data_2L52 # _entry.id 2L52 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2L52 pdb_00002l52 10.2210/pdb2l52/pdb RCSB RCSB101966 ? ? BMRB 17263 ? 10.13018/BMR17263 WWPDB D_1000101966 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-02-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-05 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' struct_ref_seq_dif 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_database_status 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' 7 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 8 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L52 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-10-24 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 17263 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Damberger, F.F.' 1 'Ranjan, N.' 2 'Sutter, M.' 3 'Allain, F.H.-T.' 4 'Weber-Ban, E.' 5 # _citation.id primary _citation.title 'Solution structure and activation mechanism of ubiquitin-like small archaeal modifier proteins.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 405 _citation.page_first 1040 _citation.page_last 1055 _citation.year 2011 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21112336 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2010.11.040 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ranjan, N.' 1 ? primary 'Damberger, F.F.' 2 ? primary 'Sutter, M.' 3 ? primary 'Allain, F.H.' 4 ? primary 'Weber-Ban, E.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'METHANOSARCINA ACETIVORANS SAMP1 HOMOLOG' _entity.formula_weight 10708.403 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMAEVKVKLFANLREAAGTPELPLSGEKVIDVLLSLTDKYPALKYVIFEKGDEKSEILILCGSINILINGNNIRHLEGL ETLLKDSDEIGILPPVSGG ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMAEVKVKLFANLREAAGTPELPLSGEKVIDVLLSLTDKYPALKYVIFEKGDEKSEILILCGSINILINGNNIRHLEGL ETLLKDSDEIGILPPVSGG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 ALA n 1 5 GLU n 1 6 VAL n 1 7 LYS n 1 8 VAL n 1 9 LYS n 1 10 LEU n 1 11 PHE n 1 12 ALA n 1 13 ASN n 1 14 LEU n 1 15 ARG n 1 16 GLU n 1 17 ALA n 1 18 ALA n 1 19 GLY n 1 20 THR n 1 21 PRO n 1 22 GLU n 1 23 LEU n 1 24 PRO n 1 25 LEU n 1 26 SER n 1 27 GLY n 1 28 GLU n 1 29 LYS n 1 30 VAL n 1 31 ILE n 1 32 ASP n 1 33 VAL n 1 34 LEU n 1 35 LEU n 1 36 SER n 1 37 LEU n 1 38 THR n 1 39 ASP n 1 40 LYS n 1 41 TYR n 1 42 PRO n 1 43 ALA n 1 44 LEU n 1 45 LYS n 1 46 TYR n 1 47 VAL n 1 48 ILE n 1 49 PHE n 1 50 GLU n 1 51 LYS n 1 52 GLY n 1 53 ASP n 1 54 GLU n 1 55 LYS n 1 56 SER n 1 57 GLU n 1 58 ILE n 1 59 LEU n 1 60 ILE n 1 61 LEU n 1 62 CYS n 1 63 GLY n 1 64 SER n 1 65 ILE n 1 66 ASN n 1 67 ILE n 1 68 LEU n 1 69 ILE n 1 70 ASN n 1 71 GLY n 1 72 ASN n 1 73 ASN n 1 74 ILE n 1 75 ARG n 1 76 HIS n 1 77 LEU n 1 78 GLU n 1 79 GLY n 1 80 LEU n 1 81 GLU n 1 82 THR n 1 83 LEU n 1 84 LEU n 1 85 LYS n 1 86 ASP n 1 87 SER n 1 88 ASP n 1 89 GLU n 1 90 ILE n 1 91 GLY n 1 92 ILE n 1 93 LEU n 1 94 PRO n 1 95 PRO n 1 96 VAL n 1 97 SER n 1 98 GLY n 1 99 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'moaD, MA_4086' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Methanosarcina acetivorans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2214 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pROEX _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 HIS 2 2 2 HIS HIS A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 CYS 62 62 62 CYS CYS A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 GLY 99 99 99 GLY GLY A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L52 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L52 _struct.title 'Solution structure of the small archaeal modifier protein 1 (SAMP1) from Methanosarcina acetivorans' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L52 _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'beta-grasp fold, PROTEIN BINDING, SAMP1, SAMP, E1-LIKE, SAMP-ACTIVATOR, ELSA, ADENYLATION, UBIQUITIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8TIQ6_METAC _struct_ref.pdbx_db_accession Q8TIQ6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAEVKVKLFANLREAAGTPELPLSGEKVIDVLLSLTDKYPALKYVIFEKGDEKSEILILCGSINILINGNNIRHLEGLET LLKDSDEIGILPPVSGG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L52 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 99 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8TIQ6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 97 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 99 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2L52 GLY A 1 ? UNP Q8TIQ6 ? ? 'expression tag' 1 1 1 2L52 HIS A 2 ? UNP Q8TIQ6 ? ? 'expression tag' 2 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 12 ? GLY A 19 ? ALA A 12 GLY A 19 1 ? 8 HELX_P HELX_P2 2 LYS A 29 ? TYR A 41 ? LYS A 29 TYR A 41 1 ? 13 HELX_P HELX_P3 3 PRO A 42 ? LYS A 45 ? PRO A 42 LYS A 45 5 ? 4 HELX_P HELX_P4 4 ASN A 73 ? LEU A 77 ? ASN A 73 LEU A 77 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 22 ? SER A 26 ? GLU A 22 SER A 26 A 2 GLU A 5 ? LEU A 10 ? GLU A 5 LEU A 10 A 3 ASP A 88 ? LEU A 93 ? ASP A 88 LEU A 93 A 4 ASN A 66 ? ILE A 69 ? ASN A 66 ILE A 69 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 25 ? O LEU A 25 N VAL A 6 ? N VAL A 6 A 2 3 N LYS A 9 ? N LYS A 9 O ILE A 92 ? O ILE A 92 A 3 4 O LEU A 93 ? O LEU A 93 N ASN A 66 ? N ASN A 66 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 2 ? ? 57.31 170.91 2 1 ALA A 12 ? ? 47.39 -145.67 3 1 TYR A 41 ? ? -116.97 75.84 4 1 GLU A 54 ? ? -66.50 15.84 5 1 ASN A 70 ? ? 54.86 10.71 6 1 ASN A 73 ? ? 51.15 99.92 7 1 LEU A 77 ? ? -124.81 -155.73 8 1 LEU A 80 ? ? -60.89 2.29 9 1 LEU A 83 ? ? 53.02 87.65 10 1 ASP A 86 ? ? -64.38 5.40 11 1 SER A 87 ? ? -153.04 16.35 12 1 SER A 97 ? ? 52.74 18.03 13 2 ALA A 12 ? ? 47.55 -146.18 14 2 TYR A 41 ? ? -116.98 74.06 15 2 LYS A 51 ? ? -74.50 30.45 16 2 ASN A 70 ? ? 54.52 11.02 17 2 ASN A 73 ? ? 51.23 100.56 18 2 LEU A 77 ? ? -124.62 -155.73 19 2 LEU A 80 ? ? -60.11 1.18 20 2 THR A 82 ? ? -62.93 0.42 21 2 LEU A 83 ? ? 51.82 83.64 22 2 ASP A 86 ? ? -62.04 4.99 23 2 SER A 87 ? ? -152.81 16.83 24 3 ALA A 12 ? ? 48.35 -148.77 25 3 TYR A 41 ? ? -118.95 74.65 26 3 ASN A 70 ? ? 54.84 9.00 27 3 ASN A 73 ? ? 47.64 106.75 28 3 LEU A 77 ? ? -128.61 -156.54 29 3 LEU A 80 ? ? -59.85 -0.82 30 3 LEU A 83 ? ? 59.95 167.76 31 3 ASP A 86 ? ? -67.04 7.24 32 3 SER A 87 ? ? -149.96 14.36 33 4 ALA A 12 ? ? 46.08 -145.44 34 4 ASN A 13 ? ? -58.91 -9.95 35 4 TYR A 41 ? ? -118.25 77.21 36 4 LYS A 51 ? ? -75.26 47.84 37 4 GLU A 54 ? ? -65.07 0.29 38 4 LYS A 55 ? ? -140.48 11.02 39 4 ASN A 70 ? ? 54.22 10.24 40 4 ASN A 73 ? ? 50.29 97.20 41 4 LEU A 77 ? ? -124.03 -157.34 42 4 LEU A 80 ? ? -59.87 -2.48 43 4 LEU A 83 ? ? 60.38 164.97 44 4 ASP A 86 ? ? -68.84 7.54 45 4 SER A 87 ? ? -152.05 16.30 46 4 ASP A 88 ? ? -69.76 -179.97 47 5 ALA A 12 ? ? 49.84 -151.79 48 5 TYR A 41 ? ? -117.13 75.04 49 5 CYS A 62 ? ? -58.56 -1.76 50 5 ASN A 70 ? ? 54.12 10.42 51 5 ASN A 73 ? ? 50.73 98.45 52 5 LEU A 77 ? ? -123.19 -154.52 53 5 LEU A 80 ? ? -62.16 4.95 54 5 LEU A 83 ? ? 53.33 83.20 55 5 LEU A 84 ? ? -57.98 170.67 56 5 ASP A 86 ? ? -62.60 4.65 57 5 SER A 87 ? ? -151.91 15.51 58 5 VAL A 96 ? ? 40.42 26.15 59 5 SER A 97 ? ? -153.90 3.55 60 6 ALA A 12 ? ? 48.67 -150.63 61 6 TYR A 41 ? ? -118.37 75.16 62 6 LYS A 55 ? ? -143.93 -0.74 63 6 SER A 56 ? ? -157.07 -157.69 64 6 ASN A 70 ? ? 54.45 8.81 65 6 ASN A 73 ? ? 50.75 98.45 66 6 LEU A 77 ? ? -123.88 -156.93 67 6 LEU A 83 ? ? 59.62 168.02 68 6 ASP A 86 ? ? -67.37 8.71 69 6 SER A 87 ? ? -150.65 15.79 70 6 VAL A 96 ? ? -142.27 16.50 71 6 SER A 97 ? ? -150.90 13.15 72 7 ALA A 12 ? ? 47.68 -147.09 73 7 ASN A 13 ? ? -57.16 -8.69 74 7 TYR A 41 ? ? -117.86 75.99 75 7 LYS A 51 ? ? -73.41 39.05 76 7 ASN A 70 ? ? 56.02 10.13 77 7 ASN A 73 ? ? -39.15 109.73 78 7 LEU A 77 ? ? -121.78 -153.89 79 7 LEU A 80 ? ? -61.00 5.27 80 7 LEU A 83 ? ? 52.61 79.67 81 7 ASP A 86 ? ? -62.98 5.98 82 7 SER A 87 ? ? -153.76 19.58 83 8 ALA A 12 ? ? 47.11 -148.63 84 8 ASN A 13 ? ? -56.14 -9.99 85 8 TYR A 41 ? ? -117.40 75.80 86 8 LYS A 51 ? ? -75.22 36.76 87 8 CYS A 62 ? ? -59.14 -2.39 88 8 ASN A 70 ? ? 54.38 11.20 89 8 ASN A 73 ? ? 51.06 100.81 90 8 LEU A 77 ? ? -124.70 -155.49 91 8 LEU A 80 ? ? -61.82 5.82 92 8 THR A 82 ? ? -62.26 0.97 93 8 LEU A 83 ? ? 51.77 84.27 94 8 LEU A 84 ? ? -58.63 171.56 95 8 ASP A 86 ? ? -63.57 4.60 96 8 SER A 87 ? ? -151.96 15.58 97 9 ALA A 12 ? ? 47.78 -147.66 98 9 TYR A 41 ? ? -116.58 73.08 99 9 LYS A 51 ? ? -72.76 35.35 100 9 LYS A 55 ? ? -143.12 10.88 101 9 ASN A 73 ? ? 49.06 93.83 102 9 LEU A 77 ? ? -123.81 -154.94 103 9 LEU A 80 ? ? -58.76 -0.97 104 9 THR A 82 ? ? -64.99 2.71 105 9 LEU A 83 ? ? 51.95 85.00 106 9 ASP A 86 ? ? -64.04 5.96 107 9 SER A 87 ? ? -153.08 16.80 108 10 ALA A 12 ? ? 49.15 -152.50 109 10 TYR A 41 ? ? -117.53 74.90 110 10 LYS A 51 ? ? -75.09 35.00 111 10 ASN A 70 ? ? 54.82 8.78 112 10 ASN A 73 ? ? 49.04 97.35 113 10 LEU A 77 ? ? -123.81 -156.10 114 10 LEU A 83 ? ? 60.98 166.09 115 10 ASP A 86 ? ? -69.17 7.26 116 10 SER A 87 ? ? -150.38 13.80 117 10 ASP A 88 ? ? -68.98 -179.50 118 10 VAL A 96 ? ? -146.65 -11.07 119 10 SER A 97 ? ? -160.13 4.59 120 11 ALA A 12 ? ? 48.67 -152.63 121 11 TYR A 41 ? ? -116.86 75.50 122 11 ASN A 70 ? ? 55.33 10.50 123 11 ASN A 73 ? ? 51.57 101.05 124 11 LEU A 77 ? ? -121.04 -84.91 125 11 LEU A 80 ? ? -58.40 1.09 126 11 THR A 82 ? ? -63.71 0.81 127 11 LEU A 83 ? ? 51.66 84.85 128 11 LEU A 84 ? ? -59.76 170.42 129 11 ASP A 86 ? ? -64.29 4.31 130 11 SER A 87 ? ? -153.07 16.03 131 12 ALA A 12 ? ? 47.73 -146.18 132 12 TYR A 41 ? ? -118.69 76.57 133 12 LYS A 51 ? ? -74.49 43.84 134 12 ASN A 70 ? ? 55.07 8.61 135 12 ASN A 73 ? ? 49.33 99.43 136 12 LEU A 77 ? ? -124.73 -156.47 137 12 LEU A 80 ? ? -60.82 2.08 138 12 LEU A 83 ? ? 52.29 83.51 139 12 LEU A 84 ? ? -58.72 170.89 140 12 ASP A 86 ? ? -64.94 7.35 141 12 SER A 87 ? ? -152.86 17.21 142 13 ALA A 12 ? ? 47.62 -147.06 143 13 TYR A 41 ? ? -117.26 76.83 144 13 CYS A 62 ? ? -58.54 -2.31 145 13 ASN A 70 ? ? 54.67 10.75 146 13 ASN A 73 ? ? 51.46 100.57 147 13 LEU A 77 ? ? -125.50 -155.63 148 13 LEU A 80 ? ? -61.15 3.25 149 13 THR A 82 ? ? -62.15 0.65 150 13 LEU A 83 ? ? 52.27 85.16 151 13 LEU A 84 ? ? -59.34 171.69 152 13 ASP A 86 ? ? -64.30 5.25 153 13 SER A 87 ? ? -152.70 16.60 154 13 SER A 97 ? ? -147.94 17.35 155 14 ALA A 12 ? ? 46.68 -146.59 156 14 TYR A 41 ? ? -118.31 77.42 157 14 GLU A 54 ? ? -73.68 45.52 158 14 ASN A 70 ? ? 54.42 5.88 159 14 ASN A 73 ? ? 48.42 93.03 160 14 LEU A 77 ? ? -122.87 -153.89 161 14 LEU A 80 ? ? -60.18 1.33 162 14 LEU A 83 ? ? 62.47 125.62 163 14 ASP A 86 ? ? -68.04 8.14 164 14 SER A 87 ? ? -151.95 18.28 165 15 ALA A 12 ? ? 47.65 -146.89 166 15 TYR A 41 ? ? -118.17 75.53 167 15 LYS A 51 ? ? -87.08 30.16 168 15 GLU A 54 ? ? -64.40 13.97 169 15 CYS A 62 ? ? -57.63 -2.26 170 15 ASN A 70 ? ? 54.29 10.05 171 15 ASN A 73 ? ? 50.39 99.89 172 15 LEU A 77 ? ? -121.14 -83.94 173 15 LEU A 80 ? ? -61.67 6.28 174 15 LEU A 83 ? ? 61.32 132.69 175 15 ASP A 86 ? ? -65.31 6.06 176 15 SER A 87 ? ? -153.61 16.59 177 16 HIS A 2 ? ? -155.65 20.60 178 16 MET A 3 ? ? 54.96 85.31 179 16 ALA A 12 ? ? 48.04 -148.15 180 16 TYR A 41 ? ? -117.97 77.81 181 16 LYS A 51 ? ? -73.65 32.63 182 16 GLU A 54 ? ? -69.98 3.01 183 16 ASN A 70 ? ? 54.06 11.39 184 16 ASN A 73 ? ? 52.43 99.59 185 16 LEU A 77 ? ? -124.81 -156.27 186 16 LEU A 80 ? ? -59.61 1.76 187 16 THR A 82 ? ? -63.37 0.24 188 16 LEU A 83 ? ? 52.73 85.53 189 16 LEU A 84 ? ? -59.74 171.10 190 16 ASP A 86 ? ? -60.01 3.81 191 16 SER A 87 ? ? -152.40 18.07 192 16 SER A 97 ? ? 49.96 17.43 193 17 ALA A 12 ? ? 47.37 -147.18 194 17 TYR A 41 ? ? -118.56 76.17 195 17 LYS A 51 ? ? -70.95 41.86 196 17 ASP A 53 ? ? -79.58 22.57 197 17 ASN A 70 ? ? 55.07 7.69 198 17 ASN A 73 ? ? 51.08 96.93 199 17 LEU A 77 ? ? -124.01 -156.68 200 17 LEU A 83 ? ? 60.37 166.32 201 17 ASP A 86 ? ? -66.97 8.39 202 17 SER A 87 ? ? -151.78 17.67 203 17 VAL A 96 ? ? 44.78 19.84 204 17 SER A 97 ? ? -161.22 -32.94 205 18 ALA A 12 ? ? 46.92 -146.04 206 18 TYR A 41 ? ? -117.80 75.30 207 18 LYS A 51 ? ? -74.61 38.49 208 18 ASN A 70 ? ? 54.86 9.66 209 18 ASN A 73 ? ? 50.81 98.78 210 18 LEU A 77 ? ? -123.75 -155.61 211 18 THR A 82 ? ? -66.08 0.65 212 18 LEU A 83 ? ? 59.63 169.84 213 18 ASP A 86 ? ? -66.56 7.59 214 18 SER A 87 ? ? -151.92 17.61 215 19 ALA A 12 ? ? 47.35 -147.63 216 19 TYR A 41 ? ? -118.48 76.10 217 19 ASN A 70 ? ? 54.74 9.92 218 19 ASN A 73 ? ? 49.84 99.65 219 19 LEU A 77 ? ? -124.81 -155.94 220 19 LEU A 80 ? ? -60.15 0.06 221 19 LEU A 83 ? ? 52.56 83.99 222 19 ASP A 86 ? ? -63.48 5.95 223 19 SER A 87 ? ? -153.48 17.37 224 20 HIS A 2 ? ? -153.39 21.69 225 20 MET A 3 ? ? 47.81 84.22 226 20 ALA A 12 ? ? 47.19 -146.60 227 20 GLU A 54 ? ? -65.97 15.46 228 20 SER A 64 ? ? -140.66 -5.50 229 20 ASN A 70 ? ? 55.23 8.40 230 20 ASN A 73 ? ? 49.49 98.60 231 20 LEU A 77 ? ? -123.73 -154.95 232 20 LEU A 80 ? ? -61.38 4.14 233 20 LEU A 83 ? ? 60.54 167.45 234 20 ASP A 86 ? ? -57.96 -5.55 235 20 SER A 87 ? ? -143.77 14.87 236 20 SER A 97 ? ? 54.14 -171.52 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 120 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L52 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L52 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-99% 13C; U-99% 15N] protein, 150 mM sodium chloride, 20 mM sodium phosphate, 0.1 mM EDTA, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM [U-99% 15N] protein, 150 mM sodium chloride, 20 mM sodium phosphate, 0.1 mM EDTA, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id SAMP1-1 1 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium chloride-2' 150 ? mM ? 1 'sodium phosphate-3' 20 ? mM ? 1 EDTA-4 0.1 ? mM ? 1 SAMP1-5 1 ? mM '[U-99% 15N]' 2 'sodium chloride-6' 150 ? mM ? 2 'sodium phosphate-7' 20 ? mM ? 2 EDTA-8 0.1 ? mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N NOESY' 1 2 1 '3D 1H-13C NOESY' 1 3 1 '3D 1H-13C NOESY' 1 4 1 '4D APSY-HACANH' 1 5 1 '5D APSY-CBCACONH' 1 6 1 '5D APSY-HACACONH' 1 7 1 '5D APSY-HC(CC-TOCSY)CONH' 1 8 1 '4D APSY-HCCH-COSY' 1 9 1 '4D aromatic APSY-HCCH-COSY' 1 10 1 '4D APSY-HBCB(CG)CDHD' 1 11 2 '2D 1H-15N HSQC' 1 12 1 '2D 15N{1H}-NOE-[15N,1H]-HSQC' # _pdbx_nmr_refine.entry_id 2L52 _pdbx_nmr_refine.method 'torsion angle dynamics, simulated annealing' _pdbx_nmr_refine.details ;The ensemble of 20 CYANA lowest target function conformers was minimized in AMBER using the rna.ff99 forcefield and generalized born solvent model. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and KOLLMANN' refinement Amber 8 1 'CYANA (Peter Guntert)' 'structure solution' CYANA 3 2 '(Torsten Herrmann)' 'peak picking' UNIO 10 3 '(Torsten Herrmann)' 'structure solution' UNIO 10 4 'Keller and Wuthrich' 'chemical shift assignment' CARA 1.8 5 'Keller and Wuthrich' 'data analysis' CARA 1.8 6 'Sebastian Hiller & Gerhard Wider' 'peak picking' GAPRO 0.9.8 7 'Sebastian Hiller & Gerhard Wider' 'chemical shift assignment' GAPRO 0.9.8 8 'Bruker Biospin' processing TopSpin 2.1 9 'Koradi, Billeter and Wuthrich' 'data analysis' MOLMOL 2.2K 10 'Herrmann and Wuthrich' 'chemical shift assignment' MATCH ? 11 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLU N N N N 88 GLU CA C N S 89 GLU C C N N 90 GLU O O N N 91 GLU CB C N N 92 GLU CG C N N 93 GLU CD C N N 94 GLU OE1 O N N 95 GLU OE2 O N N 96 GLU OXT O N N 97 GLU H H N N 98 GLU H2 H N N 99 GLU HA H N N 100 GLU HB2 H N N 101 GLU HB3 H N N 102 GLU HG2 H N N 103 GLU HG3 H N N 104 GLU HE2 H N N 105 GLU HXT H N N 106 GLY N N N N 107 GLY CA C N N 108 GLY C C N N 109 GLY O O N N 110 GLY OXT O N N 111 GLY H H N N 112 GLY H2 H N N 113 GLY HA2 H N N 114 GLY HA3 H N N 115 GLY HXT H N N 116 HIS N N N N 117 HIS CA C N S 118 HIS C C N N 119 HIS O O N N 120 HIS CB C N N 121 HIS CG C Y N 122 HIS ND1 N Y N 123 HIS CD2 C Y N 124 HIS CE1 C Y N 125 HIS NE2 N Y N 126 HIS OXT O N N 127 HIS H H N N 128 HIS H2 H N N 129 HIS HA H N N 130 HIS HB2 H N N 131 HIS HB3 H N N 132 HIS HD1 H N N 133 HIS HD2 H N N 134 HIS HE1 H N N 135 HIS HE2 H N N 136 HIS HXT H N N 137 ILE N N N N 138 ILE CA C N S 139 ILE C C N N 140 ILE O O N N 141 ILE CB C N S 142 ILE CG1 C N N 143 ILE CG2 C N N 144 ILE CD1 C N N 145 ILE OXT O N N 146 ILE H H N N 147 ILE H2 H N N 148 ILE HA H N N 149 ILE HB H N N 150 ILE HG12 H N N 151 ILE HG13 H N N 152 ILE HG21 H N N 153 ILE HG22 H N N 154 ILE HG23 H N N 155 ILE HD11 H N N 156 ILE HD12 H N N 157 ILE HD13 H N N 158 ILE HXT H N N 159 LEU N N N N 160 LEU CA C N S 161 LEU C C N N 162 LEU O O N N 163 LEU CB C N N 164 LEU CG C N N 165 LEU CD1 C N N 166 LEU CD2 C N N 167 LEU OXT O N N 168 LEU H H N N 169 LEU H2 H N N 170 LEU HA H N N 171 LEU HB2 H N N 172 LEU HB3 H N N 173 LEU HG H N N 174 LEU HD11 H N N 175 LEU HD12 H N N 176 LEU HD13 H N N 177 LEU HD21 H N N 178 LEU HD22 H N N 179 LEU HD23 H N N 180 LEU HXT H N N 181 LYS N N N N 182 LYS CA C N S 183 LYS C C N N 184 LYS O O N N 185 LYS CB C N N 186 LYS CG C N N 187 LYS CD C N N 188 LYS CE C N N 189 LYS NZ N N N 190 LYS OXT O N N 191 LYS H H N N 192 LYS H2 H N N 193 LYS HA H N N 194 LYS HB2 H N N 195 LYS HB3 H N N 196 LYS HG2 H N N 197 LYS HG3 H N N 198 LYS HD2 H N N 199 LYS HD3 H N N 200 LYS HE2 H N N 201 LYS HE3 H N N 202 LYS HZ1 H N N 203 LYS HZ2 H N N 204 LYS HZ3 H N N 205 LYS HXT H N N 206 MET N N N N 207 MET CA C N S 208 MET C C N N 209 MET O O N N 210 MET CB C N N 211 MET CG C N N 212 MET SD S N N 213 MET CE C N N 214 MET OXT O N N 215 MET H H N N 216 MET H2 H N N 217 MET HA H N N 218 MET HB2 H N N 219 MET HB3 H N N 220 MET HG2 H N N 221 MET HG3 H N N 222 MET HE1 H N N 223 MET HE2 H N N 224 MET HE3 H N N 225 MET HXT H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 SER N N N N 267 SER CA C N S 268 SER C C N N 269 SER O O N N 270 SER CB C N N 271 SER OG O N N 272 SER OXT O N N 273 SER H H N N 274 SER H2 H N N 275 SER HA H N N 276 SER HB2 H N N 277 SER HB3 H N N 278 SER HG H N N 279 SER HXT H N N 280 THR N N N N 281 THR CA C N S 282 THR C C N N 283 THR O O N N 284 THR CB C N R 285 THR OG1 O N N 286 THR CG2 C N N 287 THR OXT O N N 288 THR H H N N 289 THR H2 H N N 290 THR HA H N N 291 THR HB H N N 292 THR HG1 H N N 293 THR HG21 H N N 294 THR HG22 H N N 295 THR HG23 H N N 296 THR HXT H N N 297 TYR N N N N 298 TYR CA C N S 299 TYR C C N N 300 TYR O O N N 301 TYR CB C N N 302 TYR CG C Y N 303 TYR CD1 C Y N 304 TYR CD2 C Y N 305 TYR CE1 C Y N 306 TYR CE2 C Y N 307 TYR CZ C Y N 308 TYR OH O N N 309 TYR OXT O N N 310 TYR H H N N 311 TYR H2 H N N 312 TYR HA H N N 313 TYR HB2 H N N 314 TYR HB3 H N N 315 TYR HD1 H N N 316 TYR HD2 H N N 317 TYR HE1 H N N 318 TYR HE2 H N N 319 TYR HH H N N 320 TYR HXT H N N 321 VAL N N N N 322 VAL CA C N S 323 VAL C C N N 324 VAL O O N N 325 VAL CB C N N 326 VAL CG1 C N N 327 VAL CG2 C N N 328 VAL OXT O N N 329 VAL H H N N 330 VAL H2 H N N 331 VAL HA H N N 332 VAL HB H N N 333 VAL HG11 H N N 334 VAL HG12 H N N 335 VAL HG13 H N N 336 VAL HG21 H N N 337 VAL HG22 H N N 338 VAL HG23 H N N 339 VAL HXT H N N 340 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLU N CA sing N N 83 GLU N H sing N N 84 GLU N H2 sing N N 85 GLU CA C sing N N 86 GLU CA CB sing N N 87 GLU CA HA sing N N 88 GLU C O doub N N 89 GLU C OXT sing N N 90 GLU CB CG sing N N 91 GLU CB HB2 sing N N 92 GLU CB HB3 sing N N 93 GLU CG CD sing N N 94 GLU CG HG2 sing N N 95 GLU CG HG3 sing N N 96 GLU CD OE1 doub N N 97 GLU CD OE2 sing N N 98 GLU OE2 HE2 sing N N 99 GLU OXT HXT sing N N 100 GLY N CA sing N N 101 GLY N H sing N N 102 GLY N H2 sing N N 103 GLY CA C sing N N 104 GLY CA HA2 sing N N 105 GLY CA HA3 sing N N 106 GLY C O doub N N 107 GLY C OXT sing N N 108 GLY OXT HXT sing N N 109 HIS N CA sing N N 110 HIS N H sing N N 111 HIS N H2 sing N N 112 HIS CA C sing N N 113 HIS CA CB sing N N 114 HIS CA HA sing N N 115 HIS C O doub N N 116 HIS C OXT sing N N 117 HIS CB CG sing N N 118 HIS CB HB2 sing N N 119 HIS CB HB3 sing N N 120 HIS CG ND1 sing Y N 121 HIS CG CD2 doub Y N 122 HIS ND1 CE1 doub Y N 123 HIS ND1 HD1 sing N N 124 HIS CD2 NE2 sing Y N 125 HIS CD2 HD2 sing N N 126 HIS CE1 NE2 sing Y N 127 HIS CE1 HE1 sing N N 128 HIS NE2 HE2 sing N N 129 HIS OXT HXT sing N N 130 ILE N CA sing N N 131 ILE N H sing N N 132 ILE N H2 sing N N 133 ILE CA C sing N N 134 ILE CA CB sing N N 135 ILE CA HA sing N N 136 ILE C O doub N N 137 ILE C OXT sing N N 138 ILE CB CG1 sing N N 139 ILE CB CG2 sing N N 140 ILE CB HB sing N N 141 ILE CG1 CD1 sing N N 142 ILE CG1 HG12 sing N N 143 ILE CG1 HG13 sing N N 144 ILE CG2 HG21 sing N N 145 ILE CG2 HG22 sing N N 146 ILE CG2 HG23 sing N N 147 ILE CD1 HD11 sing N N 148 ILE CD1 HD12 sing N N 149 ILE CD1 HD13 sing N N 150 ILE OXT HXT sing N N 151 LEU N CA sing N N 152 LEU N H sing N N 153 LEU N H2 sing N N 154 LEU CA C sing N N 155 LEU CA CB sing N N 156 LEU CA HA sing N N 157 LEU C O doub N N 158 LEU C OXT sing N N 159 LEU CB CG sing N N 160 LEU CB HB2 sing N N 161 LEU CB HB3 sing N N 162 LEU CG CD1 sing N N 163 LEU CG CD2 sing N N 164 LEU CG HG sing N N 165 LEU CD1 HD11 sing N N 166 LEU CD1 HD12 sing N N 167 LEU CD1 HD13 sing N N 168 LEU CD2 HD21 sing N N 169 LEU CD2 HD22 sing N N 170 LEU CD2 HD23 sing N N 171 LEU OXT HXT sing N N 172 LYS N CA sing N N 173 LYS N H sing N N 174 LYS N H2 sing N N 175 LYS CA C sing N N 176 LYS CA CB sing N N 177 LYS CA HA sing N N 178 LYS C O doub N N 179 LYS C OXT sing N N 180 LYS CB CG sing N N 181 LYS CB HB2 sing N N 182 LYS CB HB3 sing N N 183 LYS CG CD sing N N 184 LYS CG HG2 sing N N 185 LYS CG HG3 sing N N 186 LYS CD CE sing N N 187 LYS CD HD2 sing N N 188 LYS CD HD3 sing N N 189 LYS CE NZ sing N N 190 LYS CE HE2 sing N N 191 LYS CE HE3 sing N N 192 LYS NZ HZ1 sing N N 193 LYS NZ HZ2 sing N N 194 LYS NZ HZ3 sing N N 195 LYS OXT HXT sing N N 196 MET N CA sing N N 197 MET N H sing N N 198 MET N H2 sing N N 199 MET CA C sing N N 200 MET CA CB sing N N 201 MET CA HA sing N N 202 MET C O doub N N 203 MET C OXT sing N N 204 MET CB CG sing N N 205 MET CB HB2 sing N N 206 MET CB HB3 sing N N 207 MET CG SD sing N N 208 MET CG HG2 sing N N 209 MET CG HG3 sing N N 210 MET SD CE sing N N 211 MET CE HE1 sing N N 212 MET CE HE2 sing N N 213 MET CE HE3 sing N N 214 MET OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TYR N CA sing N N 285 TYR N H sing N N 286 TYR N H2 sing N N 287 TYR CA C sing N N 288 TYR CA CB sing N N 289 TYR CA HA sing N N 290 TYR C O doub N N 291 TYR C OXT sing N N 292 TYR CB CG sing N N 293 TYR CB HB2 sing N N 294 TYR CB HB3 sing N N 295 TYR CG CD1 doub Y N 296 TYR CG CD2 sing Y N 297 TYR CD1 CE1 sing Y N 298 TYR CD1 HD1 sing N N 299 TYR CD2 CE2 doub Y N 300 TYR CD2 HD2 sing N N 301 TYR CE1 CZ doub Y N 302 TYR CE1 HE1 sing N N 303 TYR CE2 CZ sing Y N 304 TYR CE2 HE2 sing N N 305 TYR CZ OH sing N N 306 TYR OH HH sing N N 307 TYR OXT HXT sing N N 308 VAL N CA sing N N 309 VAL N H sing N N 310 VAL N H2 sing N N 311 VAL CA C sing N N 312 VAL CA CB sing N N 313 VAL CA HA sing N N 314 VAL C O doub N N 315 VAL C OXT sing N N 316 VAL CB CG1 sing N N 317 VAL CB CG2 sing N N 318 VAL CB HB sing N N 319 VAL CG1 HG11 sing N N 320 VAL CG1 HG12 sing N N 321 VAL CG1 HG13 sing N N 322 VAL CG2 HG21 sing N N 323 VAL CG2 HG22 sing N N 324 VAL CG2 HG23 sing N N 325 VAL OXT HXT sing N N 326 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 900 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' 500 Bruker AVANCE 3 'Bruker Avance' 700 Bruker AVANCE 4 'Bruker Avance' # _atom_sites.entry_id 2L52 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_