data_2L34 # _entry.id 2L34 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2L34 pdb_00002l34 10.2210/pdb2l34/pdb RCSB RCSB101896 ? ? WWPDB D_1000101896 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-11-03 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_entry_details 5 3 'Structure model' pdbx_modification_feature 6 3 'Structure model' pdbx_nmr_software 7 3 'Structure model' pdbx_nmr_spectrometer 8 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L34 _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2010-09-06 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2HAC PDB 'Structure of Zeta-Zeta Transmembrane Dimer' unspecified 2K4F PDB 'Mouse CD3epsilon Cytoplasmic Tail' unspecified 2L35 PDB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Call, M.E.' 1 'Wucherpfennig, K.W.' 2 'Chou, J.J.' 3 # _citation.id primary _citation.title 'The structural basis for intramembrane assembly of an activating immunoreceptor complex.' _citation.journal_abbrev Nat.Immunol. _citation.journal_volume 11 _citation.page_first 1023 _citation.page_last 1029 _citation.year 2010 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 1529-2908 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20890284 _citation.pdbx_database_id_DOI 10.1038/ni.1943 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Call, M.E.' 1 ? primary 'Wucherpfennig, K.W.' 2 ? primary 'Chou, J.J.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'TYRO protein tyrosine kinase-binding protein' _entity.formula_weight 3331.042 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP RESIDUES 35-67' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DNAX-activation protein 12, Killer-activating receptor-associated protein, KAR-associated protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRL _entity_poly.pdbx_seq_one_letter_code_can CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRL _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CYS n 1 2 SER n 1 3 THR n 1 4 VAL n 1 5 SER n 1 6 PRO n 1 7 GLY n 1 8 VAL n 1 9 LEU n 1 10 ALA n 1 11 GLY n 1 12 ILE n 1 13 VAL n 1 14 VAL n 1 15 GLY n 1 16 ASP n 1 17 LEU n 1 18 VAL n 1 19 LEU n 1 20 THR n 1 21 VAL n 1 22 LEU n 1 23 ILE n 1 24 ALA n 1 25 LEU n 1 26 ALA n 1 27 VAL n 1 28 TYR n 1 29 PHE n 1 30 LEU n 1 31 GLY n 1 32 ARG n 1 33 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TYROBP, DAP12, KARAP' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector trpLE _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CYS 1 1 1 CYS CYS A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 LEU 33 33 33 LEU LEU A . n B 1 1 CYS 1 1 1 CYS CYS B . n B 1 2 SER 2 2 2 SER SER B . n B 1 3 THR 3 3 3 THR THR B . n B 1 4 VAL 4 4 4 VAL VAL B . n B 1 5 SER 5 5 5 SER SER B . n B 1 6 PRO 6 6 6 PRO PRO B . n B 1 7 GLY 7 7 7 GLY GLY B . n B 1 8 VAL 8 8 8 VAL VAL B . n B 1 9 LEU 9 9 9 LEU LEU B . n B 1 10 ALA 10 10 10 ALA ALA B . n B 1 11 GLY 11 11 11 GLY GLY B . n B 1 12 ILE 12 12 12 ILE ILE B . n B 1 13 VAL 13 13 13 VAL VAL B . n B 1 14 VAL 14 14 14 VAL VAL B . n B 1 15 GLY 15 15 15 GLY GLY B . n B 1 16 ASP 16 16 16 ASP ASP B . n B 1 17 LEU 17 17 17 LEU LEU B . n B 1 18 VAL 18 18 18 VAL VAL B . n B 1 19 LEU 19 19 19 LEU LEU B . n B 1 20 THR 20 20 20 THR THR B . n B 1 21 VAL 21 21 21 VAL VAL B . n B 1 22 LEU 22 22 22 LEU LEU B . n B 1 23 ILE 23 23 23 ILE ILE B . n B 1 24 ALA 24 24 24 ALA ALA B . n B 1 25 LEU 25 25 25 LEU LEU B . n B 1 26 ALA 26 26 26 ALA ALA B . n B 1 27 VAL 27 27 27 VAL VAL B . n B 1 28 TYR 28 28 28 TYR TYR B . n B 1 29 PHE 29 29 29 PHE PHE B . n B 1 30 LEU 30 30 30 LEU LEU B . n B 1 31 GLY 31 31 31 GLY GLY B . n B 1 32 ARG 32 32 32 ARG ARG B . n B 1 33 LEU 33 33 33 LEU LEU B . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 33 ? O ? A LEU 33 O 2 1 Y 1 B LEU 33 ? O ? B LEU 33 O 3 2 Y 1 A LEU 33 ? O ? A LEU 33 O 4 2 Y 1 B LEU 33 ? O ? B LEU 33 O 5 3 Y 1 A LEU 33 ? O ? A LEU 33 O 6 3 Y 1 B LEU 33 ? O ? B LEU 33 O 7 4 Y 1 A LEU 33 ? O ? A LEU 33 O 8 4 Y 1 B LEU 33 ? O ? B LEU 33 O 9 5 Y 1 A LEU 33 ? O ? A LEU 33 O 10 5 Y 1 B LEU 33 ? O ? B LEU 33 O 11 6 Y 1 A LEU 33 ? O ? A LEU 33 O 12 6 Y 1 B LEU 33 ? O ? B LEU 33 O 13 7 Y 1 A LEU 33 ? O ? A LEU 33 O 14 7 Y 1 B LEU 33 ? O ? B LEU 33 O 15 8 Y 1 A LEU 33 ? O ? A LEU 33 O 16 8 Y 1 B LEU 33 ? O ? B LEU 33 O 17 9 Y 1 A LEU 33 ? O ? A LEU 33 O 18 9 Y 1 B LEU 33 ? O ? B LEU 33 O 19 10 Y 1 A LEU 33 ? O ? A LEU 33 O 20 10 Y 1 B LEU 33 ? O ? B LEU 33 O 21 11 Y 1 A LEU 33 ? O ? A LEU 33 O 22 11 Y 1 B LEU 33 ? O ? B LEU 33 O 23 12 Y 1 A LEU 33 ? O ? A LEU 33 O 24 12 Y 1 B LEU 33 ? O ? B LEU 33 O 25 13 Y 1 A LEU 33 ? O ? A LEU 33 O 26 13 Y 1 B LEU 33 ? O ? B LEU 33 O 27 14 Y 1 A LEU 33 ? O ? A LEU 33 O 28 14 Y 1 B LEU 33 ? O ? B LEU 33 O 29 15 Y 1 A LEU 33 ? O ? A LEU 33 O 30 15 Y 1 B LEU 33 ? O ? B LEU 33 O # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L34 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L34 _struct.title 'Structure of the DAP12 transmembrane homodimer' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L34 _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'Immunoreceptor, transmembrane assembly, DAP12, PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TYOBP_HUMAN _struct_ref.pdbx_db_accession O43914 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code CSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRL _struct_ref.pdbx_align_begin 35 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2L34 A 1 ? 33 ? O43914 35 ? 67 ? 1 33 2 1 2L34 B 1 ? 33 ? O43914 35 ? 67 ? 1 33 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2L34 VAL A 14 ? UNP O43914 MET 48 conflict 14 1 2 2L34 VAL B 14 ? UNP O43914 MET 48 conflict 14 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 6 ? GLY A 31 ? PRO A 6 GLY A 31 1 ? 26 HELX_P HELX_P2 2 CYS B 1 ? SER B 5 ? CYS B 1 SER B 5 5 ? 5 HELX_P HELX_P3 3 PRO B 6 ? ARG B 32 ? PRO B 6 ARG B 32 1 ? 27 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 1 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 1 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 1 _struct_conn.ptnr2_auth_asym_id B _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 1 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.020 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 1 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id B _pdbx_modification_feature.modified_residue_label_seq_id 1 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 1 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id B _pdbx_modification_feature.modified_residue_auth_seq_id 1 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _pdbx_entry_details.entry_id 2L34 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 4 ? ? 56.64 -76.01 2 1 SER A 5 ? ? 69.26 79.95 3 1 LEU A 30 ? ? -174.11 78.06 4 1 ARG A 32 ? ? -49.53 93.42 5 1 SER B 2 ? ? 64.51 -2.89 6 1 THR B 3 ? ? 66.89 -7.18 7 1 VAL B 4 ? ? 31.24 49.05 8 1 SER B 5 ? ? -156.65 55.95 9 1 ARG B 32 ? ? 49.20 80.29 10 2 THR A 3 ? ? -62.76 -98.98 11 2 LEU A 30 ? ? -174.38 78.10 12 2 ARG A 32 ? ? -54.82 101.35 13 2 SER B 2 ? ? 46.18 15.40 14 2 THR B 3 ? ? 56.06 160.71 15 2 SER B 5 ? ? -156.54 81.10 16 2 ARG B 32 ? ? 51.00 86.33 17 3 VAL A 4 ? ? -58.81 -7.23 18 3 SER A 5 ? ? 63.94 60.35 19 3 LEU A 30 ? ? -175.15 78.71 20 3 SER B 2 ? ? 63.81 134.39 21 3 THR B 3 ? ? -160.09 113.80 22 3 SER B 5 ? ? -173.31 48.52 23 3 PRO B 6 ? ? -66.95 88.11 24 3 ARG B 32 ? ? -60.16 87.14 25 4 THR A 3 ? ? 52.56 -82.07 26 4 SER A 5 ? ? 39.62 69.51 27 4 LEU A 30 ? ? -174.48 78.02 28 4 SER B 2 ? ? 47.40 26.48 29 4 THR B 3 ? ? 59.34 120.78 30 4 SER B 5 ? ? -172.56 71.99 31 4 PRO B 6 ? ? -46.31 86.45 32 5 SER A 2 ? ? -76.59 -74.21 33 5 THR A 3 ? ? -167.27 -87.63 34 5 VAL A 4 ? ? 41.23 96.80 35 5 PRO A 6 ? ? -64.80 69.59 36 5 LEU A 30 ? ? -175.39 78.73 37 5 SER B 2 ? ? 71.77 -17.34 38 5 VAL B 4 ? ? 34.20 29.53 39 5 SER B 5 ? ? -166.59 72.46 40 6 LEU A 30 ? ? -173.71 77.57 41 6 SER B 2 ? ? 73.65 -30.66 42 6 THR B 3 ? ? 54.71 99.61 43 6 ARG B 32 ? ? 50.98 80.13 44 7 SER A 2 ? ? -151.14 -88.18 45 7 THR A 3 ? ? -62.84 -144.97 46 7 LEU A 30 ? ? -172.40 76.47 47 7 SER B 2 ? ? 44.51 24.90 48 7 VAL B 4 ? ? 39.06 72.34 49 7 PRO B 6 ? ? -46.13 101.29 50 7 ARG B 32 ? ? -64.36 87.11 51 8 THR A 3 ? ? -46.50 103.13 52 8 VAL A 4 ? ? -75.17 -158.94 53 8 PRO A 6 ? ? -79.47 27.87 54 8 LEU A 30 ? ? -173.89 77.95 55 8 THR B 3 ? ? 53.23 99.56 56 8 PRO B 6 ? ? -42.54 88.22 57 8 ARG B 32 ? ? -163.88 78.19 58 9 THR A 3 ? ? -164.90 76.72 59 9 VAL A 4 ? ? -144.47 -22.49 60 9 LEU A 30 ? ? -174.42 78.11 61 9 SER B 2 ? ? -157.68 -32.65 62 9 THR B 3 ? ? 47.17 96.22 63 9 SER B 5 ? ? -161.15 60.68 64 9 PRO B 6 ? ? -66.78 84.70 65 10 THR A 3 ? ? -47.53 108.76 66 10 LEU A 30 ? ? -172.50 76.72 67 10 THR B 3 ? ? 51.88 96.24 68 10 VAL B 4 ? ? -65.50 -168.99 69 10 SER B 5 ? ? -160.38 62.28 70 11 PRO A 6 ? ? -78.93 40.54 71 11 LEU A 30 ? ? -174.28 78.57 72 11 SER B 5 ? ? 177.73 162.71 73 11 PRO B 6 ? ? -33.58 92.39 74 12 SER A 2 ? ? -159.57 -6.58 75 12 THR A 3 ? ? -160.67 -61.31 76 12 SER A 5 ? ? 53.05 79.21 77 12 LEU A 30 ? ? -174.75 78.44 78 12 THR B 3 ? ? 63.56 -69.30 79 12 PRO B 6 ? ? -34.45 88.06 80 13 SER A 2 ? ? -76.08 32.82 81 13 VAL A 4 ? ? -78.25 -86.12 82 13 SER A 5 ? ? 59.06 150.51 83 13 LEU A 30 ? ? -174.56 77.66 84 13 SER B 2 ? ? -159.20 -22.71 85 13 THR B 3 ? ? 46.67 81.14 86 13 ARG B 32 ? ? -47.33 97.93 87 14 VAL A 4 ? ? 52.91 -82.02 88 14 SER A 5 ? ? 59.83 143.61 89 14 LEU A 30 ? ? -173.15 77.29 90 14 SER B 2 ? ? 64.65 -2.12 91 14 THR B 3 ? ? 46.20 89.40 92 14 ARG B 32 ? ? -62.31 82.61 93 15 SER A 2 ? ? -76.53 -80.08 94 15 THR A 3 ? ? -166.41 -27.65 95 15 VAL A 4 ? ? 52.96 94.17 96 15 LEU A 30 ? ? -177.90 80.34 97 15 SER B 2 ? ? 57.00 98.50 98 15 THR B 3 ? ? 60.12 121.61 99 15 PRO B 6 ? ? -59.82 107.96 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 75 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L34 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L34 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.5 (dimer) mM [U-100% 13C; U-100% 15N; U-80% 2H] DAP12 transmembrane peptide-1, 20 mM sodium phosphate-2, 25 mM SDS-3, 250 mM Foscholine-14-4, 95% H2O/5% D2O ; 1 '95% H2O/5% D2O' ;0.5 (dimer) mM [U-100% 13C; U-100% 15N] DAP12 transmembrane peptide-5, 20 mM sodium phosphate-6, 25 mM [U-100% 2H] SDS-7, 250 mM [U-100% 2H] Foscholine-14-8, 95% H2O/5% D2O ; 2 '95% H2O/5% D2O' ;0.5 (monomer) mM [U-100% 15N; U-100% 2H] DAP12 transmembrane peptide-9, 0.5 (monomer) mM [U-100% 13C] DAP12 transmembrane peptide-10, 25 mM [U-100% 2H] SDS-11, 250 mM [U-100% 2H] Foscholine-14-12, 20 mM sodium phosphate-13, 95% H2O/5% D2O ; 3 '95% H2O/5% D2O' ;0.5 (dimer) mM [U-10% 13C] DAP12 transmembrane peptide-14, 25 mM [U-100% 2H] SDS-15, 250 mM [U-100% 2H] Foscholine-14-16, 20 mM sodium phosphate-17, 95% H2O/5% D2O ; 4 '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'DAP12 transmembrane peptide-1' 0.5 ? mM '[U-100% 13C; U-100% 15N; U-80% 2H]' 1 'sodium phosphate-2' 20 ? mM ? 1 SDS-3 25 ? mM ? 1 Foscholine-14-4 250 ? mM ? 1 'DAP12 transmembrane peptide-5' 0.5 ? mM '[U-100% 13C; U-100% 15N]' 2 'sodium phosphate-6' 20 ? mM ? 2 SDS-7 25 ? mM '[U-100% 2H]' 2 Foscholine-14-8 250 ? mM '[U-100% 2H]' 2 'DAP12 transmembrane peptide-9' 0.5 ? mM '[U-100% 15N; U-100% 2H]' 3 'DAP12 transmembrane peptide-10' 0.5 ? mM '[U-100% 13C]' 3 SDS-11 25 ? mM '[U-100% 2H]' 3 Foscholine-14-12 250 ? mM '[U-100% 2H]' 3 'sodium phosphate-13' 20 ? mM ? 3 'DAP12 transmembrane peptide-14' 0.5 ? mM '[U-10% 13C]' 4 SDS-15 25 ? mM '[U-100% 2H]' 4 Foscholine-14-16 250 ? mM '[U-100% 2H]' 4 'sodium phosphate-17' 20 ? mM ? 4 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 2 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC' 1 3 1 '3D HNCA' 1 4 1 '3D HN(CO)CA' 1 5 1 '3D HNCACB' 1 6 1 '3D HN(COCA)CB' 1 7 2 '3D 1H-15N NOESY' 1 8 2 '3D 1H-13C NOESY' 1 9 3 '3D 1H-15N NOESY' 1 10 4 '2D 1H-13C HSQC' # _pdbx_nmr_refine.entry_id 2L34 _pdbx_nmr_refine.method 'simulated annealing, molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'data analysis' NMRPipe ? 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 'Bartels et al.' 'data analysis' XEASY ? 3 'Bartels et al.' 'chemical shift assignment' XEASY ? 4 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' ? 5 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLY N N N N 71 GLY CA C N N 72 GLY C C N N 73 GLY O O N N 74 GLY OXT O N N 75 GLY H H N N 76 GLY H2 H N N 77 GLY HA2 H N N 78 GLY HA3 H N N 79 GLY HXT H N N 80 ILE N N N N 81 ILE CA C N S 82 ILE C C N N 83 ILE O O N N 84 ILE CB C N S 85 ILE CG1 C N N 86 ILE CG2 C N N 87 ILE CD1 C N N 88 ILE OXT O N N 89 ILE H H N N 90 ILE H2 H N N 91 ILE HA H N N 92 ILE HB H N N 93 ILE HG12 H N N 94 ILE HG13 H N N 95 ILE HG21 H N N 96 ILE HG22 H N N 97 ILE HG23 H N N 98 ILE HD11 H N N 99 ILE HD12 H N N 100 ILE HD13 H N N 101 ILE HXT H N N 102 LEU N N N N 103 LEU CA C N S 104 LEU C C N N 105 LEU O O N N 106 LEU CB C N N 107 LEU CG C N N 108 LEU CD1 C N N 109 LEU CD2 C N N 110 LEU OXT O N N 111 LEU H H N N 112 LEU H2 H N N 113 LEU HA H N N 114 LEU HB2 H N N 115 LEU HB3 H N N 116 LEU HG H N N 117 LEU HD11 H N N 118 LEU HD12 H N N 119 LEU HD13 H N N 120 LEU HD21 H N N 121 LEU HD22 H N N 122 LEU HD23 H N N 123 LEU HXT H N N 124 MET N N N N 125 MET CA C N S 126 MET C C N N 127 MET O O N N 128 MET CB C N N 129 MET CG C N N 130 MET SD S N N 131 MET CE C N N 132 MET OXT O N N 133 MET H H N N 134 MET H2 H N N 135 MET HA H N N 136 MET HB2 H N N 137 MET HB3 H N N 138 MET HG2 H N N 139 MET HG3 H N N 140 MET HE1 H N N 141 MET HE2 H N N 142 MET HE3 H N N 143 MET HXT H N N 144 PHE N N N N 145 PHE CA C N S 146 PHE C C N N 147 PHE O O N N 148 PHE CB C N N 149 PHE CG C Y N 150 PHE CD1 C Y N 151 PHE CD2 C Y N 152 PHE CE1 C Y N 153 PHE CE2 C Y N 154 PHE CZ C Y N 155 PHE OXT O N N 156 PHE H H N N 157 PHE H2 H N N 158 PHE HA H N N 159 PHE HB2 H N N 160 PHE HB3 H N N 161 PHE HD1 H N N 162 PHE HD2 H N N 163 PHE HE1 H N N 164 PHE HE2 H N N 165 PHE HZ H N N 166 PHE HXT H N N 167 PRO N N N N 168 PRO CA C N S 169 PRO C C N N 170 PRO O O N N 171 PRO CB C N N 172 PRO CG C N N 173 PRO CD C N N 174 PRO OXT O N N 175 PRO H H N N 176 PRO HA H N N 177 PRO HB2 H N N 178 PRO HB3 H N N 179 PRO HG2 H N N 180 PRO HG3 H N N 181 PRO HD2 H N N 182 PRO HD3 H N N 183 PRO HXT H N N 184 SER N N N N 185 SER CA C N S 186 SER C C N N 187 SER O O N N 188 SER CB C N N 189 SER OG O N N 190 SER OXT O N N 191 SER H H N N 192 SER H2 H N N 193 SER HA H N N 194 SER HB2 H N N 195 SER HB3 H N N 196 SER HG H N N 197 SER HXT H N N 198 THR N N N N 199 THR CA C N S 200 THR C C N N 201 THR O O N N 202 THR CB C N R 203 THR OG1 O N N 204 THR CG2 C N N 205 THR OXT O N N 206 THR H H N N 207 THR H2 H N N 208 THR HA H N N 209 THR HB H N N 210 THR HG1 H N N 211 THR HG21 H N N 212 THR HG22 H N N 213 THR HG23 H N N 214 THR HXT H N N 215 TYR N N N N 216 TYR CA C N S 217 TYR C C N N 218 TYR O O N N 219 TYR CB C N N 220 TYR CG C Y N 221 TYR CD1 C Y N 222 TYR CD2 C Y N 223 TYR CE1 C Y N 224 TYR CE2 C Y N 225 TYR CZ C Y N 226 TYR OH O N N 227 TYR OXT O N N 228 TYR H H N N 229 TYR H2 H N N 230 TYR HA H N N 231 TYR HB2 H N N 232 TYR HB3 H N N 233 TYR HD1 H N N 234 TYR HD2 H N N 235 TYR HE1 H N N 236 TYR HE2 H N N 237 TYR HH H N N 238 TYR HXT H N N 239 VAL N N N N 240 VAL CA C N S 241 VAL C C N N 242 VAL O O N N 243 VAL CB C N N 244 VAL CG1 C N N 245 VAL CG2 C N N 246 VAL OXT O N N 247 VAL H H N N 248 VAL H2 H N N 249 VAL HA H N N 250 VAL HB H N N 251 VAL HG11 H N N 252 VAL HG12 H N N 253 VAL HG13 H N N 254 VAL HG21 H N N 255 VAL HG22 H N N 256 VAL HG23 H N N 257 VAL HXT H N N 258 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLY N CA sing N N 67 GLY N H sing N N 68 GLY N H2 sing N N 69 GLY CA C sing N N 70 GLY CA HA2 sing N N 71 GLY CA HA3 sing N N 72 GLY C O doub N N 73 GLY C OXT sing N N 74 GLY OXT HXT sing N N 75 ILE N CA sing N N 76 ILE N H sing N N 77 ILE N H2 sing N N 78 ILE CA C sing N N 79 ILE CA CB sing N N 80 ILE CA HA sing N N 81 ILE C O doub N N 82 ILE C OXT sing N N 83 ILE CB CG1 sing N N 84 ILE CB CG2 sing N N 85 ILE CB HB sing N N 86 ILE CG1 CD1 sing N N 87 ILE CG1 HG12 sing N N 88 ILE CG1 HG13 sing N N 89 ILE CG2 HG21 sing N N 90 ILE CG2 HG22 sing N N 91 ILE CG2 HG23 sing N N 92 ILE CD1 HD11 sing N N 93 ILE CD1 HD12 sing N N 94 ILE CD1 HD13 sing N N 95 ILE OXT HXT sing N N 96 LEU N CA sing N N 97 LEU N H sing N N 98 LEU N H2 sing N N 99 LEU CA C sing N N 100 LEU CA CB sing N N 101 LEU CA HA sing N N 102 LEU C O doub N N 103 LEU C OXT sing N N 104 LEU CB CG sing N N 105 LEU CB HB2 sing N N 106 LEU CB HB3 sing N N 107 LEU CG CD1 sing N N 108 LEU CG CD2 sing N N 109 LEU CG HG sing N N 110 LEU CD1 HD11 sing N N 111 LEU CD1 HD12 sing N N 112 LEU CD1 HD13 sing N N 113 LEU CD2 HD21 sing N N 114 LEU CD2 HD22 sing N N 115 LEU CD2 HD23 sing N N 116 LEU OXT HXT sing N N 117 MET N CA sing N N 118 MET N H sing N N 119 MET N H2 sing N N 120 MET CA C sing N N 121 MET CA CB sing N N 122 MET CA HA sing N N 123 MET C O doub N N 124 MET C OXT sing N N 125 MET CB CG sing N N 126 MET CB HB2 sing N N 127 MET CB HB3 sing N N 128 MET CG SD sing N N 129 MET CG HG2 sing N N 130 MET CG HG3 sing N N 131 MET SD CE sing N N 132 MET CE HE1 sing N N 133 MET CE HE2 sing N N 134 MET CE HE3 sing N N 135 MET OXT HXT sing N N 136 PHE N CA sing N N 137 PHE N H sing N N 138 PHE N H2 sing N N 139 PHE CA C sing N N 140 PHE CA CB sing N N 141 PHE CA HA sing N N 142 PHE C O doub N N 143 PHE C OXT sing N N 144 PHE CB CG sing N N 145 PHE CB HB2 sing N N 146 PHE CB HB3 sing N N 147 PHE CG CD1 doub Y N 148 PHE CG CD2 sing Y N 149 PHE CD1 CE1 sing Y N 150 PHE CD1 HD1 sing N N 151 PHE CD2 CE2 doub Y N 152 PHE CD2 HD2 sing N N 153 PHE CE1 CZ doub Y N 154 PHE CE1 HE1 sing N N 155 PHE CE2 CZ sing Y N 156 PHE CE2 HE2 sing N N 157 PHE CZ HZ sing N N 158 PHE OXT HXT sing N N 159 PRO N CA sing N N 160 PRO N CD sing N N 161 PRO N H sing N N 162 PRO CA C sing N N 163 PRO CA CB sing N N 164 PRO CA HA sing N N 165 PRO C O doub N N 166 PRO C OXT sing N N 167 PRO CB CG sing N N 168 PRO CB HB2 sing N N 169 PRO CB HB3 sing N N 170 PRO CG CD sing N N 171 PRO CG HG2 sing N N 172 PRO CG HG3 sing N N 173 PRO CD HD2 sing N N 174 PRO CD HD3 sing N N 175 PRO OXT HXT sing N N 176 SER N CA sing N N 177 SER N H sing N N 178 SER N H2 sing N N 179 SER CA C sing N N 180 SER CA CB sing N N 181 SER CA HA sing N N 182 SER C O doub N N 183 SER C OXT sing N N 184 SER CB OG sing N N 185 SER CB HB2 sing N N 186 SER CB HB3 sing N N 187 SER OG HG sing N N 188 SER OXT HXT sing N N 189 THR N CA sing N N 190 THR N H sing N N 191 THR N H2 sing N N 192 THR CA C sing N N 193 THR CA CB sing N N 194 THR CA HA sing N N 195 THR C O doub N N 196 THR C OXT sing N N 197 THR CB OG1 sing N N 198 THR CB CG2 sing N N 199 THR CB HB sing N N 200 THR OG1 HG1 sing N N 201 THR CG2 HG21 sing N N 202 THR CG2 HG22 sing N N 203 THR CG2 HG23 sing N N 204 THR OXT HXT sing N N 205 TYR N CA sing N N 206 TYR N H sing N N 207 TYR N H2 sing N N 208 TYR CA C sing N N 209 TYR CA CB sing N N 210 TYR CA HA sing N N 211 TYR C O doub N N 212 TYR C OXT sing N N 213 TYR CB CG sing N N 214 TYR CB HB2 sing N N 215 TYR CB HB3 sing N N 216 TYR CG CD1 doub Y N 217 TYR CG CD2 sing Y N 218 TYR CD1 CE1 sing Y N 219 TYR CD1 HD1 sing N N 220 TYR CD2 CE2 doub Y N 221 TYR CD2 HD2 sing N N 222 TYR CE1 CZ doub Y N 223 TYR CE1 HE1 sing N N 224 TYR CE2 CZ sing Y N 225 TYR CE2 HE2 sing N N 226 TYR CZ OH sing N N 227 TYR OH HH sing N N 228 TYR OXT HXT sing N N 229 VAL N CA sing N N 230 VAL N H sing N N 231 VAL N H2 sing N N 232 VAL CA C sing N N 233 VAL CA CB sing N N 234 VAL CA HA sing N N 235 VAL C O doub N N 236 VAL C OXT sing N N 237 VAL CB CG1 sing N N 238 VAL CB CG2 sing N N 239 VAL CB HB sing N N 240 VAL CG1 HG11 sing N N 241 VAL CG1 HG12 sing N N 242 VAL CG1 HG13 sing N N 243 VAL CG2 HG21 sing N N 244 VAL CG2 HG22 sing N N 245 VAL CG2 HG23 sing N N 246 VAL OXT HXT sing N N 247 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2L34 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_