data_2L43 # _entry.id 2L43 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2L43 pdb_00002l43 10.2210/pdb2l43/pdb RCSB RCSB101931 ? ? WWPDB D_1000101931 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-08-31 2 'Structure model' 1 1 2020-01-15 3 'Structure model' 1 2 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Source and taxonomy' 4 2 'Structure model' 'Structure summary' 5 3 'Structure model' 'Data collection' 6 3 'Structure model' 'Database references' 7 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' entity 2 2 'Structure model' entity_name_com 3 2 'Structure model' entity_src_gen 4 2 'Structure model' pdbx_nmr_software 5 2 'Structure model' struct_ref 6 2 'Structure model' struct_ref_seq_dif 7 3 'Structure model' chem_comp_atom 8 3 'Structure model' chem_comp_bond 9 3 'Structure model' database_2 10 3 'Structure model' pdbx_struct_conn_angle 11 3 'Structure model' struct_conn 12 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_entity.pdbx_description' 2 2 'Structure model' '_pdbx_nmr_software.name' 3 2 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 4 2 'Structure model' '_struct_ref_seq_dif.details' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.value' 18 3 'Structure model' '_struct_conn.pdbx_dist_value' 19 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 20 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 21 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 22 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 23 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 24 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 27 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 28 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L43 _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2010-10-01 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Qin, S.' 1 'Zhang, J.' 2 'Wu, J.' 3 'Shi, Y.' 4 # _citation.id primary _citation.title ;Recognition of unmodified histone H3 by the first PHD finger of Bromodomain-PHD finger protein 2 provides insights into the regulation of histone acetyltransferases MOZ and MORF ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qin, S.' 1 ? primary 'Zhang, J.' 2 ? primary 'Wu, J.' 3 ? primary 'Shi, Y.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Histone H3.3,LINKER,Bromodomain-containing protein 1' 9790.953 1 ? 'C29S, C36S' ? 'chimeric protein of histone H3.3, linker, BRPF2 PHD1 domain' 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'BR140-like protein,Bromodomain and PHD finger-containing protein 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ARTKQTARKSTGGSSGSSQSLIDEDAVCSICMDGESQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRHCLQSRARPA LEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;ARTKQTARKSTGGSSGSSQSLIDEDAVCSICMDGESQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRHCLQSRARPA LEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ARG n 1 3 THR n 1 4 LYS n 1 5 GLN n 1 6 THR n 1 7 ALA n 1 8 ARG n 1 9 LYS n 1 10 SER n 1 11 THR n 1 12 GLY n 1 13 GLY n 1 14 SER n 1 15 SER n 1 16 GLY n 1 17 SER n 1 18 SER n 1 19 GLN n 1 20 SER n 1 21 LEU n 1 22 ILE n 1 23 ASP n 1 24 GLU n 1 25 ASP n 1 26 ALA n 1 27 VAL n 1 28 CYS n 1 29 SER n 1 30 ILE n 1 31 CYS n 1 32 MET n 1 33 ASP n 1 34 GLY n 1 35 GLU n 1 36 SER n 1 37 GLN n 1 38 ASN n 1 39 SER n 1 40 ASN n 1 41 VAL n 1 42 ILE n 1 43 LEU n 1 44 PHE n 1 45 CYS n 1 46 ASP n 1 47 MET n 1 48 CYS n 1 49 ASN n 1 50 LEU n 1 51 ALA n 1 52 VAL n 1 53 HIS n 1 54 GLN n 1 55 GLU n 1 56 CYS n 1 57 TYR n 1 58 GLY n 1 59 VAL n 1 60 PRO n 1 61 TYR n 1 62 ILE n 1 63 PRO n 1 64 GLU n 1 65 GLY n 1 66 GLN n 1 67 TRP n 1 68 LEU n 1 69 CYS n 1 70 ARG n 1 71 HIS n 1 72 CYS n 1 73 LEU n 1 74 GLN n 1 75 SER n 1 76 ARG n 1 77 ALA n 1 78 ARG n 1 79 PRO n 1 80 ALA n 1 81 LEU n 1 82 GLU n 1 83 HIS n 1 84 HIS n 1 85 HIS n 1 86 HIS n 1 87 HIS n 1 88 HIS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 12 Human ? 'H3-3A, H3.3A, H3F3, H3F3A, PP781, H3-3B, H3.3B, H3F3B' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? 'pET22b(+)' ? ? 1 2 sample 'Biological sequence' 13 18 ? ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? 'pET22b(+)' ? ? 1 3 sample 'Biological sequence' 19 88 Human ? 'BRD1, BRL, BRPF2' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? 'pET22b(+)' ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 HIS 53 53 53 HIS HIS A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 TRP 67 67 67 TRP TRP A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 CYS 69 69 69 CYS CYS A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 HIS 71 71 71 HIS HIS A . n A 1 72 CYS 72 72 72 CYS CYS A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 LEU 81 81 ? ? ? A . n A 1 82 GLU 82 82 ? ? ? A . n A 1 83 HIS 83 83 ? ? ? A . n A 1 84 HIS 84 84 ? ? ? A . n A 1 85 HIS 85 85 ? ? ? A . n A 1 86 HIS 86 86 ? ? ? A . n A 1 87 HIS 87 87 ? ? ? A . n A 1 88 HIS 88 88 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 89 81 ZN ZN A . C 2 ZN 1 90 82 ZN ZN A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'Solution structure of histone H3(1-12)-BRPF2 PHD1 chimeric protein' _exptl.entry_id 2L43 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L43 _struct.title 'Structural basis for histone code recognition by BRPF2-PHD1 finger' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L43 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'PHD finger, histone code, transcription' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP H33_HUMAN P84243 ? 1 ARTKQTARKSTG 2 2 PDB 2L43 2L43 ? 1 ? 13 3 UNP BRD1_HUMAN O95696 ? 1 QSLIDEDAVCCICMDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRHCLQSRARPA 208 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2L43 A 1 ? 12 ? P84243 2 ? 13 ? 1 12 2 2 2L43 A 13 ? 18 ? 2L43 13 ? 18 ? 13 18 3 3 2L43 A 19 ? 80 ? O95696 208 ? 269 ? 19 80 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 3 2L43 SER A 29 ? UNP O95696 CYS 218 'engineered mutation' 29 1 3 2L43 SER A 36 ? UNP O95696 CYS 225 'engineered mutation' 36 2 3 2L43 LEU A 81 ? UNP O95696 ? ? 'expression tag' 81 3 3 2L43 GLU A 82 ? UNP O95696 ? ? 'expression tag' 82 4 3 2L43 HIS A 83 ? UNP O95696 ? ? 'expression tag' 83 5 3 2L43 HIS A 84 ? UNP O95696 ? ? 'expression tag' 84 6 3 2L43 HIS A 85 ? UNP O95696 ? ? 'expression tag' 85 7 3 2L43 HIS A 86 ? UNP O95696 ? ? 'expression tag' 86 8 3 2L43 HIS A 87 ? UNP O95696 ? ? 'expression tag' 87 9 3 2L43 HIS A 88 ? UNP O95696 ? ? 'expression tag' 88 10 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 HIS A 53 ? GLY A 58 ? HIS A 53 GLY A 58 1 ? 6 HELX_P HELX_P2 2 CYS A 69 ? ARG A 76 ? CYS A 69 ARG A 76 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 28 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 28 A ZN 89 1_555 ? ? ? ? ? ? ? 2.275 ? ? metalc2 metalc ? ? A CYS 31 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 31 A ZN 89 1_555 ? ? ? ? ? ? ? 2.294 ? ? metalc3 metalc ? ? A CYS 45 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 45 A ZN 90 1_555 ? ? ? ? ? ? ? 2.295 ? ? metalc4 metalc ? ? A CYS 48 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 48 A ZN 90 1_555 ? ? ? ? ? ? ? 2.284 ? ? metalc5 metalc ? ? A HIS 53 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 53 A ZN 89 1_555 ? ? ? ? ? ? ? 2.101 ? ? metalc6 metalc ? ? A CYS 56 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 56 A ZN 89 1_555 ? ? ? ? ? ? ? 2.297 ? ? metalc7 metalc ? ? A CYS 69 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 69 A ZN 90 1_555 ? ? ? ? ? ? ? 2.297 ? ? metalc8 metalc ? ? A CYS 72 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 72 A ZN 90 1_555 ? ? ? ? ? ? ? 2.287 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 89 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 110.4 ? 2 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 89 ? 1_555 ND1 ? A HIS 53 ? A HIS 53 ? 1_555 96.5 ? 3 SG ? A CYS 31 ? A CYS 31 ? 1_555 ZN ? B ZN . ? A ZN 89 ? 1_555 ND1 ? A HIS 53 ? A HIS 53 ? 1_555 113.6 ? 4 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 89 ? 1_555 SG ? A CYS 56 ? A CYS 56 ? 1_555 107.9 ? 5 SG ? A CYS 31 ? A CYS 31 ? 1_555 ZN ? B ZN . ? A ZN 89 ? 1_555 SG ? A CYS 56 ? A CYS 56 ? 1_555 111.3 ? 6 ND1 ? A HIS 53 ? A HIS 53 ? 1_555 ZN ? B ZN . ? A ZN 89 ? 1_555 SG ? A CYS 56 ? A CYS 56 ? 1_555 116.1 ? 7 SG ? A CYS 45 ? A CYS 45 ? 1_555 ZN ? C ZN . ? A ZN 90 ? 1_555 SG ? A CYS 48 ? A CYS 48 ? 1_555 107.7 ? 8 SG ? A CYS 45 ? A CYS 45 ? 1_555 ZN ? C ZN . ? A ZN 90 ? 1_555 SG ? A CYS 69 ? A CYS 69 ? 1_555 116.2 ? 9 SG ? A CYS 48 ? A CYS 48 ? 1_555 ZN ? C ZN . ? A ZN 90 ? 1_555 SG ? A CYS 69 ? A CYS 69 ? 1_555 111.3 ? 10 SG ? A CYS 45 ? A CYS 45 ? 1_555 ZN ? C ZN . ? A ZN 90 ? 1_555 SG ? A CYS 72 ? A CYS 72 ? 1_555 104.1 ? 11 SG ? A CYS 48 ? A CYS 48 ? 1_555 ZN ? C ZN . ? A ZN 90 ? 1_555 SG ? A CYS 72 ? A CYS 72 ? 1_555 112.4 ? 12 SG ? A CYS 69 ? A CYS 69 ? 1_555 ZN ? C ZN . ? A ZN 90 ? 1_555 SG ? A CYS 72 ? A CYS 72 ? 1_555 105.0 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 2 ? ALA A 7 ? ARG A 2 ALA A 7 A 2 SER A 39 ? PHE A 44 ? SER A 39 PHE A 44 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 4 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 4 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 42 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 42 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 89 ? 4 'BINDING SITE FOR RESIDUE ZN A 89' AC2 Software A ZN 90 ? 4 'BINDING SITE FOR RESIDUE ZN A 90' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 28 ? CYS A 28 . ? 1_555 ? 2 AC1 4 CYS A 31 ? CYS A 31 . ? 1_555 ? 3 AC1 4 HIS A 53 ? HIS A 53 . ? 1_555 ? 4 AC1 4 CYS A 56 ? CYS A 56 . ? 1_555 ? 5 AC2 4 CYS A 45 ? CYS A 45 . ? 1_555 ? 6 AC2 4 CYS A 48 ? CYS A 48 . ? 1_555 ? 7 AC2 4 CYS A 69 ? CYS A 69 . ? 1_555 ? 8 AC2 4 CYS A 72 ? CYS A 72 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 17 ? ? 67.12 -74.35 2 1 SER A 20 ? ? -172.88 103.35 3 1 MET A 32 ? ? -95.71 35.79 4 1 GLU A 35 ? ? -157.43 87.26 5 1 GLN A 37 ? ? 66.55 164.34 6 1 LEU A 50 ? ? -63.38 96.35 7 2 LYS A 9 ? ? 65.03 104.27 8 2 SER A 10 ? ? -163.64 -48.80 9 2 SER A 15 ? ? 70.41 -66.79 10 2 GLU A 24 ? ? 64.83 79.31 11 2 MET A 32 ? ? -98.00 45.68 12 2 LEU A 50 ? ? -55.86 107.98 13 3 ARG A 8 ? ? 71.62 -64.11 14 3 ILE A 22 ? ? -151.68 -46.45 15 3 ASP A 23 ? ? -160.82 106.66 16 3 ASP A 25 ? ? -58.76 -80.51 17 3 ALA A 26 ? ? 177.71 165.46 18 3 SER A 36 ? ? -95.44 33.42 19 3 GLU A 64 ? ? -97.70 31.83 20 4 LYS A 9 ? ? 48.33 -166.20 21 4 THR A 11 ? ? -104.13 67.13 22 4 SER A 14 ? ? 68.13 113.40 23 4 GLU A 24 ? ? -163.04 77.99 24 4 MET A 32 ? ? -106.04 50.75 25 4 LEU A 50 ? ? -60.03 95.59 26 4 GLU A 64 ? ? -98.47 31.65 27 5 ARG A 8 ? ? 67.93 113.38 28 5 SER A 14 ? ? 67.55 165.77 29 5 SER A 18 ? ? 63.09 -178.11 30 5 SER A 20 ? ? 62.07 86.79 31 5 ASP A 23 ? ? 66.62 171.45 32 5 MET A 32 ? ? -105.96 49.03 33 5 LEU A 50 ? ? -49.96 108.96 34 6 LYS A 9 ? ? 48.66 -165.22 35 6 SER A 10 ? ? -154.42 -51.35 36 6 THR A 11 ? ? 72.83 -63.15 37 6 SER A 14 ? ? -92.96 46.63 38 6 SER A 15 ? ? -154.36 -65.66 39 6 SER A 18 ? ? 72.88 141.68 40 6 LEU A 21 ? ? -162.48 117.81 41 6 ASP A 23 ? ? 47.90 -165.02 42 6 MET A 32 ? ? -97.61 44.51 43 6 SER A 36 ? ? -97.00 31.74 44 6 LEU A 50 ? ? -62.59 95.52 45 7 SER A 14 ? ? -128.18 -50.48 46 7 GLN A 19 ? ? -132.39 -49.67 47 7 LEU A 21 ? ? 61.36 170.45 48 7 ILE A 22 ? ? 71.17 147.17 49 7 ASP A 23 ? ? 58.65 72.32 50 7 ASP A 25 ? ? 55.21 -175.84 51 7 MET A 32 ? ? -113.91 53.17 52 7 LEU A 50 ? ? -53.43 98.23 53 8 LYS A 9 ? ? 66.63 103.85 54 8 SER A 18 ? ? -172.37 -48.66 55 8 GLU A 24 ? ? 38.67 91.82 56 8 MET A 32 ? ? -99.04 36.39 57 8 SER A 36 ? ? -68.18 92.61 58 8 LEU A 50 ? ? -56.22 95.05 59 9 LEU A 21 ? ? -143.68 31.13 60 9 ALA A 26 ? ? 68.49 154.84 61 9 MET A 32 ? ? -108.61 48.96 62 9 SER A 36 ? ? -98.83 34.34 63 9 LEU A 50 ? ? -55.02 97.64 64 10 THR A 11 ? ? 63.45 -179.50 65 10 SER A 14 ? ? 62.88 89.93 66 10 SER A 15 ? ? -103.65 -64.96 67 10 SER A 17 ? ? -150.68 35.99 68 10 ASP A 23 ? ? -160.37 28.05 69 10 MET A 32 ? ? -100.20 43.07 70 10 LEU A 50 ? ? -54.27 108.90 71 11 SER A 20 ? ? 66.60 162.47 72 11 ALA A 26 ? ? 67.27 174.96 73 11 MET A 32 ? ? -118.16 51.25 74 11 SER A 36 ? ? -96.70 34.51 75 11 LEU A 50 ? ? -57.56 94.07 76 11 PRO A 79 ? ? -56.40 95.02 77 12 ARG A 8 ? ? -162.63 91.05 78 12 THR A 11 ? ? 48.85 -164.15 79 12 SER A 15 ? ? -130.86 -54.78 80 12 GLN A 19 ? ? 71.94 131.97 81 12 SER A 20 ? ? 61.29 74.58 82 12 SER A 36 ? ? 62.15 86.23 83 12 LEU A 50 ? ? -58.59 96.65 84 13 ARG A 8 ? ? 66.07 108.16 85 13 SER A 10 ? ? 65.27 -173.09 86 13 THR A 11 ? ? -176.58 -46.52 87 13 SER A 14 ? ? 68.76 -72.62 88 13 SER A 20 ? ? 62.35 97.41 89 13 GLU A 24 ? ? 64.50 93.88 90 13 MET A 32 ? ? -98.97 36.28 91 13 SER A 36 ? ? -96.83 34.93 92 13 LEU A 50 ? ? -56.06 108.96 93 13 GLU A 64 ? ? -98.60 31.13 94 14 SER A 14 ? ? -155.58 -65.09 95 14 SER A 15 ? ? 64.56 174.67 96 14 SER A 17 ? ? -106.89 -70.42 97 14 SER A 18 ? ? -160.81 -51.77 98 14 ILE A 22 ? ? 61.87 88.74 99 14 GLU A 24 ? ? -116.76 73.01 100 14 ALA A 26 ? ? 71.90 161.02 101 14 MET A 32 ? ? -96.37 39.51 102 14 LEU A 50 ? ? -54.06 94.40 103 15 ARG A 8 ? ? 67.24 -78.15 104 15 THR A 11 ? ? -142.29 -43.99 105 15 SER A 17 ? ? -147.29 -66.06 106 15 SER A 18 ? ? 67.53 -74.11 107 15 SER A 20 ? ? 70.66 129.87 108 15 MET A 32 ? ? -106.92 51.29 109 15 LEU A 50 ? ? -52.50 100.84 110 16 LYS A 9 ? ? -144.92 -65.06 111 16 SER A 14 ? ? -152.44 -50.48 112 16 MET A 32 ? ? -99.42 34.51 113 16 LEU A 50 ? ? -64.49 94.79 114 17 ARG A 8 ? ? -98.17 35.84 115 17 LYS A 9 ? ? -86.91 -75.49 116 17 SER A 10 ? ? -178.26 -55.08 117 17 SER A 15 ? ? 64.07 -179.91 118 17 GLN A 19 ? ? -134.79 -61.59 119 17 SER A 20 ? ? -167.62 115.43 120 17 LEU A 21 ? ? 62.69 94.84 121 17 ASP A 23 ? ? 62.51 -177.48 122 17 MET A 32 ? ? -99.13 45.43 123 17 LEU A 50 ? ? -62.20 96.83 124 17 GLU A 64 ? ? -96.00 31.08 125 18 ARG A 8 ? ? 65.15 178.02 126 18 THR A 11 ? ? 38.59 53.14 127 18 SER A 17 ? ? 70.77 -68.22 128 18 SER A 20 ? ? 66.37 165.04 129 18 ASP A 23 ? ? -94.83 31.64 130 18 MET A 32 ? ? -107.47 43.72 131 18 ASN A 38 ? ? -98.24 -64.45 132 18 LEU A 50 ? ? -51.87 100.26 133 19 ARG A 8 ? ? 66.31 100.90 134 19 SER A 14 ? ? 71.15 -69.55 135 19 GLN A 19 ? ? 70.32 133.41 136 19 SER A 20 ? ? -99.07 33.47 137 19 ASP A 23 ? ? 59.14 -177.16 138 19 MET A 32 ? ? -98.73 42.12 139 19 SER A 36 ? ? 61.50 78.73 140 19 LEU A 50 ? ? -53.28 109.55 141 20 ARG A 8 ? ? 62.98 179.48 142 20 THR A 11 ? ? -133.30 -44.92 143 20 SER A 17 ? ? 64.84 94.35 144 20 GLN A 19 ? ? -154.85 21.92 145 20 SER A 20 ? ? 60.03 -171.61 146 20 LEU A 21 ? ? -136.36 -47.42 147 20 MET A 32 ? ? -104.17 51.68 148 20 SER A 39 ? ? -174.84 112.18 149 20 LEU A 50 ? ? -52.77 109.05 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L43 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L43 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.8mM [U-100% 13C; U-100% 15N] protein-1, 1.6mM ZINC ION-2, 20mM Bis-Tris-3, 150mM sodium chloride-4, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.8mM [U-100% 13C; U-100% 15N] protein-5, 1.6mM ZINC ION-6, 20mM Bis-Tris-7, 150mM sodium chloride-8, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id protein-1 0.8 ? mM '[U-100% 13C; U-100% 15N]' 1 'ZINC ION-2' 1.6 ? mM ? 1 Bis-Tris-3 20 ? mM ? 1 'sodium chloride-4' 150 ? mM ? 1 protein-5 0.8 ? mM '[U-100% 13C; U-100% 15N]' 2 'ZINC ION-6' 1.6 ? mM ? 2 Bis-Tris-7 20 ? mM ? 2 'sodium chloride-8' 150 ? mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.15 _pdbx_nmr_exptl_sample_conditions.pH 6.7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D HNCACB' 1 4 1 '3D C(CO)NH' 1 5 1 '3D HBHA(CO)NH' 1 6 1 '3D H(CCO)NH' 1 7 1 '3D 1H-15N NOESY' 1 8 2 '3D 1H-13C NOESY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2L43 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 28 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1201 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 464 _pdbx_nmr_constraints.NOE_long_range_total_count 301 _pdbx_nmr_constraints.NOE_medium_range_total_count 139 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 297 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 31 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 31 # _pdbx_nmr_refine.entry_id 2L43 _pdbx_nmr_refine.method 'simulated annealing, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 Goddard 'data analysis' Sparky 3 2 Goddard 'chemical shift assignment' Sparky 3 3 Goddard 'peak picking' Sparky 3 4 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 5 'Cornilescu, Delaglio and Bax' 'chemical shift calculation' TALOS ? 6 'Laskowski and MacArthur' 'data analysis' ProcheckNMR ? 7 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 1.2 8 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.2 9 'Koradi, Billeter and Wuthrich' 'data analysis' MOLMOL ? 10 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 81 ? A LEU 81 2 1 Y 1 A GLU 82 ? A GLU 82 3 1 Y 1 A HIS 83 ? A HIS 83 4 1 Y 1 A HIS 84 ? A HIS 84 5 1 Y 1 A HIS 85 ? A HIS 85 6 1 Y 1 A HIS 86 ? A HIS 86 7 1 Y 1 A HIS 87 ? A HIS 87 8 1 Y 1 A HIS 88 ? A HIS 88 9 2 Y 1 A LEU 81 ? A LEU 81 10 2 Y 1 A GLU 82 ? A GLU 82 11 2 Y 1 A HIS 83 ? A HIS 83 12 2 Y 1 A HIS 84 ? A HIS 84 13 2 Y 1 A HIS 85 ? A HIS 85 14 2 Y 1 A HIS 86 ? A HIS 86 15 2 Y 1 A HIS 87 ? A HIS 87 16 2 Y 1 A HIS 88 ? A HIS 88 17 3 Y 1 A LEU 81 ? A LEU 81 18 3 Y 1 A GLU 82 ? A GLU 82 19 3 Y 1 A HIS 83 ? A HIS 83 20 3 Y 1 A HIS 84 ? A HIS 84 21 3 Y 1 A HIS 85 ? A HIS 85 22 3 Y 1 A HIS 86 ? A HIS 86 23 3 Y 1 A HIS 87 ? A HIS 87 24 3 Y 1 A HIS 88 ? A HIS 88 25 4 Y 1 A LEU 81 ? A LEU 81 26 4 Y 1 A GLU 82 ? A GLU 82 27 4 Y 1 A HIS 83 ? A HIS 83 28 4 Y 1 A HIS 84 ? A HIS 84 29 4 Y 1 A HIS 85 ? A HIS 85 30 4 Y 1 A HIS 86 ? A HIS 86 31 4 Y 1 A HIS 87 ? A HIS 87 32 4 Y 1 A HIS 88 ? A HIS 88 33 5 Y 1 A LEU 81 ? A LEU 81 34 5 Y 1 A GLU 82 ? A GLU 82 35 5 Y 1 A HIS 83 ? A HIS 83 36 5 Y 1 A HIS 84 ? A HIS 84 37 5 Y 1 A HIS 85 ? A HIS 85 38 5 Y 1 A HIS 86 ? A HIS 86 39 5 Y 1 A HIS 87 ? A HIS 87 40 5 Y 1 A HIS 88 ? A HIS 88 41 6 Y 1 A LEU 81 ? A LEU 81 42 6 Y 1 A GLU 82 ? A GLU 82 43 6 Y 1 A HIS 83 ? A HIS 83 44 6 Y 1 A HIS 84 ? A HIS 84 45 6 Y 1 A HIS 85 ? A HIS 85 46 6 Y 1 A HIS 86 ? A HIS 86 47 6 Y 1 A HIS 87 ? A HIS 87 48 6 Y 1 A HIS 88 ? A HIS 88 49 7 Y 1 A LEU 81 ? A LEU 81 50 7 Y 1 A GLU 82 ? A GLU 82 51 7 Y 1 A HIS 83 ? A HIS 83 52 7 Y 1 A HIS 84 ? A HIS 84 53 7 Y 1 A HIS 85 ? A HIS 85 54 7 Y 1 A HIS 86 ? A HIS 86 55 7 Y 1 A HIS 87 ? A HIS 87 56 7 Y 1 A HIS 88 ? A HIS 88 57 8 Y 1 A LEU 81 ? A LEU 81 58 8 Y 1 A GLU 82 ? A GLU 82 59 8 Y 1 A HIS 83 ? A HIS 83 60 8 Y 1 A HIS 84 ? A HIS 84 61 8 Y 1 A HIS 85 ? A HIS 85 62 8 Y 1 A HIS 86 ? A HIS 86 63 8 Y 1 A HIS 87 ? A HIS 87 64 8 Y 1 A HIS 88 ? A HIS 88 65 9 Y 1 A LEU 81 ? A LEU 81 66 9 Y 1 A GLU 82 ? A GLU 82 67 9 Y 1 A HIS 83 ? A HIS 83 68 9 Y 1 A HIS 84 ? A HIS 84 69 9 Y 1 A HIS 85 ? A HIS 85 70 9 Y 1 A HIS 86 ? A HIS 86 71 9 Y 1 A HIS 87 ? A HIS 87 72 9 Y 1 A HIS 88 ? A HIS 88 73 10 Y 1 A LEU 81 ? A LEU 81 74 10 Y 1 A GLU 82 ? A GLU 82 75 10 Y 1 A HIS 83 ? A HIS 83 76 10 Y 1 A HIS 84 ? A HIS 84 77 10 Y 1 A HIS 85 ? A HIS 85 78 10 Y 1 A HIS 86 ? A HIS 86 79 10 Y 1 A HIS 87 ? A HIS 87 80 10 Y 1 A HIS 88 ? A HIS 88 81 11 Y 1 A LEU 81 ? A LEU 81 82 11 Y 1 A GLU 82 ? A GLU 82 83 11 Y 1 A HIS 83 ? A HIS 83 84 11 Y 1 A HIS 84 ? A HIS 84 85 11 Y 1 A HIS 85 ? A HIS 85 86 11 Y 1 A HIS 86 ? A HIS 86 87 11 Y 1 A HIS 87 ? A HIS 87 88 11 Y 1 A HIS 88 ? A HIS 88 89 12 Y 1 A LEU 81 ? A LEU 81 90 12 Y 1 A GLU 82 ? A GLU 82 91 12 Y 1 A HIS 83 ? A HIS 83 92 12 Y 1 A HIS 84 ? A HIS 84 93 12 Y 1 A HIS 85 ? A HIS 85 94 12 Y 1 A HIS 86 ? A HIS 86 95 12 Y 1 A HIS 87 ? A HIS 87 96 12 Y 1 A HIS 88 ? A HIS 88 97 13 Y 1 A LEU 81 ? A LEU 81 98 13 Y 1 A GLU 82 ? A GLU 82 99 13 Y 1 A HIS 83 ? A HIS 83 100 13 Y 1 A HIS 84 ? A HIS 84 101 13 Y 1 A HIS 85 ? A HIS 85 102 13 Y 1 A HIS 86 ? A HIS 86 103 13 Y 1 A HIS 87 ? A HIS 87 104 13 Y 1 A HIS 88 ? A HIS 88 105 14 Y 1 A LEU 81 ? A LEU 81 106 14 Y 1 A GLU 82 ? A GLU 82 107 14 Y 1 A HIS 83 ? A HIS 83 108 14 Y 1 A HIS 84 ? A HIS 84 109 14 Y 1 A HIS 85 ? A HIS 85 110 14 Y 1 A HIS 86 ? A HIS 86 111 14 Y 1 A HIS 87 ? A HIS 87 112 14 Y 1 A HIS 88 ? A HIS 88 113 15 Y 1 A LEU 81 ? A LEU 81 114 15 Y 1 A GLU 82 ? A GLU 82 115 15 Y 1 A HIS 83 ? A HIS 83 116 15 Y 1 A HIS 84 ? A HIS 84 117 15 Y 1 A HIS 85 ? A HIS 85 118 15 Y 1 A HIS 86 ? A HIS 86 119 15 Y 1 A HIS 87 ? A HIS 87 120 15 Y 1 A HIS 88 ? A HIS 88 121 16 Y 1 A LEU 81 ? A LEU 81 122 16 Y 1 A GLU 82 ? A GLU 82 123 16 Y 1 A HIS 83 ? A HIS 83 124 16 Y 1 A HIS 84 ? A HIS 84 125 16 Y 1 A HIS 85 ? A HIS 85 126 16 Y 1 A HIS 86 ? A HIS 86 127 16 Y 1 A HIS 87 ? A HIS 87 128 16 Y 1 A HIS 88 ? A HIS 88 129 17 Y 1 A LEU 81 ? A LEU 81 130 17 Y 1 A GLU 82 ? A GLU 82 131 17 Y 1 A HIS 83 ? A HIS 83 132 17 Y 1 A HIS 84 ? A HIS 84 133 17 Y 1 A HIS 85 ? A HIS 85 134 17 Y 1 A HIS 86 ? A HIS 86 135 17 Y 1 A HIS 87 ? A HIS 87 136 17 Y 1 A HIS 88 ? A HIS 88 137 18 Y 1 A LEU 81 ? A LEU 81 138 18 Y 1 A GLU 82 ? A GLU 82 139 18 Y 1 A HIS 83 ? A HIS 83 140 18 Y 1 A HIS 84 ? A HIS 84 141 18 Y 1 A HIS 85 ? A HIS 85 142 18 Y 1 A HIS 86 ? A HIS 86 143 18 Y 1 A HIS 87 ? A HIS 87 144 18 Y 1 A HIS 88 ? A HIS 88 145 19 Y 1 A LEU 81 ? A LEU 81 146 19 Y 1 A GLU 82 ? A GLU 82 147 19 Y 1 A HIS 83 ? A HIS 83 148 19 Y 1 A HIS 84 ? A HIS 84 149 19 Y 1 A HIS 85 ? A HIS 85 150 19 Y 1 A HIS 86 ? A HIS 86 151 19 Y 1 A HIS 87 ? A HIS 87 152 19 Y 1 A HIS 88 ? A HIS 88 153 20 Y 1 A LEU 81 ? A LEU 81 154 20 Y 1 A GLU 82 ? A GLU 82 155 20 Y 1 A HIS 83 ? A HIS 83 156 20 Y 1 A HIS 84 ? A HIS 84 157 20 Y 1 A HIS 85 ? A HIS 85 158 20 Y 1 A HIS 86 ? A HIS 86 159 20 Y 1 A HIS 87 ? A HIS 87 160 20 Y 1 A HIS 88 ? A HIS 88 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 ZN ZN ZN N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DMX' # _atom_sites.entry_id 2L43 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_