193 PHE C O doub N N 194 PHE C OXT sing N N 195 PHE CB CG sing N N 196 PHE CB HB2 sing N N 197 PHE CB HB3 sing N N 198 PHE CG CD1 doub Y N 199 PHE CG CD2 sing Y N 200 PHE CD1 CE1 sing Y N 201 PHE CD1 HD1 sing N N 202 PHE CD2 CE2 doub Y N 203 PHE CD2 HD2 sing N N 204 PHE CE1 CZ doub Y N 205 PHE CE1 HE1 sing N N 206 PHE CE2 CZ sing Y N 207 PHE CE2 HE2 sing N N 208 PHE CZ HZ sing N N 209 PHE OXT HXT sing N N 210 SER N CA sing N N 211 SER N H sing N N 212 SER N H2 sing N N 213 SER CA C sing N N 214 SER CA CB sing N N 215 SER CA HA sing N N 216 SER C O doub N N 217 SER C OXT sing N N 218 SER CB OG sing N N 219 SER CB HB2 sing N N 220 SER CB HB3 sing N N 221 SER OG HG sing N N 222 SER OXT HXT sing N N 223 THR N CA sing N N 224 THR N H sing N N 225 THR N H2 sing N N 226 THR CA C sing N N 227 THR CA CB sing N N 228 THR CA HA sing N N 229 THR C O doub N N 230 THR C OXT sing N N 231 THR CB OG1 sing N N 232 THR CB CG2 sing N N 233 THR CB HB sing N N 234 THR OG1 HG1 sing N N 235 THR CG2 HG21 sing N N 236 THR CG2 HG22 sing N N 237 THR CG2 HG23 sing N N 238 THR OXT HXT sing N N 239 TYR N CA sing N N 240 TYR N H sing N N 241 TYR N H2 sing N N 242 TYR CA C sing N N 243 TYR CA CB sing N N 244 TYR CA HA sing N N 245 TYR C O doub N N 246 TYR C OXT sing N N 247 TYR CB CG sing N N 248 TYR CB HB2 sing N N 249 TYR CB HB3 sing N N 250 TYR CG CD1 doub Y N 251 TYR CG CD2 sing Y N 252 TYR CD1 CE1 sing Y N 253 TYR CD1 HD1 sing N N 254 TYR CD2 CE2 doub Y N 255 TYR CD2 HD2 sing N N 256 TYR CE1 CZ doub Y N 257 TYR CE1 HE1 sing N N 258 TYR CE2 CZ sing Y N 259 TYR CE2 HE2 sing N N 260 TYR CZ OH sing N N 261 TYR OH HH sing N N 262 TYR OXT HXT sing N N 263 VAL N CA sing N N 264 VAL N H sing N N 265 VAL N H2 sing N N 266 VAL CA C sing N N 267 VAL CA CB sing N N 268 VAL CA HA sing N N 269 VAL C O doub N N 270 VAL C OXT sing N N 271 VAL CB CG1 sing N N 272 VAL CB CG2 sing N N 273 VAL CB HB sing N N 274 VAL CG1 HG11 sing N N 275 VAL CG1 HG12 sing N N 276 VAL CG1 HG13 sing N N 277 VAL CG2 HG21 sing N N 278 VAL CG2 HG22 sing N N 279 VAL CG2 HG23 sing N N 280 VAL OXT HXT sing N N 281 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 600 Varian INOVA 2 'Varian INOVA' # _atom_sites.entry_id 2KYB _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_