data_2KZR # _entry.id 2KZR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KZR pdb_00002kzr 10.2210/pdb2kzr/pdb RCSB RCSB101776 ? ? BMRB 17017 ? ? WWPDB D_1000101776 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17017 BMRB unspecified . MmT2A TargetDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KZR _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-06-23 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chitayat, S.' 1 'Gutmanas, A.' 2 'Lemak, A.' 3 'Yee, A.' 4 'Bezsonova, I.' 5 'Wu, B.' 6 'Doherty, R.S.' 7 'Semesi, A.' 8 'Montelione, G.T.' 9 'Arrowsmith, C.H.' 10 'Dhe-Paganon, S.' 11 'Northeast Structural Genomics Consortium (NESG)' 12 # _citation.id primary _citation.title 'Northeast Structural Genomics Consortium Target MmT2A' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chitayat, S.' 1 ? primary 'Gutmanas, A.' 2 ? primary 'Lemak, A.' 3 ? primary 'Yee, A.' 4 ? primary 'Bezsonova, I.' 5 ? primary 'Wu, B.' 6 ? primary 'Doherty, R.S.' 7 ? primary 'Semesi, A.' 8 ? primary 'Arrowsmith, C.H.' 9 ? primary 'Dhe-Paganon, S.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ubiquitin thioesterase OTU1' _entity.formula_weight 9364.707 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.1.2.- _entity.pdbx_mutation ? _entity.pdbx_fragment 'UBX-like domain 42-127' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;WRVRCKAKGGTHLLQGLSSRTRLRELQGQIAAITGIAPGSQRILVGYPPECLDLSDRDITLGDLPIQSGDMLIVEEDQTR PKASPS ; _entity_poly.pdbx_seq_one_letter_code_can ;WRVRCKAKGGTHLLQGLSSRTRLRELQGQIAAITGIAPGSQRILVGYPPECLDLSDRDITLGDLPIQSGDMLIVEEDQTR PKASPS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier MmT2A # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 TRP n 1 2 ARG n 1 3 VAL n 1 4 ARG n 1 5 CYS n 1 6 LYS n 1 7 ALA n 1 8 LYS n 1 9 GLY n 1 10 GLY n 1 11 THR n 1 12 HIS n 1 13 LEU n 1 14 LEU n 1 15 GLN n 1 16 GLY n 1 17 LEU n 1 18 SER n 1 19 SER n 1 20 ARG n 1 21 THR n 1 22 ARG n 1 23 LEU n 1 24 ARG n 1 25 GLU n 1 26 LEU n 1 27 GLN n 1 28 GLY n 1 29 GLN n 1 30 ILE n 1 31 ALA n 1 32 ALA n 1 33 ILE n 1 34 THR n 1 35 GLY n 1 36 ILE n 1 37 ALA n 1 38 PRO n 1 39 GLY n 1 40 SER n 1 41 GLN n 1 42 ARG n 1 43 ILE n 1 44 LEU n 1 45 VAL n 1 46 GLY n 1 47 TYR n 1 48 PRO n 1 49 PRO n 1 50 GLU n 1 51 CYS n 1 52 LEU n 1 53 ASP n 1 54 LEU n 1 55 SER n 1 56 ASP n 1 57 ARG n 1 58 ASP n 1 59 ILE n 1 60 THR n 1 61 LEU n 1 62 GLY n 1 63 ASP n 1 64 LEU n 1 65 PRO n 1 66 ILE n 1 67 GLN n 1 68 SER n 1 69 GLY n 1 70 ASP n 1 71 MET n 1 72 LEU n 1 73 ILE n 1 74 VAL n 1 75 GLU n 1 76 GLU n 1 77 ASP n 1 78 GLN n 1 79 THR n 1 80 ARG n 1 81 PRO n 1 82 LYS n 1 83 ALA n 1 84 SER n 1 85 PRO n 1 86 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Yod1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pMgK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET28-MHL _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code OTU1_MOUSE _struct_ref.pdbx_db_accession Q8CB27 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;WRVRCKAKGGTHLLQGLSSRTRLRELQGQIAAITGIAPGSQRILVGYPPECLDLSDRDITLGDLPIQSGDMLIVEEDQTR PKASPA ; _struct_ref.pdbx_align_begin 42 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KZR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 86 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8CB27 _struct_ref_seq.db_align_beg 42 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 127 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 86 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2KZR _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 86 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q8CB27 _struct_ref_seq_dif.db_mon_id ALA _struct_ref_seq_dif.pdbx_seq_db_seq_num 127 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 86 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D 1H-13C arom NOESY' 1 6 1 '3D HBHA(CO)NH' 1 7 1 '3D HNCA' 1 8 1 '3D 1H-15N NOESY' 1 9 1 '3D 1H-13C NOESY' 1 10 1 '3D HCCH-TOCSY' 1 11 1 '3D HCCH-TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1.1 mM [U-100% 13C; U-100% 15N] MmT2A, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2KZR _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KZR _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KZR _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'geometry optimization' CNS ? 3 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 4 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA 3.0 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 6 'Huang, Tejero, Powers and Montelione' 'data analysis,refinement' AutoStructure 2.1 7 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 8 'Bruker Biospin' collection TopSpin ? 9 Goddard 'data analysis' Sparky ? 10 'Shen, Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS+ ? 11 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRDraw ? 12 'Koradi, Billeter and Wuthrich' 'data analysis' MOLMOL ? 13 'Gutmanas, Arrowsmith' processing MDDGUI 1.0 14 'Lemak, Arrowsmith' 'chemical shift assignment' FMCGUI 2.3 15 'Lemak, Arrowsmith' refinement FMCGUI 2.3 16 'Lemak, Arrowsmith' 'structure solution' FMCGUI 2.3 17 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ;Solution NMR Structure of Ubiquitin thioesterase OTU1 EC3.1.2.- from Mus musculus, Northeast Structural Genomics Consortium Target MmT2A ; _exptl.entry_id 2KZR _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KZR _struct.title ;Solution NMR Structure of Ubiquitin thioesterase OTU1 (EC 3.1.2.-) from Mus musculus, Northeast Structural Genomics Consortium Target MmT2A ; _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KZR _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-2, Protein Structure Initiative, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ARG _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 22 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id THR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 34 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ARG _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 22 _struct_conf.end_auth_comp_id THR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 34 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 10 ? LEU A 14 ? GLY A 10 LEU A 14 A 2 VAL A 3 ? ALA A 7 ? VAL A 3 ALA A 7 A 3 MET A 71 ? ILE A 73 ? MET A 71 ILE A 73 A 4 LEU A 44 ? VAL A 45 ? LEU A 44 VAL A 45 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O HIS A 12 ? O HIS A 12 N CYS A 5 ? N CYS A 5 A 2 3 N ARG A 4 ? N ARG A 4 O LEU A 72 ? O LEU A 72 A 3 4 O ILE A 73 ? O ILE A 73 N LEU A 44 ? N LEU A 44 # _atom_sites.entry_id 2KZR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 TRP 1 1 1 TRP TRP A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 SER 86 86 86 SER SER A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-07-07 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-05 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' struct_ref_seq_dif 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' 7 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_nmr_exptl_sample.component MmT2A-1 _pdbx_nmr_exptl_sample.concentration 1.1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 48 ? ? -41.22 101.46 2 1 ARG A 57 ? ? -141.88 -29.16 3 1 SER A 68 ? ? -68.47 96.46 4 1 GLN A 78 ? ? 78.66 -51.16 5 1 PRO A 81 ? ? -56.27 89.01 6 2 PRO A 48 ? ? -39.65 107.60 7 2 PRO A 65 ? ? -77.66 42.79 8 2 THR A 79 ? ? -96.03 30.99 9 2 ARG A 80 ? ? 67.44 120.18 10 2 LYS A 82 ? ? 61.54 101.77 11 2 PRO A 85 ? ? -36.08 -35.73 12 3 PRO A 48 ? ? -43.09 108.36 13 3 ARG A 80 ? ? 54.64 107.60 14 4 PRO A 48 ? ? -45.61 108.52 15 4 CYS A 51 ? ? 56.03 84.37 16 5 PRO A 48 ? ? -49.25 106.66 17 5 CYS A 51 ? ? 55.43 79.42 18 5 SER A 55 ? ? -126.72 -51.32 19 5 PRO A 65 ? ? -53.15 83.50 20 6 SER A 18 ? ? -116.81 -166.26 21 6 PRO A 48 ? ? -58.06 100.31 22 6 LEU A 52 ? ? -67.18 99.92 23 6 PRO A 65 ? ? -78.94 44.82 24 7 PRO A 65 ? ? -69.60 78.49 25 8 SER A 18 ? ? -116.07 -166.82 26 8 PRO A 65 ? ? -87.20 34.24 27 8 GLN A 78 ? ? 59.91 12.94 28 9 PRO A 48 ? ? -42.04 104.97 29 9 PRO A 65 ? ? -81.61 41.77 30 9 SER A 68 ? ? -64.40 99.51 31 9 ARG A 80 ? ? 65.59 91.75 32 9 PRO A 85 ? ? -59.45 85.48 33 10 PRO A 48 ? ? -37.45 103.45 34 10 CYS A 51 ? ? 56.14 74.35 35 10 PRO A 65 ? ? -78.49 25.49 36 11 PRO A 48 ? ? -45.29 108.04 37 11 PRO A 65 ? ? -80.66 36.65 38 11 ARG A 80 ? ? 66.89 165.46 39 12 ILE A 33 ? ? -84.27 -70.07 40 12 SER A 40 ? ? -140.37 12.62 41 12 PRO A 65 ? ? -78.07 31.51 42 12 ARG A 80 ? ? 43.99 76.04 43 12 SER A 84 ? ? 64.72 77.84 44 12 PRO A 85 ? ? -69.90 82.57 45 13 ILE A 33 ? ? -82.78 -70.35 46 13 PRO A 48 ? ? -50.89 109.21 47 13 CYS A 51 ? ? 56.27 83.05 48 13 PRO A 65 ? ? -63.21 78.26 49 13 ARG A 80 ? ? 54.94 76.67 50 13 LYS A 82 ? ? -67.47 95.24 51 14 SER A 40 ? ? -146.60 12.99 52 14 CYS A 51 ? ? 57.04 82.37 53 14 ARG A 57 ? ? -132.17 -31.10 54 14 ASP A 63 ? ? -100.76 -63.06 55 14 PRO A 65 ? ? -55.64 78.74 56 14 SER A 68 ? ? -63.74 95.92 57 14 THR A 79 ? ? -88.83 41.08 58 14 ARG A 80 ? ? 53.47 77.70 59 14 PRO A 81 ? ? -64.61 -176.43 60 14 LYS A 82 ? ? 75.90 -24.60 61 15 PRO A 48 ? ? -46.24 104.73 62 15 LEU A 52 ? ? -39.59 140.93 63 15 PRO A 65 ? ? -79.20 45.10 64 15 GLN A 78 ? ? 67.94 -86.61 65 15 THR A 79 ? ? 38.58 -67.11 66 15 ARG A 80 ? ? 69.80 76.42 67 15 PRO A 81 ? ? -83.03 -153.07 68 15 ALA A 83 ? ? 69.64 -72.88 69 16 PRO A 48 ? ? -46.95 107.10 70 16 GLU A 50 ? ? -94.78 34.33 71 16 CYS A 51 ? ? 75.66 -54.30 72 16 LEU A 52 ? ? 68.01 90.96 73 16 PRO A 65 ? ? -82.57 43.53 74 16 GLN A 78 ? ? 69.90 -80.26 75 16 THR A 79 ? ? 38.55 -62.84 76 16 ARG A 80 ? ? 83.97 80.68 77 17 ARG A 2 ? ? -108.47 71.63 78 17 LYS A 8 ? ? 70.39 -75.45 79 17 LEU A 17 ? ? 42.16 104.80 80 17 PRO A 48 ? ? -53.17 108.63 81 17 ASP A 63 ? ? -93.88 -60.75 82 17 PRO A 65 ? ? -79.13 39.65 83 17 ARG A 80 ? ? 61.32 72.25 84 17 PRO A 85 ? ? -40.15 101.14 85 18 PRO A 48 ? ? -39.55 109.39 86 18 CYS A 51 ? ? 55.50 73.26 87 18 LEU A 54 ? ? -100.24 78.98 88 18 PRO A 65 ? ? -69.09 21.65 89 18 ARG A 80 ? ? 38.91 68.31 90 18 LYS A 82 ? ? -94.37 41.35 91 19 ARG A 42 ? ? -120.19 -166.16 92 19 PRO A 48 ? ? -33.61 100.69 93 19 CYS A 51 ? ? -47.79 86.28 94 19 PRO A 65 ? ? -75.60 37.32 95 19 ARG A 80 ? ? 58.85 76.53 96 20 SER A 40 ? ? -135.53 -35.75 97 20 PRO A 48 ? ? -39.66 101.15 98 20 CYS A 51 ? ? 53.93 71.29 99 20 ASP A 56 ? ? -126.05 -157.38 100 20 ARG A 57 ? ? -147.95 -31.39 101 20 PRO A 65 ? ? -78.93 40.97 102 20 ARG A 80 ? ? 61.14 76.99 #