data_2L0B # _entry.id 2L0B # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2L0B pdb_00002l0b 10.2210/pdb2l0b/pdb RCSB RCSB101795 ? ? WWPDB D_1000101795 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-08-25 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_nmr_software 5 3 'Structure model' pdbx_nmr_spectrometer 6 3 'Structure model' pdbx_struct_conn_angle 7 3 'Structure model' struct_conn 8 3 'Structure model' struct_ref_seq_dif 9 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.value' 16 3 'Structure model' '_struct_conn.pdbx_dist_value' 17 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 23 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 24 3 'Structure model' '_struct_ref_seq_dif.details' 25 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 26 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 27 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L0B _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-06-30 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id HR4710B _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, G.' 1 'Tong, S.' 2 'Hamilton, K.' 3 'Ciccosanti, C.' 4 'Shastry, R.' 5 'Acton, T.B.' 6 'Xiao, R.' 7 'Everett, J.K.' 8 'Montelione, G.T.' 9 'Northeast Structural Genomics Consortium (NESG)' 10 # _citation.id primary _citation.title ;Solution structure of zinc finger domain of E3 ubiquitin-protein ligase protein praja-1 from Homo sapiens, northeast structural genomics consortium (NESG) target HR4710B ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, G.' 1 ? primary 'Tong, S.' 2 ? primary 'Xiao, R.' 3 ? primary 'Acton, T.B.' 4 ? primary 'Everett, J.K.' 5 ? primary 'Montelione, G.T.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'E3 ubiquitin-protein ligase Praja-1' 10111.733 1 6.3.2.- ? 'RING-type zinc finger residues 564-643' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Praja1, RING finger protein 70' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGHHHHHHSHMVANPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELPCHHYFHKPCVSIWLQKSGTC PVCRCMFPPPL ; _entity_poly.pdbx_seq_one_letter_code_can ;MGHHHHHHSHMVANPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELPCHHYFHKPCVSIWLQKSGTC PVCRCMFPPPL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier HR4710B # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 SER n 1 10 HIS n 1 11 MET n 1 12 VAL n 1 13 ALA n 1 14 ASN n 1 15 PRO n 1 16 PRO n 1 17 ALA n 1 18 SER n 1 19 LYS n 1 20 GLU n 1 21 SER n 1 22 ILE n 1 23 ASP n 1 24 ALA n 1 25 LEU n 1 26 PRO n 1 27 GLU n 1 28 ILE n 1 29 LEU n 1 30 VAL n 1 31 THR n 1 32 GLU n 1 33 ASP n 1 34 HIS n 1 35 GLY n 1 36 ALA n 1 37 VAL n 1 38 GLY n 1 39 GLN n 1 40 GLU n 1 41 MET n 1 42 CYS n 1 43 CYS n 1 44 PRO n 1 45 ILE n 1 46 CYS n 1 47 CYS n 1 48 SER n 1 49 GLU n 1 50 TYR n 1 51 VAL n 1 52 LYS n 1 53 GLY n 1 54 ASP n 1 55 VAL n 1 56 ALA n 1 57 THR n 1 58 GLU n 1 59 LEU n 1 60 PRO n 1 61 CYS n 1 62 HIS n 1 63 HIS n 1 64 TYR n 1 65 PHE n 1 66 HIS n 1 67 LYS n 1 68 PRO n 1 69 CYS n 1 70 VAL n 1 71 SER n 1 72 ILE n 1 73 TRP n 1 74 LEU n 1 75 GLN n 1 76 LYS n 1 77 SER n 1 78 GLY n 1 79 THR n 1 80 CYS n 1 81 PRO n 1 82 VAL n 1 83 CYS n 1 84 ARG n 1 85 CYS n 1 86 MET n 1 87 PHE n 1 88 PRO n 1 89 PRO n 1 90 PRO n 1 91 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PJA1, RNF70' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'pET 14-15C' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 MET 41 41 41 MET MET A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 CYS 61 61 61 CYS CYS A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 CYS 69 69 69 CYS CYS A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 TRP 73 73 73 TRP TRP A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 CYS 80 80 80 CYS CYS A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 CYS 83 83 83 CYS CYS A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 CYS 85 85 85 CYS CYS A . n A 1 86 MET 86 86 86 MET MET A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 LEU 91 91 91 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 143 143 ZN ZN A . C 2 ZN 1 161 161 ZN ZN A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L0B _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L0B _struct.title ;Solution NMR structure of zinc finger domain of E3 ubiquitin-protein ligase praja-1 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) target HR4710B ; _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag Y _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L0B _struct_keywords.pdbx_keywords LIGASE _struct_keywords.text 'Zinc finger, NESG, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, LIGASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PJA1_HUMAN _struct_ref.pdbx_db_accession Q8NG27 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VANPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGEVATELPCHHYFHKPCVSIWLQKSGTCPVCRCMFPPPL ; _struct_ref.pdbx_align_begin 564 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L0B _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 12 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 91 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8NG27 _struct_ref_seq.db_align_beg 564 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 643 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 12 _struct_ref_seq.pdbx_auth_seq_align_end 91 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2L0B MET A 1 ? UNP Q8NG27 ? ? 'expression tag' 1 1 1 2L0B GLY A 2 ? UNP Q8NG27 ? ? 'expression tag' 2 2 1 2L0B HIS A 3 ? UNP Q8NG27 ? ? 'expression tag' 3 3 1 2L0B HIS A 4 ? UNP Q8NG27 ? ? 'expression tag' 4 4 1 2L0B HIS A 5 ? UNP Q8NG27 ? ? 'expression tag' 5 5 1 2L0B HIS A 6 ? UNP Q8NG27 ? ? 'expression tag' 6 6 1 2L0B HIS A 7 ? UNP Q8NG27 ? ? 'expression tag' 7 7 1 2L0B HIS A 8 ? UNP Q8NG27 ? ? 'expression tag' 8 8 1 2L0B SER A 9 ? UNP Q8NG27 ? ? 'expression tag' 9 9 1 2L0B HIS A 10 ? UNP Q8NG27 ? ? 'expression tag' 10 10 1 2L0B MET A 11 ? UNP Q8NG27 ? ? 'expression tag' 11 11 1 2L0B ASP A 54 ? UNP Q8NG27 GLU 606 conflict 54 12 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 18 ? ALA A 24 ? SER A 18 ALA A 24 1 ? 7 HELX_P HELX_P2 2 LYS A 67 ? GLN A 75 ? LYS A 67 GLN A 75 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 43 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 43 A ZN 143 1_555 ? ? ? ? ? ? ? 2.442 ? ? metalc2 metalc ? ? A CYS 46 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 46 A ZN 143 1_555 ? ? ? ? ? ? ? 2.240 ? ? metalc3 metalc ? ? A CYS 61 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 61 A ZN 161 1_555 ? ? ? ? ? ? ? 2.258 ? ? metalc4 metalc ? ? A HIS 63 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 63 A ZN 161 1_555 ? ? ? ? ? ? ? 2.107 ? ? metalc5 metalc ? ? A HIS 66 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 66 A ZN 143 1_555 ? ? ? ? ? ? ? 2.104 ? ? metalc6 metalc ? ? A CYS 69 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 69 A ZN 143 1_555 ? ? ? ? ? ? ? 2.401 ? ? metalc7 metalc ? ? A CYS 80 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 80 A ZN 161 1_555 ? ? ? ? ? ? ? 2.446 ? ? metalc8 metalc ? ? A CYS 83 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 83 A ZN 161 1_555 ? ? ? ? ? ? ? 2.370 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 43 ? A CYS 43 ? 1_555 ZN ? B ZN . ? A ZN 143 ? 1_555 SG ? A CYS 46 ? A CYS 46 ? 1_555 101.5 ? 2 SG ? A CYS 43 ? A CYS 43 ? 1_555 ZN ? B ZN . ? A ZN 143 ? 1_555 ND1 ? A HIS 66 ? A HIS 66 ? 1_555 97.4 ? 3 SG ? A CYS 46 ? A CYS 46 ? 1_555 ZN ? B ZN . ? A ZN 143 ? 1_555 ND1 ? A HIS 66 ? A HIS 66 ? 1_555 123.1 ? 4 SG ? A CYS 43 ? A CYS 43 ? 1_555 ZN ? B ZN . ? A ZN 143 ? 1_555 SG ? A CYS 69 ? A CYS 69 ? 1_555 97.4 ? 5 SG ? A CYS 46 ? A CYS 46 ? 1_555 ZN ? B ZN . ? A ZN 143 ? 1_555 SG ? A CYS 69 ? A CYS 69 ? 1_555 114.4 ? 6 ND1 ? A HIS 66 ? A HIS 66 ? 1_555 ZN ? B ZN . ? A ZN 143 ? 1_555 SG ? A CYS 69 ? A CYS 69 ? 1_555 115.6 ? 7 SG ? A CYS 61 ? A CYS 61 ? 1_555 ZN ? C ZN . ? A ZN 161 ? 1_555 ND1 ? A HIS 63 ? A HIS 63 ? 1_555 121.5 ? 8 SG ? A CYS 61 ? A CYS 61 ? 1_555 ZN ? C ZN . ? A ZN 161 ? 1_555 SG ? A CYS 80 ? A CYS 80 ? 1_555 100.9 ? 9 ND1 ? A HIS 63 ? A HIS 63 ? 1_555 ZN ? C ZN . ? A ZN 161 ? 1_555 SG ? A CYS 80 ? A CYS 80 ? 1_555 97.4 ? 10 SG ? A CYS 61 ? A CYS 61 ? 1_555 ZN ? C ZN . ? A ZN 161 ? 1_555 SG ? A CYS 83 ? A CYS 83 ? 1_555 115.3 ? 11 ND1 ? A HIS 63 ? A HIS 63 ? 1_555 ZN ? C ZN . ? A ZN 161 ? 1_555 SG ? A CYS 83 ? A CYS 83 ? 1_555 116.7 ? 12 SG ? A CYS 80 ? A CYS 80 ? 1_555 ZN ? C ZN . ? A ZN 161 ? 1_555 SG ? A CYS 83 ? A CYS 83 ? 1_555 97.4 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PHE 87 A . ? PHE 87 A PRO 88 A ? PRO 88 A 1 3.42 2 PHE 87 A . ? PHE 87 A PRO 88 A ? PRO 88 A 2 3.43 3 PHE 87 A . ? PHE 87 A PRO 88 A ? PRO 88 A 3 -0.80 4 PHE 87 A . ? PHE 87 A PRO 88 A ? PRO 88 A 4 -2.54 5 PHE 87 A . ? PHE 87 A PRO 88 A ? PRO 88 A 5 2.17 6 PHE 87 A . ? PHE 87 A PRO 88 A ? PRO 88 A 6 0.16 7 PHE 87 A . ? PHE 87 A PRO 88 A ? PRO 88 A 7 2.03 8 PHE 87 A . ? PHE 87 A PRO 88 A ? PRO 88 A 8 -1.99 9 PHE 87 A . ? PHE 87 A PRO 88 A ? PRO 88 A 9 -0.57 10 PHE 87 A . ? PHE 87 A PRO 88 A ? PRO 88 A 10 -0.89 11 PHE 87 A . ? PHE 87 A PRO 88 A ? PRO 88 A 11 2.81 12 PHE 87 A . ? PHE 87 A PRO 88 A ? PRO 88 A 12 2.14 13 PHE 87 A . ? PHE 87 A PRO 88 A ? PRO 88 A 13 1.19 14 PHE 87 A . ? PHE 87 A PRO 88 A ? PRO 88 A 14 -0.47 15 PHE 87 A . ? PHE 87 A PRO 88 A ? PRO 88 A 15 2.32 16 PHE 87 A . ? PHE 87 A PRO 88 A ? PRO 88 A 16 0.08 17 PHE 87 A . ? PHE 87 A PRO 88 A ? PRO 88 A 17 -0.52 18 PHE 87 A . ? PHE 87 A PRO 88 A ? PRO 88 A 18 2.79 19 PHE 87 A . ? PHE 87 A PRO 88 A ? PRO 88 A 19 -1.94 20 PHE 87 A . ? PHE 87 A PRO 88 A ? PRO 88 A 20 -2.33 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 27 ? LEU A 29 ? GLU A 27 LEU A 29 A 2 VAL A 55 ? LEU A 59 ? VAL A 55 LEU A 59 A 3 HIS A 63 ? HIS A 66 ? HIS A 63 HIS A 66 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 28 ? N ILE A 28 O ALA A 56 ? O ALA A 56 A 2 3 N LEU A 59 ? N LEU A 59 O HIS A 63 ? O HIS A 63 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 143 ? 4 'BINDING SITE FOR RESIDUE ZN A 143' AC2 Software A ZN 161 ? 4 'BINDING SITE FOR RESIDUE ZN A 161' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 43 ? CYS A 43 . ? 1_555 ? 2 AC1 4 CYS A 46 ? CYS A 46 . ? 1_555 ? 3 AC1 4 HIS A 66 ? HIS A 66 . ? 1_555 ? 4 AC1 4 CYS A 69 ? CYS A 69 . ? 1_555 ? 5 AC2 4 CYS A 61 ? CYS A 61 . ? 1_555 ? 6 AC2 4 HIS A 63 ? HIS A 63 . ? 1_555 ? 7 AC2 4 CYS A 80 ? CYS A 80 . ? 1_555 ? 8 AC2 4 CYS A 83 ? CYS A 83 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HG1 A THR 31 ? ? OD1 A ASP 33 ? ? 1.58 2 1 OD1 A ASP 23 ? ? HZ1 A LYS 67 ? ? 1.59 3 2 HG11 A VAL 30 ? ? HA2 A GLY 35 ? ? 1.31 4 9 OD1 A ASP 54 ? ? HE2 A HIS 66 ? ? 1.60 5 10 O A CYS 80 ? ? H A ARG 84 ? ? 1.59 6 18 O A CYS 80 ? ? H A ARG 84 ? ? 1.59 7 20 OE1 A GLU 40 ? ? HE2 A HIS 63 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 10 ? ? 72.30 143.65 2 1 GLN A 39 ? ? -160.97 -155.87 3 2 HIS A 7 ? ? -149.84 23.63 4 2 HIS A 8 ? ? -55.67 103.63 5 2 MET A 11 ? ? 64.51 65.91 6 2 HIS A 34 ? ? -141.32 34.76 7 2 VAL A 37 ? ? 60.51 91.79 8 2 GLN A 39 ? ? -141.16 -52.65 9 2 PRO A 60 ? ? -58.81 -7.80 10 3 HIS A 4 ? ? -113.91 79.81 11 3 PRO A 60 ? ? -63.44 4.32 12 3 HIS A 62 ? ? 66.59 89.13 13 3 HIS A 63 ? ? -172.53 125.40 14 3 ARG A 84 ? ? 63.67 91.71 15 4 ASN A 14 ? ? 70.32 101.54 16 4 ALA A 36 ? ? 67.17 -2.83 17 4 VAL A 37 ? ? 72.77 -64.84 18 4 PRO A 60 ? ? -68.83 51.04 19 4 CYS A 61 ? ? -153.37 16.80 20 4 HIS A 62 ? ? 56.95 18.16 21 4 SER A 77 ? ? -172.33 117.28 22 5 HIS A 10 ? ? 70.86 -34.87 23 5 HIS A 62 ? ? 69.22 62.44 24 6 HIS A 7 ? ? -97.86 -68.69 25 6 ASP A 33 ? ? 76.14 -51.51 26 6 HIS A 34 ? ? -111.38 55.74 27 6 SER A 77 ? ? -148.74 11.66 28 7 HIS A 3 ? ? 58.42 78.18 29 7 HIS A 8 ? ? -59.98 109.68 30 7 SER A 9 ? ? -171.17 112.23 31 8 HIS A 3 ? ? -108.54 -169.89 32 8 MET A 11 ? ? 69.57 -63.30 33 8 MET A 41 ? ? -141.13 13.09 34 8 GLU A 49 ? ? -77.92 -169.99 35 8 PRO A 60 ? ? -59.79 -9.72 36 9 HIS A 3 ? ? -126.02 -57.48 37 9 HIS A 4 ? ? 57.00 71.60 38 9 VAL A 12 ? ? -150.79 -27.72 39 9 HIS A 34 ? ? -153.18 64.60 40 11 HIS A 4 ? ? -117.34 51.13 41 11 SER A 9 ? ? -56.90 103.80 42 11 ASP A 33 ? ? 53.44 74.47 43 11 HIS A 34 ? ? -165.22 29.51 44 11 GLU A 49 ? ? -101.89 -169.87 45 11 HIS A 62 ? ? 62.24 77.79 46 12 ALA A 36 ? ? 60.16 76.62 47 13 ALA A 13 ? ? -57.08 -72.72 48 14 VAL A 12 ? ? -115.59 -74.32 49 14 MET A 41 ? ? -76.37 22.45 50 14 HIS A 62 ? ? 60.14 74.78 51 15 ASN A 14 ? ? 68.29 152.07 52 15 ALA A 36 ? ? 72.33 138.34 53 15 GLN A 39 ? ? -172.17 -80.59 54 15 VAL A 82 ? ? -92.28 -61.16 55 16 SER A 9 ? ? -61.77 94.71 56 16 MET A 11 ? ? -98.74 38.09 57 16 ALA A 13 ? ? -128.72 -61.86 58 16 ASN A 14 ? ? 73.05 129.80 59 16 PRO A 60 ? ? -67.93 36.19 60 16 CYS A 61 ? ? -140.06 28.07 61 16 ARG A 84 ? ? 63.40 71.35 62 17 HIS A 5 ? ? -101.58 -169.77 63 17 ASN A 14 ? ? 71.67 136.37 64 17 PRO A 60 ? ? -59.81 -8.19 65 17 ARG A 84 ? ? 57.23 77.14 66 18 GLN A 39 ? ? -154.30 -56.96 67 18 PRO A 60 ? ? -63.51 12.91 68 18 HIS A 62 ? ? 64.12 74.84 69 19 GLU A 49 ? ? -78.84 -169.90 70 20 MET A 11 ? ? 41.18 87.67 71 20 ASP A 33 ? ? 76.07 -0.09 72 20 GLN A 39 ? ? 56.87 -67.67 73 20 HIS A 62 ? ? 65.33 93.00 74 20 HIS A 63 ? ? -175.62 122.47 75 20 ARG A 84 ? ? 62.42 80.57 # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L0B _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L0B _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.94 mM [U-100% 13C; U-100% 15N] pja1 zinc finger domain, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.82 mM [U-10% 13C; U-100% 15N] pja1 zinc finger domain, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'pja1 zinc finger domain-1' 0.94 ? mM '[U-100% 13C; U-100% 15N]' 1 'pja1 zinc finger domain-2' 0.82 ? mM '[U-10% 13C; U-100% 15N]' 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength n.a. _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC' 1 3 1 '3D 1H-13C-15N SIMUTANEOUS NOESY' 1 4 1 '3D 1H-13C aromatic NOESY' 1 5 1 '3D HNCACB' 1 6 1 '3D CBCA(CO)NH' 1 7 1 '3D C(CO)NH' 1 8 1 '3D HNCO' 1 9 1 '3D HCCH-TOCSY' 1 10 1 '3D HBHA(CO)NH' # _pdbx_nmr_refine.entry_id 2L0B _pdbx_nmr_refine.method 'distance geometry, simulated annealing, molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'geometry optimization' CNS ? 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 3 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 4 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA ? 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 6 'Huang, Tejero, Powers and Montelione' refinement AutoStructure ? 7 'Huang, Tejero, Powers and Montelione' 'geometry optimization' AutoStructure ? 8 'Huang, Tejero, Powers and Montelione' 'data analysis' AutoStructure ? 9 'Shen, Delaglio and Bax' 'data analysis' TALOS+ ? 10 'Bartels et al.' 'data analysis' XEASY ? 11 'Bartels et al.' 'peak picking' XEASY ? 12 'Bartels et al.' refinement XEASY ? 13 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign ? 14 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 15 Varian collection VnmrJ ? 16 'Bruker Biospin' collection TopSpin ? 17 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 ZN ZN ZN N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Varian INOVA 2 'Varian INOVA' # _atom_sites.entry_id 2L0B _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_