data_2L1H # _entry.id 2L1H # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2L1H RCSB RCSB101837 WWPDB D_1000101837 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 2L1D unspecified . PDB 2L1E unspecified . PDB 2L1K unspecified . BMRB 17084 unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L1H _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2010-07-28 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Christen, B.' 1 'Damberger, F.F.' 2 'Perez, D.R.' 3 'Hornemann, S.' 4 'Wuthrich, K.' 5 # _citation.id primary _citation.title 'Temperature-dependent conformational exchange in the cellular form of prion proteins' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Christen, B.' 1 primary 'Damberger, F.F.' 2 primary 'Perez, D.R.' 3 primary 'Hornemann, S.' 4 primary 'Wuthrich, K.' 5 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Major prion protein' _entity.formula_weight 13408.877 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 120-231' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENF TETDVKMMERVVEQMCVTQYQKESQAYYDGRRSS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENF TETDVKMMERVVEQMCVTQYQKESQAYYDGRRSS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 VAL n 1 4 VAL n 1 5 GLY n 1 6 GLY n 1 7 LEU n 1 8 GLY n 1 9 GLY n 1 10 TYR n 1 11 MET n 1 12 LEU n 1 13 GLY n 1 14 SER n 1 15 ALA n 1 16 MET n 1 17 SER n 1 18 ARG n 1 19 PRO n 1 20 MET n 1 21 ILE n 1 22 HIS n 1 23 PHE n 1 24 GLY n 1 25 ASN n 1 26 ASP n 1 27 TRP n 1 28 GLU n 1 29 ASP n 1 30 ARG n 1 31 TYR n 1 32 TYR n 1 33 ARG n 1 34 GLU n 1 35 ASN n 1 36 MET n 1 37 TYR n 1 38 ARG n 1 39 TYR n 1 40 PRO n 1 41 ASN n 1 42 GLN n 1 43 VAL n 1 44 TYR n 1 45 TYR n 1 46 ARG n 1 47 PRO n 1 48 VAL n 1 49 ASP n 1 50 GLN n 1 51 TYR n 1 52 SER n 1 53 ASN n 1 54 GLN n 1 55 ASN n 1 56 ASN n 1 57 PHE n 1 58 VAL n 1 59 HIS n 1 60 ASP n 1 61 CYS n 1 62 VAL n 1 63 ASN n 1 64 ILE n 1 65 THR n 1 66 ILE n 1 67 LYS n 1 68 GLN n 1 69 HIS n 1 70 THR n 1 71 VAL n 1 72 THR n 1 73 THR n 1 74 THR n 1 75 THR n 1 76 LYS n 1 77 GLY n 1 78 GLU n 1 79 ASN n 1 80 PHE n 1 81 THR n 1 82 GLU n 1 83 THR n 1 84 ASP n 1 85 VAL n 1 86 LYS n 1 87 MET n 1 88 MET n 1 89 GLU n 1 90 ARG n 1 91 VAL n 1 92 VAL n 1 93 GLU n 1 94 GLN n 1 95 MET n 1 96 CYS n 1 97 VAL n 1 98 THR n 1 99 GLN n 1 100 TYR n 1 101 GLN n 1 102 LYS n 1 103 GLU n 1 104 SER n 1 105 GLN n 1 106 ALA n 1 107 TYR n 1 108 TYR n 1 109 ASP n 1 110 GLY n 1 111 ARG n 1 112 ARG n 1 113 SER n 1 114 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Prnp, RP23-401J24.1-001' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pRSETA _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q4FJQ7_MOUSE _struct_ref.pdbx_db_accession Q4FJQ7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTE TDVKMMERVVEQMCVTQYQKESQAYYDGRRSS ; _struct_ref.pdbx_align_begin 120 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L1H _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 114 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q4FJQ7 _struct_ref_seq.db_align_beg 120 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 231 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 121 _struct_ref_seq.pdbx_auth_seq_align_end 232 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2L1H GLY A 1 ? UNP Q4FJQ7 ? ? 'EXPRESSION TAG' 119 1 1 2L1H SER A 2 ? UNP Q4FJQ7 ? ? 'EXPRESSION TAG' 120 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N NOESY' 1 2 1 '3D 1H-13C NOESY' 1 3 1 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.01 _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293.2 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1.0 mM [U-99% 13C; U-99% 15N] protein, 10 mM [U-2H] sodium acetate-2, 0.02 % sodium azide-3, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 750 Bruker DRX 1 'Bruker DRX' 900 Bruker Avance 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2L1H _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2L1H _pdbx_nmr_details.text ;Two 13C-resolved NOESYs were measured, one with the 13C carrier centered in the aliphatic region and one with the 13C carrier centered in the aromatic region. ; # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L1H _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L1H _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' processing xwinnmr ? 1 'Bruker Biospin' collection xwinnmr ? 2 'Keller and Wuthrich' 'chemical shift assignment' CARA ? 3 'Keller and Wuthrich' 'data analysis' CARA ? 4 'Herrmann, Guntert and Wuthrich' 'chemical shift assignment' ATNOS/CANDID 1.2 5 'Herrmann, Guntert and Wuthrich' 'peak picking' ATNOS/CANDID 1.2 6 'Guntert, Mumenthaler and Wuthrich' 'structure solution' DYANA 1.0.3 7 'Luginbuhl, Guntert, Billeter and Wuthrich' refinement OPALP ? 8 'Koradi, Billeter and Wuthrich' 'data analysis' Molmol ? 9 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L1H _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L1H _struct.title 'Mouse prion protein fragment 121-231 at 20 C' _struct.pdbx_descriptor 'Major prion protein' _struct.pdbx_model_details 'fewest violations, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L1H _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'prion, MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 25 ? MET A 36 ? ASN A 143 MET A 154 1 ? 12 HELX_P HELX_P2 2 TYR A 37 ? TYR A 39 ? TYR A 155 TYR A 157 5 ? 3 HELX_P HELX_P3 3 PRO A 47 ? TYR A 51 ? PRO A 165 TYR A 169 5 ? 5 HELX_P HELX_P4 4 GLN A 54 ? THR A 72 ? GLN A 172 THR A 190 1 ? 19 HELX_P HELX_P5 5 THR A 81 ? SER A 114 ? THR A 199 SER A 232 1 ? 34 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 61 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 96 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 179 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 214 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.033 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 MET A 11 ? LEU A 12 ? MET A 129 LEU A 130 A 2 TYR A 44 ? TYR A 45 ? TYR A 162 TYR A 163 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id MET _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 11 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id MET _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 129 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 45 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 163 # _atom_sites.entry_id 2L1H _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 119 119 GLY GLY A . n A 1 2 SER 2 120 120 SER SER A . n A 1 3 VAL 3 121 121 VAL VAL A . n A 1 4 VAL 4 122 122 VAL VAL A . n A 1 5 GLY 5 123 123 GLY GLY A . n A 1 6 GLY 6 124 124 GLY GLY A . n A 1 7 LEU 7 125 125 LEU LEU A . n A 1 8 GLY 8 126 126 GLY GLY A . n A 1 9 GLY 9 127 127 GLY GLY A . n A 1 10 TYR 10 128 128 TYR TYR A . n A 1 11 MET 11 129 129 MET MET A . n A 1 12 LEU 12 130 130 LEU LEU A . n A 1 13 GLY 13 131 131 GLY GLY A . n A 1 14 SER 14 132 132 SER SER A . n A 1 15 ALA 15 133 133 ALA ALA A . n A 1 16 MET 16 134 134 MET MET A . n A 1 17 SER 17 135 135 SER SER A . n A 1 18 ARG 18 136 136 ARG ARG A . n A 1 19 PRO 19 137 137 PRO PRO A . n A 1 20 MET 20 138 138 MET MET A . n A 1 21 ILE 21 139 139 ILE ILE A . n A 1 22 HIS 22 140 140 HIS HIS A . n A 1 23 PHE 23 141 141 PHE PHE A . n A 1 24 GLY 24 142 142 GLY GLY A . n A 1 25 ASN 25 143 143 ASN ASN A . n A 1 26 ASP 26 144 144 ASP ASP A . n A 1 27 TRP 27 145 145 TRP TRP A . n A 1 28 GLU 28 146 146 GLU GLU A . n A 1 29 ASP 29 147 147 ASP ASP A . n A 1 30 ARG 30 148 148 ARG ARG A . n A 1 31 TYR 31 149 149 TYR TYR A . n A 1 32 TYR 32 150 150 TYR TYR A . n A 1 33 ARG 33 151 151 ARG ARG A . n A 1 34 GLU 34 152 152 GLU GLU A . n A 1 35 ASN 35 153 153 ASN ASN A . n A 1 36 MET 36 154 154 MET MET A . n A 1 37 TYR 37 155 155 TYR TYR A . n A 1 38 ARG 38 156 156 ARG ARG A . n A 1 39 TYR 39 157 157 TYR TYR A . n A 1 40 PRO 40 158 158 PRO PRO A . n A 1 41 ASN 41 159 159 ASN ASN A . n A 1 42 GLN 42 160 160 GLN GLN A . n A 1 43 VAL 43 161 161 VAL VAL A . n A 1 44 TYR 44 162 162 TYR TYR A . n A 1 45 TYR 45 163 163 TYR TYR A . n A 1 46 ARG 46 164 164 ARG ARG A . n A 1 47 PRO 47 165 165 PRO PRO A . n A 1 48 VAL 48 166 166 VAL VAL A . n A 1 49 ASP 49 167 167 ASP ASP A . n A 1 50 GLN 50 168 168 GLN GLN A . n A 1 51 TYR 51 169 169 TYR TYR A . n A 1 52 SER 52 170 170 SER SER A . n A 1 53 ASN 53 171 171 ASN ASN A . n A 1 54 GLN 54 172 172 GLN GLN A . n A 1 55 ASN 55 173 173 ASN ASN A . n A 1 56 ASN 56 174 174 ASN ASN A . n A 1 57 PHE 57 175 175 PHE PHE A . n A 1 58 VAL 58 176 176 VAL VAL A . n A 1 59 HIS 59 177 177 HIS HIS A . n A 1 60 ASP 60 178 178 ASP ASP A . n A 1 61 CYS 61 179 179 CYS CYS A . n A 1 62 VAL 62 180 180 VAL VAL A . n A 1 63 ASN 63 181 181 ASN ASN A . n A 1 64 ILE 64 182 182 ILE ILE A . n A 1 65 THR 65 183 183 THR THR A . n A 1 66 ILE 66 184 184 ILE ILE A . n A 1 67 LYS 67 185 185 LYS LYS A . n A 1 68 GLN 68 186 186 GLN GLN A . n A 1 69 HIS 69 187 187 HIS HIS A . n A 1 70 THR 70 188 188 THR THR A . n A 1 71 VAL 71 189 189 VAL VAL A . n A 1 72 THR 72 190 190 THR THR A . n A 1 73 THR 73 191 191 THR THR A . n A 1 74 THR 74 192 192 THR THR A . n A 1 75 THR 75 193 193 THR THR A . n A 1 76 LYS 76 194 194 LYS LYS A . n A 1 77 GLY 77 195 195 GLY GLY A . n A 1 78 GLU 78 196 196 GLU GLU A . n A 1 79 ASN 79 197 197 ASN ASN A . n A 1 80 PHE 80 198 198 PHE PHE A . n A 1 81 THR 81 199 199 THR THR A . n A 1 82 GLU 82 200 200 GLU GLU A . n A 1 83 THR 83 201 201 THR THR A . n A 1 84 ASP 84 202 202 ASP ASP A . n A 1 85 VAL 85 203 203 VAL VAL A . n A 1 86 LYS 86 204 204 LYS LYS A . n A 1 87 MET 87 205 205 MET MET A . n A 1 88 MET 88 206 206 MET MET A . n A 1 89 GLU 89 207 207 GLU GLU A . n A 1 90 ARG 90 208 208 ARG ARG A . n A 1 91 VAL 91 209 209 VAL VAL A . n A 1 92 VAL 92 210 210 VAL VAL A . n A 1 93 GLU 93 211 211 GLU GLU A . n A 1 94 GLN 94 212 212 GLN GLN A . n A 1 95 MET 95 213 213 MET MET A . n A 1 96 CYS 96 214 214 CYS CYS A . n A 1 97 VAL 97 215 215 VAL VAL A . n A 1 98 THR 98 216 216 THR THR A . n A 1 99 GLN 99 217 217 GLN GLN A . n A 1 100 TYR 100 218 218 TYR TYR A . n A 1 101 GLN 101 219 219 GLN GLN A . n A 1 102 LYS 102 220 220 LYS LYS A . n A 1 103 GLU 103 221 221 GLU GLU A . n A 1 104 SER 104 222 222 SER SER A . n A 1 105 GLN 105 223 223 GLN GLN A . n A 1 106 ALA 106 224 224 ALA ALA A . n A 1 107 TYR 107 225 225 TYR TYR A . n A 1 108 TYR 108 226 226 TYR TYR A . n A 1 109 ASP 109 227 227 ASP ASP A . n A 1 110 GLY 110 228 228 GLY GLY A . n A 1 111 ARG 111 229 229 ARG ARG A . n A 1 112 ARG 112 230 230 ARG ARG A . n A 1 113 SER 113 231 231 SER SER A . n A 1 114 SER 114 232 232 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-08-10 2 'Structure model' 1 1 2012-02-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 1.0 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium acetate-2' 10 ? mM '[U-2H]' 1 'sodium azide-3' 0.02 ? % ? 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HH A TYR 163 ? ? OE2 A GLU 221 ? ? 1.57 2 5 O A THR 188 ? ? HG1 A THR 192 ? ? 1.56 3 6 HH A TYR 163 ? ? OE2 A GLU 221 ? ? 1.60 4 7 HG1 A THR 199 ? ? OD2 A ASP 202 ? ? 1.58 5 9 HH A TYR 163 ? ? OE2 A GLU 221 ? ? 1.56 6 10 HH A TYR 163 ? ? OE2 A GLU 221 ? ? 1.56 7 11 HG1 A THR 199 ? ? OD2 A ASP 202 ? ? 1.53 8 15 HH A TYR 149 ? ? OD1 A ASP 202 ? ? 1.59 9 16 HG1 A THR 199 ? ? OD2 A ASP 202 ? ? 1.60 10 17 HH A TYR 157 ? ? OD1 A ASP 202 ? ? 1.55 11 18 HG1 A THR 199 ? ? OD2 A ASP 202 ? ? 1.58 12 19 HH A TYR 163 ? ? OE1 A GLU 221 ? ? 1.52 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 3 NE A ARG 148 ? ? CZ A ARG 148 ? ? NH2 A ARG 148 ? ? 117.13 120.30 -3.17 0.50 N 2 13 CB A TYR 169 ? ? CG A TYR 169 ? ? CD2 A TYR 169 ? ? 117.28 121.00 -3.72 0.60 N 3 18 CA A VAL 176 ? ? CB A VAL 176 ? ? CG1 A VAL 176 ? ? 123.34 110.90 12.44 1.50 N 4 18 NE A ARG 230 ? ? CZ A ARG 230 ? ? NH2 A ARG 230 ? ? 117.24 120.30 -3.06 0.50 N 5 20 CD A ARG 151 ? ? NE A ARG 151 ? ? CZ A ARG 151 ? ? 133.52 123.60 9.92 1.40 N 6 20 NE A ARG 151 ? ? CZ A ARG 151 ? ? NH1 A ARG 151 ? ? 124.60 120.30 4.30 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 122 ? ? -90.52 55.80 2 1 LEU A 125 ? ? -85.17 -72.27 3 1 ASN A 171 ? ? 72.60 -178.65 4 1 LYS A 194 ? ? -121.62 -51.93 5 1 ARG A 230 ? ? -56.22 -72.76 6 1 SER A 231 ? ? 163.08 56.06 7 2 LEU A 125 ? ? -97.12 -75.05 8 2 GLN A 168 ? ? 55.89 71.43 9 2 SER A 170 ? ? -153.95 21.98 10 2 ARG A 230 ? ? -73.02 -82.94 11 2 SER A 231 ? ? -152.58 14.77 12 3 SER A 120 ? ? 61.12 -177.45 13 3 VAL A 121 ? ? -77.75 49.33 14 3 VAL A 122 ? ? 38.21 50.28 15 3 LEU A 125 ? ? -105.94 -93.32 16 3 ASN A 153 ? ? -144.71 51.07 17 3 GLN A 168 ? ? 74.02 -40.51 18 4 VAL A 122 ? ? 24.47 44.68 19 4 TYR A 150 ? ? -54.42 -71.57 20 4 TYR A 155 ? ? -59.77 63.20 21 4 ARG A 156 ? ? -154.02 -59.24 22 4 ASP A 167 ? ? 27.38 -94.01 23 4 SER A 170 ? ? -133.52 -50.62 24 4 LYS A 194 ? ? -108.92 -60.25 25 4 SER A 231 ? ? 50.88 77.53 26 5 SER A 120 ? ? 61.29 -179.36 27 5 VAL A 122 ? ? -81.23 49.99 28 5 LEU A 125 ? ? -104.29 -66.23 29 5 ARG A 136 ? ? -50.84 107.91 30 5 HIS A 140 ? ? -115.83 75.87 31 5 PRO A 158 ? ? -62.30 -179.82 32 5 GLN A 168 ? ? 58.55 -159.52 33 5 TYR A 169 ? ? 64.04 -174.36 34 5 SER A 170 ? ? -169.05 26.11 35 5 GLN A 172 ? ? -130.56 -58.75 36 5 THR A 191 ? ? -146.58 -57.69 37 5 SER A 231 ? ? 52.43 83.67 38 6 LEU A 125 ? ? -122.25 -56.77 39 6 ARG A 136 ? ? -55.29 103.52 40 6 ASP A 167 ? ? 60.30 -84.66 41 6 GLN A 168 ? ? -140.52 -49.46 42 6 TYR A 169 ? ? 54.82 -156.17 43 6 SER A 170 ? ? -161.89 -44.85 44 6 THR A 188 ? ? -79.17 -72.21 45 6 ARG A 230 ? ? -80.18 -75.17 46 7 TYR A 155 ? ? -66.32 30.99 47 7 ASP A 167 ? ? -36.43 -34.23 48 7 GLN A 168 ? ? -144.34 -32.22 49 7 TYR A 169 ? ? 27.71 -95.51 50 7 SER A 170 ? ? -172.01 -74.72 51 7 SER A 231 ? ? 56.82 89.99 52 8 VAL A 121 ? ? -46.63 104.16 53 8 LEU A 125 ? ? -99.06 -70.22 54 8 ARG A 136 ? ? -25.17 103.25 55 8 ASP A 167 ? ? 56.65 -51.11 56 8 GLN A 168 ? ? -145.97 -63.77 57 8 TYR A 169 ? ? 58.48 -79.96 58 8 SER A 170 ? ? 47.59 26.48 59 8 LYS A 220 ? ? -61.69 -70.97 60 8 ARG A 230 ? ? -72.05 -75.70 61 8 SER A 231 ? ? -153.11 2.82 62 9 LEU A 125 ? ? -116.79 -78.61 63 9 ARG A 136 ? ? -46.80 100.33 64 9 ASP A 167 ? ? -57.52 86.75 65 9 GLN A 168 ? ? 68.24 110.30 66 9 ASN A 171 ? ? -47.42 156.70 67 9 SER A 231 ? ? 57.81 90.23 68 10 LEU A 125 ? ? -109.35 -76.64 69 10 ASP A 167 ? ? 49.60 -147.98 70 11 LEU A 125 ? ? -107.65 -90.54 71 11 GLN A 168 ? ? -104.55 -157.43 72 11 TYR A 169 ? ? 68.94 -176.71 73 11 SER A 170 ? ? -179.06 95.87 74 11 ASN A 171 ? ? 158.04 143.09 75 12 TYR A 128 ? ? 40.70 170.82 76 12 ARG A 136 ? ? -41.96 98.44 77 12 PRO A 158 ? ? -66.69 -92.24 78 12 ASN A 159 ? ? 143.81 -19.43 79 12 GLN A 168 ? ? 93.23 -8.35 80 12 SER A 170 ? ? -147.96 -24.71 81 13 ARG A 136 ? ? -24.81 93.89 82 13 ASP A 167 ? ? 47.30 -161.29 83 13 TYR A 169 ? ? 44.63 -155.97 84 13 THR A 191 ? ? -149.59 -53.95 85 14 VAL A 122 ? ? 32.86 44.93 86 14 LEU A 125 ? ? -96.61 -72.28 87 14 GLN A 168 ? ? 60.26 -54.66 88 14 TYR A 169 ? ? 47.80 -159.76 89 14 SER A 170 ? ? -159.95 -32.84 90 14 VAL A 176 ? ? -69.82 -93.93 91 14 HIS A 177 ? ? 27.15 -90.71 92 14 THR A 191 ? ? -132.22 -43.49 93 14 SER A 231 ? ? -159.12 4.09 94 15 SER A 120 ? ? 68.26 -173.93 95 15 LEU A 125 ? ? -92.10 -62.89 96 15 ARG A 136 ? ? -46.31 103.49 97 15 GLN A 168 ? ? 47.85 85.40 98 15 SER A 170 ? ? -72.40 -165.32 99 15 ASN A 171 ? ? -55.42 173.12 100 15 SER A 231 ? ? 151.95 40.39 101 16 VAL A 121 ? ? -58.42 107.52 102 16 ARG A 136 ? ? -40.83 106.96 103 16 HIS A 140 ? ? -151.28 87.09 104 16 ASP A 167 ? ? 54.04 -84.43 105 16 THR A 190 ? ? -69.29 7.30 106 16 THR A 191 ? ? -147.47 -61.21 107 16 SER A 231 ? ? -163.81 10.11 108 17 LEU A 125 ? ? -108.52 -83.24 109 17 ARG A 136 ? ? -47.19 106.58 110 17 ASP A 167 ? ? -64.48 96.41 111 17 GLN A 168 ? ? 66.09 126.78 112 17 SER A 170 ? ? -76.19 -81.94 113 17 VAL A 189 ? ? -130.65 -46.98 114 17 THR A 191 ? ? -129.51 -52.88 115 17 SER A 231 ? ? 54.54 84.93 116 18 VAL A 122 ? ? -81.03 48.80 117 18 TYR A 128 ? ? 50.31 177.50 118 18 ARG A 136 ? ? -34.08 96.62 119 18 GLU A 152 ? ? -66.18 -81.00 120 18 ASP A 167 ? ? 29.41 39.15 121 18 GLN A 168 ? ? 42.82 19.40 122 19 GLN A 168 ? ? 49.07 11.27 123 19 SER A 170 ? ? -150.73 10.05 124 19 THR A 193 ? ? -66.02 2.44 125 19 LYS A 220 ? ? -65.73 -83.76 126 19 SER A 231 ? ? 58.43 95.96 127 20 LEU A 125 ? ? -120.93 -106.38 128 20 ARG A 136 ? ? -45.85 102.85 129 20 ASP A 167 ? ? -26.50 104.18 130 20 SER A 170 ? ? -155.74 31.62 131 20 ARG A 230 ? ? -67.83 -72.20 132 20 SER A 231 ? ? -169.22 8.76 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 2 SER A 231 ? ? SER A 232 ? ? 146.60 2 4 SER A 231 ? ? SER A 232 ? ? 125.52 3 11 SER A 231 ? ? SER A 232 ? ? 137.26 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 157 ? ? 0.076 'SIDE CHAIN' 2 1 TYR A 169 ? ? 0.064 'SIDE CHAIN' 3 1 TYR A 225 ? ? 0.081 'SIDE CHAIN' 4 2 TYR A 157 ? ? 0.078 'SIDE CHAIN' 5 2 TYR A 163 ? ? 0.073 'SIDE CHAIN' 6 3 ARG A 151 ? ? 0.088 'SIDE CHAIN' 7 4 TYR A 128 ? ? 0.087 'SIDE CHAIN' 8 4 TYR A 169 ? ? 0.071 'SIDE CHAIN' 9 4 ARG A 208 ? ? 0.125 'SIDE CHAIN' 10 5 ARG A 156 ? ? 0.091 'SIDE CHAIN' 11 6 ARG A 148 ? ? 0.103 'SIDE CHAIN' 12 6 ARG A 208 ? ? 0.097 'SIDE CHAIN' 13 7 ARG A 151 ? ? 0.110 'SIDE CHAIN' 14 8 ARG A 136 ? ? 0.101 'SIDE CHAIN' 15 8 ARG A 151 ? ? 0.078 'SIDE CHAIN' 16 8 TYR A 163 ? ? 0.067 'SIDE CHAIN' 17 8 TYR A 225 ? ? 0.076 'SIDE CHAIN' 18 9 ARG A 208 ? ? 0.089 'SIDE CHAIN' 19 10 TYR A 155 ? ? 0.076 'SIDE CHAIN' 20 10 TYR A 157 ? ? 0.065 'SIDE CHAIN' 21 11 TYR A 150 ? ? 0.101 'SIDE CHAIN' 22 11 TYR A 225 ? ? 0.070 'SIDE CHAIN' 23 11 ARG A 229 ? ? 0.076 'SIDE CHAIN' 24 11 ARG A 230 ? ? 0.079 'SIDE CHAIN' 25 12 TYR A 150 ? ? 0.079 'SIDE CHAIN' 26 12 TYR A 157 ? ? 0.108 'SIDE CHAIN' 27 13 PHE A 141 ? ? 0.080 'SIDE CHAIN' 28 13 TYR A 225 ? ? 0.074 'SIDE CHAIN' 29 13 ARG A 230 ? ? 0.097 'SIDE CHAIN' 30 14 ARG A 164 ? ? 0.079 'SIDE CHAIN' 31 14 TYR A 169 ? ? 0.086 'SIDE CHAIN' 32 14 ARG A 230 ? ? 0.113 'SIDE CHAIN' 33 15 ARG A 148 ? ? 0.126 'SIDE CHAIN' 34 15 ARG A 156 ? ? 0.082 'SIDE CHAIN' 35 15 ARG A 164 ? ? 0.091 'SIDE CHAIN' 36 15 TYR A 218 ? ? 0.062 'SIDE CHAIN' 37 17 TYR A 169 ? ? 0.069 'SIDE CHAIN' 38 18 TYR A 150 ? ? 0.084 'SIDE CHAIN' 39 18 ARG A 208 ? ? 0.084 'SIDE CHAIN' 40 20 TYR A 150 ? ? 0.070 'SIDE CHAIN' 41 20 TYR A 218 ? ? 0.093 'SIDE CHAIN' #