data_2L1B # _entry.id 2L1B # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2L1B RCSB RCSB101831 BMRB 17079 WWPDB D_1000101831 # _pdbx_database_related.db_id 17079 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L1B _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-07-27 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kaustov, L.' 1 'Lemak, A.' 2 'Fares, C.' 3 'Gutmanas, A.' 4 'Muhandiram, R.' 5 'Quang, H.' 6 'Loppnau, P.' 7 'Min, J.' 8 'Edwards, A.' 9 'Arrowsmith, C.' 10 'Structural Genomics Consortium (SGC)' 11 # _citation.id primary _citation.title 'Recognition and specificity determinants of the human cbx chromodomains.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 286 _citation.page_first 521 _citation.page_last 529 _citation.year 2011 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21047797 _citation.pdbx_database_id_DOI 10.1074/jbc.M110.191411 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kaustov, L.' 1 ? primary 'Ouyang, H.' 2 ? primary 'Amaya, M.' 3 ? primary 'Lemak, A.' 4 ? primary 'Nady, N.' 5 ? primary 'Duan, S.' 6 ? primary 'Wasney, G.A.' 7 ? primary 'Li, Z.' 8 ? primary 'Vedadi, M.' 9 ? primary 'Schapira, M.' 10 ? primary 'Min, J.' 11 ? primary 'Arrowsmith, C.H.' 12 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Chromobox protein homolog 7' 6816.852 1 ? ? 'UNP Residues 7-62' ? 2 polymer syn 'Histone H3' 1515.776 1 ? ? 'UNP Residues 20-34' ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE GEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE A ? 2 'polypeptide(L)' no yes 'QLATKAAR(M3L)SAPATG' QLATKAARKSAPATG B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLU n 1 3 GLN n 1 4 VAL n 1 5 PHE n 1 6 ALA n 1 7 VAL n 1 8 GLU n 1 9 SER n 1 10 ILE n 1 11 ARG n 1 12 LYS n 1 13 LYS n 1 14 ARG n 1 15 VAL n 1 16 ARG n 1 17 LYS n 1 18 GLY n 1 19 LYS n 1 20 VAL n 1 21 GLU n 1 22 TYR n 1 23 LEU n 1 24 VAL n 1 25 LYS n 1 26 TRP n 1 27 LYS n 1 28 GLY n 1 29 TRP n 1 30 PRO n 1 31 PRO n 1 32 LYS n 1 33 TYR n 1 34 SER n 1 35 THR n 1 36 TRP n 1 37 GLU n 1 38 PRO n 1 39 GLU n 1 40 GLU n 1 41 HIS n 1 42 ILE n 1 43 LEU n 1 44 ASP n 1 45 PRO n 1 46 ARG n 1 47 LEU n 1 48 VAL n 1 49 MET n 1 50 ALA n 1 51 TYR n 1 52 GLU n 1 53 GLU n 1 54 LYS n 1 55 GLU n 1 56 GLU n 2 1 GLN n 2 2 LEU n 2 3 ALA n 2 4 THR n 2 5 LYS n 2 6 ALA n 2 7 ALA n 2 8 ARG n 2 9 M3L n 2 10 SER n 2 11 ALA n 2 12 PRO n 2 13 ALA n 2 14 THR n 2 15 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CBX7 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'BL21(DE3) Codon plus RIL (Stratagene)' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3) Codon plus RIL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET28a-mhl _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Xenopus laevis' _pdbx_entity_src_syn.organism_common_name 'clawed frog,common platanna,platanna' _pdbx_entity_src_syn.ncbi_taxonomy_id 8355 _pdbx_entity_src_syn.details 'H3K27me3 15-mer peptide' # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP CBX7_HUMAN O95931 1 EQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE 8 ? 2 UNP Q92133_XENLA Q92133 2 QLATKAARKSAPATG 20 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2L1B A 2 ? 56 ? O95931 8 ? 62 ? 2 56 2 2 2L1B B 1 ? 15 ? Q92133 20 ? 34 ? 19 33 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2L1B _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O95931 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 M3L 'L-peptide linking' n N-TRIMETHYLLYSINE ? 'C9 H21 N2 O2 1' 189.275 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCO' 1 5 1 '3D HNCA' 1 6 1 '3D HBHA(CO)NH' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY' 1 9 1 '3D HCCH-TOCSY' 1 10 1 '3D HCCH-TOCSY' 1 11 1 '13C/15N-filtered/edited NOESY' 1 12 1 '3D aro 1H-13C NOESY' 1 13 1 '3D aro HCCH-TOCSY' 1 14 1 '3D aro (H)CCH-TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 300 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;0.5 mM [U-13C; U-15N] protein, 2.7 mM peptide, 10 mM sodium phosphate, 300 mM sodium chloride, 0.5 mM PMSF, 0.5 mM TCEP, 1 mM Benzamidine, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 500 Varian INOVA 2 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2L1B _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L1B _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L1B _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal '(ABACUS)-Grishaev' 'chemical shift assignment' ABACUS ? 1 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 3 Goddard 'peak picking' Sparky ? 4 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L1B _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L1B _struct.title 'Solution NMR structure of the chromobox protein Cbx7 with H3K27me3' _struct.pdbx_descriptor 'Chromobox protein homolog 7, Histone H3' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L1B _struct_keywords.pdbx_keywords 'TRANSCRIPTION REGULATOR' _struct_keywords.text 'chromodomain, Structural Genomics, Structural Genomics Consortium, SGC, TRANSCRIPTION REGULATOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 40 ? ILE A 42 ? GLU A 40 ILE A 42 5 ? 3 HELX_P HELX_P2 2 PRO A 45 ? GLU A 53 ? PRO A 45 GLU A 53 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? B ARG 8 C ? ? ? 1_555 B M3L 9 N ? ? B ARG 26 B M3L 27 1_555 ? ? ? ? ? ? ? 1.336 ? covale2 covale both ? B M3L 9 C ? ? ? 1_555 B SER 10 N ? ? B M3L 27 B SER 28 1_555 ? ? ? ? ? ? ? 1.354 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 35 ? PRO A 38 ? THR A 35 PRO A 38 A 2 LYS A 19 ? TRP A 26 ? LYS A 19 TRP A 26 A 3 GLN A 3 ? ARG A 16 ? GLN A 3 ARG A 16 A 4 LYS B 5 ? M3L B 9 ? LYS B 23 M3L B 27 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O THR A 35 ? O THR A 35 N VAL A 24 ? N VAL A 24 A 2 3 O LEU A 23 ? O LEU A 23 N ARG A 11 ? N ARG A 11 A 3 4 N PHE A 5 ? N PHE A 5 O ALA B 7 ? O ALA B 25 # _atom_sites.entry_id 2L1B _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 TRP 26 26 26 TRP TRP A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 TRP 29 29 29 TRP TRP A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 MET 49 49 49 MET MET A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLU 56 56 56 GLU GLU A . n B 2 1 GLN 1 19 19 GLN GLN B . n B 2 2 LEU 2 20 20 LEU LEU B . n B 2 3 ALA 3 21 21 ALA ALA B . n B 2 4 THR 4 22 22 THR THR B . n B 2 5 LYS 5 23 23 LYS LYS B . n B 2 6 ALA 6 24 24 ALA ALA B . n B 2 7 ALA 7 25 25 ALA ALA B . n B 2 8 ARG 8 26 26 ARG ARG B . n B 2 9 M3L 9 27 27 M3L M3L B . n B 2 10 SER 10 28 28 SER SER B . n B 2 11 ALA 11 29 29 ALA ALA B . n B 2 12 PRO 12 30 30 PRO PRO B . n B 2 13 ALA 13 31 31 ALA ALA B . n B 2 14 THR 14 32 32 THR THR B . n B 2 15 GLY 15 33 33 GLY GLY B . n # _pdbx_SG_project.full_name_of_center 'Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center SGC _pdbx_SG_project.project_name ? # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id M3L _pdbx_struct_mod_residue.label_seq_id 9 _pdbx_struct_mod_residue.auth_asym_id B _pdbx_struct_mod_residue.auth_comp_id M3L _pdbx_struct_mod_residue.auth_seq_id 27 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id LYS _pdbx_struct_mod_residue.details N-TRIMETHYLLYSINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-08-25 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' struct_conn 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity_1-1 0.5 ? mM '[U-13C; U-15N]' 1 entity_2-2 2.7 ? mM ? 1 'sodium phosphate-3' 10 ? mM ? 1 'sodium chloride-4' 300 ? mM ? 1 PMSF-5 0.5 ? mM ? 1 TCEP-6 0.5 ? mM ? 1 Benzamidine-7 1 ? mM ? 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 9 ? ? -174.14 -172.28 2 1 PRO A 31 ? ? -69.42 5.54 3 1 LEU A 43 ? ? -89.44 -79.47 4 1 ALA B 29 ? ? 70.70 131.63 5 2 LEU A 23 ? ? -69.26 90.58 6 2 TRP A 36 ? ? -68.81 85.40 7 2 LEU A 43 ? ? -86.34 -71.94 8 2 LEU B 20 ? ? 62.95 93.83 9 2 SER B 28 ? ? 76.45 161.08 10 2 ALA B 29 ? ? 66.36 90.24 11 2 ALA B 31 ? ? -67.06 95.33 12 3 GLU A 55 ? ? 66.92 81.14 13 3 THR B 32 ? ? -155.86 21.87 14 4 TRP A 36 ? ? -68.80 83.49 15 4 LEU A 43 ? ? -87.91 -70.73 16 4 SER B 28 ? ? 178.10 147.47 17 4 PRO B 30 ? ? -51.75 108.92 18 5 LEU A 23 ? ? -68.63 89.09 19 5 TRP A 36 ? ? -69.89 80.62 20 5 LEU A 43 ? ? -78.07 -72.14 21 5 M3L B 27 ? ? -100.19 70.46 22 5 PRO B 30 ? ? -58.14 103.28 23 6 SER A 9 ? ? -175.07 -175.84 24 6 LEU A 23 ? ? -68.82 86.86 25 6 M3L B 27 ? ? -109.21 67.88 26 6 SER B 28 ? ? -57.10 98.42 27 7 GLU A 2 ? ? -107.39 -80.94 28 7 LEU A 23 ? ? -67.70 94.17 29 7 LEU A 43 ? ? -84.13 -77.67 30 7 PRO B 30 ? ? -46.11 100.53 31 8 GLU A 2 ? ? -68.24 93.00 32 8 SER A 9 ? ? -170.91 -174.61 33 8 LEU A 23 ? ? -68.09 88.02 34 8 LEU A 43 ? ? -82.69 -77.53 35 8 THR B 22 ? ? -69.53 96.32 36 8 ALA B 31 ? ? 78.17 -45.18 37 9 SER A 9 ? ? -175.19 -171.53 38 9 LEU A 23 ? ? -69.54 91.52 39 9 LEU A 43 ? ? -82.10 -70.62 40 9 GLU A 53 ? ? -89.50 49.78 41 9 M3L B 27 ? ? -106.91 71.54 42 9 THR B 32 ? ? -154.21 -16.90 43 10 GLU A 2 ? ? -103.59 68.57 44 10 LEU A 23 ? ? -65.57 89.27 45 10 LEU A 43 ? ? -96.73 -69.15 46 10 ALA B 21 ? ? -99.15 33.07 47 10 SER B 28 ? ? -67.74 77.04 48 11 LEU A 43 ? ? -75.68 -78.93 49 11 THR B 22 ? ? -91.07 43.04 50 11 ALA B 25 ? ? -102.90 -167.65 51 11 M3L B 27 ? ? -104.53 64.46 52 12 SER A 9 ? ? 177.94 169.51 53 12 LEU A 43 ? ? -88.20 -70.47 54 12 GLU A 55 ? ? 59.84 15.17 55 12 SER B 28 ? ? -62.41 96.05 56 13 TRP A 36 ? ? -68.94 82.26 57 13 LEU B 20 ? ? 67.57 98.16 58 13 SER B 28 ? ? 72.59 -89.24 59 13 ALA B 29 ? ? 38.11 104.09 60 13 PRO B 30 ? ? -53.15 102.68 61 13 THR B 32 ? ? -64.32 93.90 62 14 SER A 9 ? ? -173.60 -172.57 63 14 LEU A 43 ? ? -90.85 -67.22 64 14 GLU A 55 ? ? 60.46 96.06 65 14 LEU B 20 ? ? -107.89 62.35 66 15 SER A 9 ? ? -167.59 -169.34 67 15 LEU A 43 ? ? -87.34 -71.12 68 15 GLU A 55 ? ? 65.12 98.70 69 15 THR B 22 ? ? -67.62 84.19 70 16 ARG A 14 ? ? -171.45 -174.24 71 16 LEU A 43 ? ? -81.23 -82.57 72 16 GLU A 55 ? ? 57.16 77.88 73 17 PRO A 31 ? ? -68.22 0.56 74 17 LEU A 43 ? ? -81.98 -77.62 75 17 SER B 28 ? ? 94.40 158.17 76 18 SER A 9 ? ? -175.46 -170.12 77 18 LEU A 43 ? ? -85.31 -72.79 78 18 M3L B 27 ? ? -108.02 62.98 79 18 ALA B 31 ? ? 65.88 -72.06 80 19 SER A 9 ? ? 178.76 -175.89 81 19 LEU A 23 ? ? -67.36 97.11 82 19 LEU A 43 ? ? -83.45 -73.89 83 19 LYS B 23 ? ? -118.21 -165.92 84 20 ALA B 21 ? ? -67.50 88.33 85 20 THR B 32 ? ? 56.52 18.37 #