data_2L40 # _entry.id 2L40 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2L40 pdb_00002l40 10.2210/pdb2l40/pdb RCSB RCSB101928 ? ? WWPDB D_1000101928 ? ? BMRB 17213 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2L1D PDB 'Mouse prion protein (121-231) with the mutation Y169G' unspecified 2L1H PDB 'Mouse prion protein (121-231) at 20 C degrees' unspecified 2L39 PDB 'Mouse prion protein (121-231) at 37 C degrees' unspecified 2L1K PDB 'Mouse prion protein (121-231) with the mutations Y169A, Y225A, and Y226A' unspecified 2L1E PDB 'Mouse prion protein (121-231) with the mutation F175A' unspecified 17213 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L40 _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2010-09-28 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Christen, B.' 1 'Damberger, F.F.' 2 'Perez, D.R.' 3 'Hornemann, S.' 4 'Wuthrich, K.' 5 # _citation.id primary _citation.title 'Cellular prion protein conformation and function.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 108 _citation.page_first 17308 _citation.page_last 17313 _citation.year 2011 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21987789 _citation.pdbx_database_id_DOI 10.1073/pnas.1106325108 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Damberger, F.F.' 1 ? primary 'Christen, B.' 2 ? primary 'Perez, D.R.' 3 ? primary 'Hornemann, S.' 4 ? primary 'Wuthrich, K.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Major prion protein' _entity.formula_weight 13316.781 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation Y169A _entity.pdbx_fragment 'UNP residues 120-231' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQASNQNNFVHDCVNITIKQHTVTTTTKGENF TETDVKMMERVVEQMCVTQYQKESQAYYDGRRSS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQASNQNNFVHDCVNITIKQHTVTTTTKGENF TETDVKMMERVVEQMCVTQYQKESQAYYDGRRSS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 VAL n 1 4 VAL n 1 5 GLY n 1 6 GLY n 1 7 LEU n 1 8 GLY n 1 9 GLY n 1 10 TYR n 1 11 MET n 1 12 LEU n 1 13 GLY n 1 14 SER n 1 15 ALA n 1 16 MET n 1 17 SER n 1 18 ARG n 1 19 PRO n 1 20 MET n 1 21 ILE n 1 22 HIS n 1 23 PHE n 1 24 GLY n 1 25 ASN n 1 26 ASP n 1 27 TRP n 1 28 GLU n 1 29 ASP n 1 30 ARG n 1 31 TYR n 1 32 TYR n 1 33 ARG n 1 34 GLU n 1 35 ASN n 1 36 MET n 1 37 TYR n 1 38 ARG n 1 39 TYR n 1 40 PRO n 1 41 ASN n 1 42 GLN n 1 43 VAL n 1 44 TYR n 1 45 TYR n 1 46 ARG n 1 47 PRO n 1 48 VAL n 1 49 ASP n 1 50 GLN n 1 51 ALA n 1 52 SER n 1 53 ASN n 1 54 GLN n 1 55 ASN n 1 56 ASN n 1 57 PHE n 1 58 VAL n 1 59 HIS n 1 60 ASP n 1 61 CYS n 1 62 VAL n 1 63 ASN n 1 64 ILE n 1 65 THR n 1 66 ILE n 1 67 LYS n 1 68 GLN n 1 69 HIS n 1 70 THR n 1 71 VAL n 1 72 THR n 1 73 THR n 1 74 THR n 1 75 THR n 1 76 LYS n 1 77 GLY n 1 78 GLU n 1 79 ASN n 1 80 PHE n 1 81 THR n 1 82 GLU n 1 83 THR n 1 84 ASP n 1 85 VAL n 1 86 LYS n 1 87 MET n 1 88 MET n 1 89 GLU n 1 90 ARG n 1 91 VAL n 1 92 VAL n 1 93 GLU n 1 94 GLN n 1 95 MET n 1 96 CYS n 1 97 VAL n 1 98 THR n 1 99 GLN n 1 100 TYR n 1 101 GLN n 1 102 LYS n 1 103 GLU n 1 104 SER n 1 105 GLN n 1 106 ALA n 1 107 TYR n 1 108 TYR n 1 109 ASP n 1 110 GLY n 1 111 ARG n 1 112 ARG n 1 113 SER n 1 114 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Prnp, RP23-401J24.1-001' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pRSETA _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q4FJQ7_MOUSE _struct_ref.pdbx_db_accession Q4FJQ7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTE TDVKMMERVVEQMCVTQYQKESQAYYDGRRSS ; _struct_ref.pdbx_align_begin 120 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L40 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 114 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q4FJQ7 _struct_ref_seq.db_align_beg 120 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 231 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 121 _struct_ref_seq.pdbx_auth_seq_align_end 232 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2L40 GLY A 1 ? UNP Q4FJQ7 ? ? 'expression tag' 119 1 1 2L40 SER A 2 ? UNP Q4FJQ7 ? ? 'expression tag' 120 2 1 2L40 ALA A 51 ? UNP Q4FJQ7 TYR 168 'engineered mutation' 169 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N NOESY' 1 2 1 '3D 1H-13C NOESY' 1 3 1 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.01 _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293.2 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1.4 mM [U-99% 13C; U-99% 15N] entity-1, 10 mM [U-2H] sodium acetate-2, 0.02 % sodium azide-3, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker DRX 1 'Bruker DRX' 900 Bruker AVANCE 2 'Bruker Avance' 750 Bruker DRX 3 'Bruker DRX' 600 Bruker DRX 4 'Bruker DRX' # _pdbx_nmr_refine.entry_id 2L40 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2L40 _pdbx_nmr_details.text ;TWO 13C-RESOLVED [1H,1H]-NOESY SPECTRA WERE OBTAINED WITH THE 13C CARRIER AND SPECTRAL WIDTH OPTIMIZED FOR ALIPHATIC AND AROMATIC 13C RESONANCES RESPECTIVELY. ; # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 80 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L40 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L40 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' processing XwinNMR ? 1 'Bruker Biospin' collection XwinNMR ? 2 'Keller and Wuthrich' 'data analysis' CARA ? 3 'Herrmann, Guntert and Wuthrich' 'chemical shift assignment' ATNOS/CANDID 1.2 4 'Herrmann, Guntert and Wuthrich' 'peak picking' ATNOS/CANDID 1.2 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' DYANA 1.0.3 6 'Luginbuhl, Guntert, Billeter and Wuthrich' refinement OPALp ? 7 'Koradi, Billeter and Wuthrich' 'data analysis' MOLMOL ? 8 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L40 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L40 _struct.title 'Mouse prion protein (121-231) containing the substitution Y169A' _struct.pdbx_model_details 'fewest violations, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L40 _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'prion, mutation, MEMBRANE PROTEIN, PrP' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TRP A 27 ? MET A 36 ? TRP A 145 MET A 154 1 ? 10 HELX_P HELX_P2 2 TYR A 37 ? TYR A 39 ? TYR A 155 TYR A 157 5 ? 3 HELX_P HELX_P3 3 ASN A 53 ? GLN A 68 ? ASN A 171 GLN A 186 1 ? 16 HELX_P HELX_P4 4 THR A 81 ? ASP A 109 ? THR A 199 ASP A 227 1 ? 29 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 61 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 96 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 179 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 214 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.031 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 MET A 11 ? LEU A 12 ? MET A 129 LEU A 130 A 2 TYR A 44 ? TYR A 45 ? TYR A 162 TYR A 163 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id MET _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 11 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id MET _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 129 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 45 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 163 # _atom_sites.entry_id 2L40 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 119 119 GLY GLY A . n A 1 2 SER 2 120 120 SER SER A . n A 1 3 VAL 3 121 121 VAL VAL A . n A 1 4 VAL 4 122 122 VAL VAL A . n A 1 5 GLY 5 123 123 GLY GLY A . n A 1 6 GLY 6 124 124 GLY GLY A . n A 1 7 LEU 7 125 125 LEU LEU A . n A 1 8 GLY 8 126 126 GLY GLY A . n A 1 9 GLY 9 127 127 GLY GLY A . n A 1 10 TYR 10 128 128 TYR TYR A . n A 1 11 MET 11 129 129 MET MET A . n A 1 12 LEU 12 130 130 LEU LEU A . n A 1 13 GLY 13 131 131 GLY GLY A . n A 1 14 SER 14 132 132 SER SER A . n A 1 15 ALA 15 133 133 ALA ALA A . n A 1 16 MET 16 134 134 MET MET A . n A 1 17 SER 17 135 135 SER SER A . n A 1 18 ARG 18 136 136 ARG ARG A . n A 1 19 PRO 19 137 137 PRO PRO A . n A 1 20 MET 20 138 138 MET MET A . n A 1 21 ILE 21 139 139 ILE ILE A . n A 1 22 HIS 22 140 140 HIS HIS A . n A 1 23 PHE 23 141 141 PHE PHE A . n A 1 24 GLY 24 142 142 GLY GLY A . n A 1 25 ASN 25 143 143 ASN ASN A . n A 1 26 ASP 26 144 144 ASP ASP A . n A 1 27 TRP 27 145 145 TRP TRP A . n A 1 28 GLU 28 146 146 GLU GLU A . n A 1 29 ASP 29 147 147 ASP ASP A . n A 1 30 ARG 30 148 148 ARG ARG A . n A 1 31 TYR 31 149 149 TYR TYR A . n A 1 32 TYR 32 150 150 TYR TYR A . n A 1 33 ARG 33 151 151 ARG ARG A . n A 1 34 GLU 34 152 152 GLU GLU A . n A 1 35 ASN 35 153 153 ASN ASN A . n A 1 36 MET 36 154 154 MET MET A . n A 1 37 TYR 37 155 155 TYR TYR A . n A 1 38 ARG 38 156 156 ARG ARG A . n A 1 39 TYR 39 157 157 TYR TYR A . n A 1 40 PRO 40 158 158 PRO PRO A . n A 1 41 ASN 41 159 159 ASN ASN A . n A 1 42 GLN 42 160 160 GLN GLN A . n A 1 43 VAL 43 161 161 VAL VAL A . n A 1 44 TYR 44 162 162 TYR TYR A . n A 1 45 TYR 45 163 163 TYR TYR A . n A 1 46 ARG 46 164 164 ARG ARG A . n A 1 47 PRO 47 165 165 PRO PRO A . n A 1 48 VAL 48 166 166 VAL VAL A . n A 1 49 ASP 49 167 167 ASP ASP A . n A 1 50 GLN 50 168 168 GLN GLN A . n A 1 51 ALA 51 169 169 ALA ALA A . n A 1 52 SER 52 170 170 SER SER A . n A 1 53 ASN 53 171 171 ASN ASN A . n A 1 54 GLN 54 172 172 GLN GLN A . n A 1 55 ASN 55 173 173 ASN ASN A . n A 1 56 ASN 56 174 174 ASN ASN A . n A 1 57 PHE 57 175 175 PHE PHE A . n A 1 58 VAL 58 176 176 VAL VAL A . n A 1 59 HIS 59 177 177 HIS HIS A . n A 1 60 ASP 60 178 178 ASP ASP A . n A 1 61 CYS 61 179 179 CYS CYS A . n A 1 62 VAL 62 180 180 VAL VAL A . n A 1 63 ASN 63 181 181 ASN ASN A . n A 1 64 ILE 64 182 182 ILE ILE A . n A 1 65 THR 65 183 183 THR THR A . n A 1 66 ILE 66 184 184 ILE ILE A . n A 1 67 LYS 67 185 185 LYS LYS A . n A 1 68 GLN 68 186 186 GLN GLN A . n A 1 69 HIS 69 187 187 HIS HIS A . n A 1 70 THR 70 188 188 THR THR A . n A 1 71 VAL 71 189 189 VAL VAL A . n A 1 72 THR 72 190 190 THR THR A . n A 1 73 THR 73 191 191 THR THR A . n A 1 74 THR 74 192 192 THR THR A . n A 1 75 THR 75 193 193 THR THR A . n A 1 76 LYS 76 194 194 LYS LYS A . n A 1 77 GLY 77 195 195 GLY GLY A . n A 1 78 GLU 78 196 196 GLU GLU A . n A 1 79 ASN 79 197 197 ASN ASN A . n A 1 80 PHE 80 198 198 PHE PHE A . n A 1 81 THR 81 199 199 THR THR A . n A 1 82 GLU 82 200 200 GLU GLU A . n A 1 83 THR 83 201 201 THR THR A . n A 1 84 ASP 84 202 202 ASP ASP A . n A 1 85 VAL 85 203 203 VAL VAL A . n A 1 86 LYS 86 204 204 LYS LYS A . n A 1 87 MET 87 205 205 MET MET A . n A 1 88 MET 88 206 206 MET MET A . n A 1 89 GLU 89 207 207 GLU GLU A . n A 1 90 ARG 90 208 208 ARG ARG A . n A 1 91 VAL 91 209 209 VAL VAL A . n A 1 92 VAL 92 210 210 VAL VAL A . n A 1 93 GLU 93 211 211 GLU GLU A . n A 1 94 GLN 94 212 212 GLN GLN A . n A 1 95 MET 95 213 213 MET MET A . n A 1 96 CYS 96 214 214 CYS CYS A . n A 1 97 VAL 97 215 215 VAL VAL A . n A 1 98 THR 98 216 216 THR THR A . n A 1 99 GLN 99 217 217 GLN GLN A . n A 1 100 TYR 100 218 218 TYR TYR A . n A 1 101 GLN 101 219 219 GLN GLN A . n A 1 102 LYS 102 220 220 LYS LYS A . n A 1 103 GLU 103 221 221 GLU GLU A . n A 1 104 SER 104 222 222 SER SER A . n A 1 105 GLN 105 223 223 GLN GLN A . n A 1 106 ALA 106 224 224 ALA ALA A . n A 1 107 TYR 107 225 225 TYR TYR A . n A 1 108 TYR 108 226 226 TYR TYR A . n A 1 109 ASP 109 227 227 ASP ASP A . n A 1 110 GLY 110 228 228 GLY GLY A . n A 1 111 ARG 111 229 229 ARG ARG A . n A 1 112 ARG 112 230 230 ARG ARG A . n A 1 113 SER 113 231 231 SER SER A . n A 1 114 SER 114 232 232 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-08-10 2 'Structure model' 1 1 2011-11-09 3 'Structure model' 1 2 2020-02-26 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' 7 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 1.4 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium acetate-2' 10 ? mM '[U-2H]' 1 'sodium azide-3' 0.02 ? % ? 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HG1 A THR 199 ? ? OD1 A ASP 202 ? ? 1.59 2 4 HG1 A THR 199 ? ? OD1 A ASP 202 ? ? 1.59 3 5 O A HIS 187 ? ? HG1 A THR 191 ? ? 1.59 4 9 HH A TYR 128 ? ? OD2 A ASP 178 ? ? 1.54 5 9 O A PRO 137 ? ? HH A TYR 150 ? ? 1.57 6 14 HH A TYR 163 ? ? OE2 A GLU 221 ? ? 1.58 7 14 O A HIS 187 ? ? HG1 A THR 191 ? ? 1.60 8 20 O A PRO 137 ? ? HH A TYR 150 ? ? 1.60 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 151 ? ? CZ A ARG 151 ? ? NH2 A ARG 151 ? ? 117.22 120.30 -3.08 0.50 N 2 1 CA A CYS 179 ? ? CB A CYS 179 ? ? SG A CYS 179 ? ? 120.85 114.20 6.65 1.10 N 3 4 CA A THR 199 ? ? CB A THR 199 ? ? CG2 A THR 199 ? ? 103.57 112.40 -8.83 1.40 N 4 7 CB A TYR 149 ? ? CG A TYR 149 ? ? CD2 A TYR 149 ? ? 116.76 121.00 -4.24 0.60 N 5 7 NE A ARG 208 ? ? CZ A ARG 208 ? ? NH2 A ARG 208 ? ? 117.01 120.30 -3.29 0.50 N 6 10 CB A TYR 157 ? ? CG A TYR 157 ? ? CD2 A TYR 157 ? ? 117.02 121.00 -3.98 0.60 N 7 12 CA A VAL 176 ? ? CB A VAL 176 ? ? CG2 A VAL 176 ? ? 120.58 110.90 9.68 1.50 N 8 14 CA A CYS 179 ? ? CB A CYS 179 ? ? SG A CYS 179 ? ? 120.90 114.20 6.70 1.10 N 9 16 NE A ARG 230 ? ? CZ A ARG 230 ? ? NH1 A ARG 230 ? ? 123.55 120.30 3.25 0.50 N 10 17 NE A ARG 164 ? ? CZ A ARG 164 ? ? NH2 A ARG 164 ? ? 117.01 120.30 -3.29 0.50 N 11 18 CB A TYR 157 ? ? CG A TYR 157 ? ? CD2 A TYR 157 ? ? 117.06 121.00 -3.94 0.60 N 12 18 CA A VAL 209 ? ? CB A VAL 209 ? ? CG2 A VAL 209 ? ? 126.56 110.90 15.66 1.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 132 ? ? -58.47 170.42 2 1 MET A 134 ? ? -103.70 -160.22 3 1 GLN A 168 ? ? 45.50 -52.36 4 1 ALA A 169 ? ? -138.05 -79.53 5 1 SER A 170 ? ? 45.76 24.80 6 1 THR A 191 ? ? -153.52 -42.55 7 1 ASN A 197 ? ? -169.08 56.58 8 2 VAL A 121 ? ? 57.52 16.33 9 2 VAL A 122 ? ? -24.01 -61.56 10 2 ALA A 169 ? ? -125.38 -108.87 11 2 SER A 170 ? ? 40.82 27.53 12 2 GLN A 186 ? ? -78.05 -90.22 13 2 THR A 191 ? ? -150.89 -42.88 14 2 LYS A 194 ? ? -94.35 33.93 15 2 ASN A 197 ? ? -172.71 41.46 16 2 PHE A 198 ? ? -39.50 123.43 17 2 SER A 231 ? ? -151.49 38.44 18 3 ALA A 169 ? ? -94.05 -98.72 19 3 SER A 170 ? ? 40.41 25.51 20 3 HIS A 187 ? ? -136.11 -41.81 21 3 THR A 191 ? ? -155.51 -39.76 22 3 ASN A 197 ? ? -170.01 64.96 23 3 ASP A 227 ? ? -69.44 3.09 24 4 VAL A 121 ? ? 61.67 66.02 25 4 SER A 170 ? ? -143.35 21.28 26 4 HIS A 187 ? ? -136.69 -35.06 27 4 THR A 191 ? ? -150.60 -34.77 28 4 LYS A 194 ? ? -117.53 59.11 29 4 ASN A 197 ? ? -167.62 52.35 30 4 SER A 231 ? ? -164.46 76.96 31 5 SER A 120 ? ? 65.59 176.23 32 5 VAL A 121 ? ? -147.80 27.39 33 5 VAL A 122 ? ? -37.30 -38.26 34 5 PRO A 165 ? ? -84.27 47.31 35 5 VAL A 166 ? ? 44.22 127.90 36 5 GLN A 168 ? ? -39.67 -29.21 37 5 SER A 170 ? ? -81.62 42.30 38 5 ASN A 171 ? ? -42.19 160.17 39 5 HIS A 187 ? ? -155.24 -36.52 40 5 THR A 191 ? ? -151.44 -30.40 41 5 ASN A 197 ? ? -174.16 60.46 42 5 SER A 231 ? ? -147.51 12.29 43 6 PHE A 141 ? ? 49.44 -14.60 44 6 MET A 154 ? ? -58.02 -3.02 45 6 ALA A 169 ? ? -147.37 22.43 46 6 SER A 170 ? ? -89.51 38.14 47 6 ASN A 171 ? ? -43.45 159.89 48 6 HIS A 187 ? ? -143.63 -37.02 49 6 THR A 191 ? ? -144.89 -30.27 50 6 LYS A 194 ? ? -96.68 52.07 51 6 ASN A 197 ? ? -171.67 69.73 52 7 VAL A 122 ? ? -24.05 -63.77 53 7 GLN A 168 ? ? -48.64 -16.76 54 7 SER A 170 ? ? -75.23 35.48 55 7 ASN A 171 ? ? -49.93 152.79 56 7 GLN A 186 ? ? -71.13 -93.33 57 7 THR A 191 ? ? -163.15 -36.50 58 7 ASN A 197 ? ? -179.11 45.82 59 8 SER A 120 ? ? 59.03 -163.11 60 8 VAL A 122 ? ? -24.98 -64.24 61 8 MET A 134 ? ? -111.17 -149.16 62 8 MET A 154 ? ? -38.72 -37.55 63 8 SER A 170 ? ? -82.47 30.79 64 8 GLN A 186 ? ? -69.94 -73.84 65 8 THR A 188 ? ? -124.77 -61.45 66 8 THR A 191 ? ? -148.70 -55.75 67 8 ASN A 197 ? ? 179.33 51.70 68 8 SER A 231 ? ? -154.73 46.05 69 9 VAL A 122 ? ? -25.32 -47.49 70 9 GLN A 168 ? ? -38.44 -30.58 71 9 ALA A 169 ? ? -146.84 23.46 72 9 SER A 170 ? ? -78.87 48.41 73 9 ASN A 171 ? ? -49.62 164.28 74 9 HIS A 187 ? ? -140.88 -21.49 75 9 THR A 190 ? ? -91.18 30.46 76 9 THR A 191 ? ? -151.32 -48.81 77 9 GLU A 196 ? ? -67.64 -178.85 78 9 ASN A 197 ? ? -173.81 67.51 79 9 SER A 231 ? ? -151.01 73.44 80 10 SER A 120 ? ? 60.08 -166.27 81 10 VAL A 122 ? ? -66.94 2.36 82 10 PHE A 141 ? ? 39.13 0.85 83 10 VAL A 166 ? ? 34.06 85.36 84 10 GLN A 186 ? ? -77.44 -87.80 85 10 THR A 191 ? ? -160.00 -35.04 86 10 ASN A 197 ? ? 178.76 70.23 87 10 PHE A 198 ? ? -50.26 106.39 88 10 SER A 231 ? ? -151.89 50.95 89 11 PRO A 137 ? ? -62.90 -178.96 90 11 MET A 154 ? ? -62.03 1.42 91 11 ALA A 169 ? ? -85.17 -100.84 92 11 SER A 170 ? ? 42.11 24.39 93 11 HIS A 177 ? ? -53.61 -70.02 94 11 LYS A 185 ? ? -56.46 -8.93 95 11 THR A 191 ? ? -166.41 -53.19 96 11 ASN A 197 ? ? -173.25 65.39 97 11 SER A 231 ? ? -140.32 32.62 98 12 VAL A 122 ? ? -24.86 -42.93 99 12 MET A 154 ? ? -57.93 21.67 100 12 GLN A 186 ? ? -60.51 -81.26 101 12 THR A 190 ? ? -92.76 37.85 102 12 THR A 191 ? ? -158.49 -53.08 103 12 ASN A 197 ? ? -173.03 58.96 104 12 PHE A 198 ? ? -51.80 104.63 105 13 SER A 120 ? ? 171.07 154.79 106 13 VAL A 121 ? ? -143.70 27.21 107 13 MET A 134 ? ? -108.84 -168.59 108 13 ASP A 167 ? ? -128.89 -163.11 109 13 ALA A 169 ? ? -144.79 40.91 110 13 HIS A 187 ? ? -132.37 -32.62 111 13 THR A 191 ? ? -153.48 -43.12 112 13 ASN A 197 ? ? -172.70 59.21 113 13 PHE A 198 ? ? -33.62 126.42 114 13 TYR A 226 ? ? -75.75 -75.49 115 13 ASP A 227 ? ? 24.97 32.00 116 13 ARG A 229 ? ? -74.69 29.56 117 14 VAL A 121 ? ? -153.83 44.65 118 14 VAL A 122 ? ? -62.87 3.56 119 14 GLN A 168 ? ? 43.98 -60.58 120 14 ALA A 169 ? ? -148.87 12.43 121 14 LYS A 185 ? ? -56.11 -5.87 122 14 GLN A 186 ? ? -74.20 -94.92 123 14 THR A 191 ? ? -161.71 -59.20 124 14 ASN A 197 ? ? -166.75 43.80 125 14 PHE A 198 ? ? -39.05 111.19 126 14 TYR A 225 ? ? -96.26 -63.84 127 14 SER A 231 ? ? -171.10 72.69 128 15 VAL A 121 ? ? 55.36 14.81 129 15 HIS A 140 ? ? -119.90 77.52 130 15 SER A 170 ? ? -142.17 17.23 131 15 HIS A 187 ? ? -147.55 -3.82 132 15 THR A 191 ? ? -164.53 -56.30 133 15 ASN A 197 ? ? -172.46 61.62 134 15 SER A 231 ? ? -151.75 18.26 135 16 MET A 134 ? ? -97.63 -157.97 136 16 HIS A 140 ? ? -118.70 76.69 137 16 SER A 170 ? ? -83.20 40.59 138 16 HIS A 187 ? ? -151.70 -9.68 139 16 THR A 191 ? ? -162.95 -44.93 140 16 ASN A 197 ? ? -174.20 63.52 141 16 ARG A 229 ? ? -150.92 14.25 142 17 ARG A 136 ? ? -59.38 107.47 143 17 ALA A 169 ? ? -150.09 85.39 144 17 SER A 170 ? ? -151.78 17.42 145 17 GLN A 186 ? ? -71.38 -93.02 146 17 THR A 191 ? ? -161.98 -39.04 147 17 ASN A 197 ? ? 176.30 44.67 148 18 SER A 120 ? ? 83.58 116.02 149 18 VAL A 122 ? ? -25.63 -63.07 150 18 HIS A 140 ? ? -117.48 79.78 151 18 ASP A 144 ? ? -68.97 0.13 152 18 SER A 170 ? ? -145.28 22.87 153 18 GLN A 186 ? ? -84.62 -87.77 154 18 THR A 191 ? ? -165.75 -50.02 155 18 LYS A 194 ? ? -110.24 54.45 156 18 ASN A 197 ? ? -178.61 66.87 157 18 PHE A 198 ? ? -49.82 106.03 158 18 SER A 231 ? ? -160.33 78.65 159 19 HIS A 140 ? ? -111.07 74.94 160 19 PRO A 165 ? ? -81.92 43.65 161 19 VAL A 166 ? ? 55.00 172.29 162 19 GLN A 168 ? ? -47.09 -14.62 163 19 ALA A 169 ? ? -140.35 -83.60 164 19 SER A 170 ? ? 35.63 39.86 165 19 GLN A 186 ? ? -80.25 -87.62 166 19 THR A 191 ? ? -163.05 -58.29 167 19 ASN A 197 ? ? -179.91 50.38 168 19 SER A 231 ? ? -142.54 34.39 169 20 VAL A 122 ? ? -39.80 -38.66 170 20 ALA A 133 ? ? -35.40 107.53 171 20 HIS A 187 ? ? -141.30 -48.28 172 20 THR A 191 ? ? -147.77 -33.81 173 20 LYS A 194 ? ? -113.97 63.66 174 20 GLU A 196 ? ? -69.69 -175.73 175 20 ASN A 197 ? ? -168.34 36.67 176 20 PHE A 198 ? ? -30.43 109.38 177 20 SER A 231 ? ? -146.86 29.20 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 3 GLY A 124 ? ? LEU A 125 ? ? -148.99 2 4 GLY A 142 ? ? ASN A 143 ? ? 142.68 3 4 GLN A 186 ? ? HIS A 187 ? ? 149.76 4 7 GLY A 124 ? ? LEU A 125 ? ? -145.23 5 8 GLY A 124 ? ? LEU A 125 ? ? -137.82 6 8 SER A 231 ? ? SER A 232 ? ? -143.84 7 9 GLY A 124 ? ? LEU A 125 ? ? -141.60 8 10 ASN A 171 ? ? GLN A 172 ? ? -134.38 9 11 THR A 190 ? ? THR A 191 ? ? -146.86 10 13 GLN A 186 ? ? HIS A 187 ? ? 147.82 11 20 GLY A 124 ? ? LEU A 125 ? ? -149.31 12 20 ASN A 171 ? ? GLN A 172 ? ? -132.19 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 218 ? ? 0.072 'SIDE CHAIN' 2 2 ARG A 136 ? ? 0.125 'SIDE CHAIN' 3 2 ARG A 151 ? ? 0.113 'SIDE CHAIN' 4 2 ARG A 164 ? ? 0.078 'SIDE CHAIN' 5 2 TYR A 226 ? ? 0.126 'SIDE CHAIN' 6 3 TYR A 128 ? ? 0.082 'SIDE CHAIN' 7 4 TYR A 128 ? ? 0.104 'SIDE CHAIN' 8 4 TYR A 162 ? ? 0.091 'SIDE CHAIN' 9 5 TYR A 218 ? ? 0.103 'SIDE CHAIN' 10 6 TYR A 149 ? ? 0.074 'SIDE CHAIN' 11 6 TYR A 218 ? ? 0.089 'SIDE CHAIN' 12 6 ARG A 230 ? ? 0.118 'SIDE CHAIN' 13 7 ARG A 148 ? ? 0.105 'SIDE CHAIN' 14 7 TYR A 149 ? ? 0.086 'SIDE CHAIN' 15 7 TYR A 162 ? ? 0.076 'SIDE CHAIN' 16 7 TYR A 163 ? ? 0.072 'SIDE CHAIN' 17 7 ARG A 164 ? ? 0.081 'SIDE CHAIN' 18 8 HIS A 140 ? ? 0.101 'SIDE CHAIN' 19 8 ARG A 156 ? ? 0.087 'SIDE CHAIN' 20 8 TYR A 163 ? ? 0.075 'SIDE CHAIN' 21 9 HIS A 140 ? ? 0.091 'SIDE CHAIN' 22 9 ARG A 148 ? ? 0.088 'SIDE CHAIN' 23 10 ARG A 164 ? ? 0.139 'SIDE CHAIN' 24 10 TYR A 226 ? ? 0.128 'SIDE CHAIN' 25 11 ARG A 151 ? ? 0.079 'SIDE CHAIN' 26 11 ARG A 208 ? ? 0.099 'SIDE CHAIN' 27 12 HIS A 140 ? ? 0.101 'SIDE CHAIN' 28 13 ARG A 136 ? ? 0.090 'SIDE CHAIN' 29 13 ARG A 208 ? ? 0.085 'SIDE CHAIN' 30 13 TYR A 226 ? ? 0.099 'SIDE CHAIN' 31 14 ARG A 136 ? ? 0.096 'SIDE CHAIN' 32 14 TYR A 150 ? ? 0.076 'SIDE CHAIN' 33 14 TYR A 226 ? ? 0.066 'SIDE CHAIN' 34 15 TYR A 128 ? ? 0.064 'SIDE CHAIN' 35 15 ARG A 136 ? ? 0.095 'SIDE CHAIN' 36 15 ARG A 148 ? ? 0.120 'SIDE CHAIN' 37 15 ARG A 230 ? ? 0.105 'SIDE CHAIN' 38 17 PHE A 141 ? ? 0.081 'SIDE CHAIN' 39 17 TYR A 225 ? ? 0.099 'SIDE CHAIN' 40 18 TYR A 157 ? ? 0.077 'SIDE CHAIN' 41 18 ARG A 164 ? ? 0.089 'SIDE CHAIN' 42 20 ARG A 136 ? ? 0.115 'SIDE CHAIN' #