data_2L5U # _entry.id 2L5U # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2L5U pdb_00002l5u 10.2210/pdb2l5u/pdb RCSB RCSB101994 ? ? WWPDB D_1000101994 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-01-19 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_nmr_software 5 3 'Structure model' pdbx_struct_conn_angle 6 3 'Structure model' struct_conn 7 3 'Structure model' struct_ref_seq_dif 8 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.value' 15 3 'Structure model' '_struct_conn.pdbx_dist_value' 16 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 17 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 19 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 20 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 21 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 22 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 23 3 'Structure model' '_struct_ref_seq_dif.details' 24 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 25 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 26 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L5U _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2010-11-08 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 17285 _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mansfield, R.E.' 1 'Kwan, A.H.' 2 'Mackay, J.P.' 3 # _citation.id primary _citation.title 'Plant Homeodomain (PHD) Fingers of CHD4 Are Histone H3-binding Modules with Preference for Unmodified H3K4 and Methylated H3K9' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 286 _citation.page_first 11779 _citation.page_last 11791 _citation.year 2011 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21278251 _citation.pdbx_database_id_DOI 10.1074/jbc.M110.208207 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mansfield, R.E.' 1 ? primary 'Musselman, C.A.' 2 ? primary 'Kwan, A.H.' 3 ? primary 'Oliver, S.S.' 4 ? primary 'Garske, A.L.' 5 ? primary 'Davrazou, F.' 6 ? primary 'Denu, J.M.' 7 ? primary 'Kutateladze, T.G.' 8 ? primary 'Mackay, J.P.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Chromodomain-helicase-DNA-binding protein 4' 6852.672 1 ? ? 'PHD1 domain, UNP residues 365-420' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CHD-4, ATP-dependent helicase CHD4, Mi-2 autoantigen 218 kDa protein, Mi2-beta' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GPLGSYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQ _entity_poly.pdbx_seq_one_letter_code_can GPLGSYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 TYR n 1 7 GLU n 1 8 THR n 1 9 ASP n 1 10 HIS n 1 11 GLN n 1 12 ASP n 1 13 TYR n 1 14 CYS n 1 15 GLU n 1 16 VAL n 1 17 CYS n 1 18 GLN n 1 19 GLN n 1 20 GLY n 1 21 GLY n 1 22 GLU n 1 23 ILE n 1 24 ILE n 1 25 LEU n 1 26 CYS n 1 27 ASP n 1 28 THR n 1 29 CYS n 1 30 PRO n 1 31 ARG n 1 32 ALA n 1 33 TYR n 1 34 HIS n 1 35 MET n 1 36 VAL n 1 37 CYS n 1 38 LEU n 1 39 ASP n 1 40 PRO n 1 41 ASP n 1 42 MET n 1 43 GLU n 1 44 LYS n 1 45 ALA n 1 46 PRO n 1 47 GLU n 1 48 GLY n 1 49 LYS n 1 50 TRP n 1 51 SER n 1 52 CYS n 1 53 PRO n 1 54 HIS n 1 55 CYS n 1 56 GLU n 1 57 LYS n 1 58 GLU n 1 59 GLY n 1 60 ILE n 1 61 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CHD4 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pGEX-6PE _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'pGEX-6PE is an edited version of pGEX-2T which contains an HRV3C protease cleavage site.' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 MET 35 35 35 MET MET A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 CYS 55 55 55 CYS CYS A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 GLN 61 61 61 GLN GLN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 62 62 ZN ZN A . C 2 ZN 1 63 63 ZN ZN A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L5U _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L5U _struct.title 'Structure of the first PHD finger (PHD1) from CHD4 (Mi2b)' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L5U _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'CHD4, Mi2b, Mi2-beta, PHD, PROTEIN BINDING, peptide binding protein, METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CHD4_HUMAN _struct_ref.pdbx_db_accession Q14839 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code YETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQ _struct_ref.pdbx_align_begin 365 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L5U _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 61 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q14839 _struct_ref_seq.db_align_beg 365 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 420 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 6 _struct_ref_seq.pdbx_auth_seq_align_end 61 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2L5U GLY A 1 ? UNP Q14839 ? ? 'expression tag' 1 1 1 2L5U PRO A 2 ? UNP Q14839 ? ? 'expression tag' 2 2 1 2L5U LEU A 3 ? UNP Q14839 ? ? 'expression tag' 3 3 1 2L5U GLY A 4 ? UNP Q14839 ? ? 'expression tag' 4 4 1 2L5U SER A 5 ? UNP Q14839 ? ? 'expression tag' 5 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 HIS A 34 ? ASP A 39 ? HIS A 34 ASP A 39 1 ? 6 HELX_P HELX_P2 2 HIS A 54 ? GLY A 59 ? HIS A 54 GLY A 59 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 14 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 14 A ZN 63 1_555 ? ? ? ? ? ? ? 2.271 ? ? metalc2 metalc ? ? A CYS 17 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 17 A ZN 63 1_555 ? ? ? ? ? ? ? 2.278 ? ? metalc3 metalc ? ? A CYS 26 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 26 A ZN 62 1_555 ? ? ? ? ? ? ? 2.319 ? ? metalc4 metalc ? ? A CYS 29 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 29 A ZN 62 1_555 ? ? ? ? ? ? ? 2.268 ? ? metalc5 metalc ? ? A HIS 34 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 34 A ZN 63 1_555 ? ? ? ? ? ? ? 1.989 ? ? metalc6 metalc ? ? A CYS 37 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 37 A ZN 63 1_555 ? ? ? ? ? ? ? 2.252 ? ? metalc7 metalc ? ? A CYS 52 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 52 A ZN 62 1_555 ? ? ? ? ? ? ? 2.313 ? ? metalc8 metalc ? ? A CYS 55 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 55 A ZN 62 1_555 ? ? ? ? ? ? ? 2.301 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? C ZN . ? A ZN 63 ? 1_555 SG ? A CYS 17 ? A CYS 17 ? 1_555 109.4 ? 2 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? C ZN . ? A ZN 63 ? 1_555 ND1 ? A HIS 34 ? A HIS 34 ? 1_555 107.2 ? 3 SG ? A CYS 17 ? A CYS 17 ? 1_555 ZN ? C ZN . ? A ZN 63 ? 1_555 ND1 ? A HIS 34 ? A HIS 34 ? 1_555 110.1 ? 4 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? C ZN . ? A ZN 63 ? 1_555 SG ? A CYS 37 ? A CYS 37 ? 1_555 111.1 ? 5 SG ? A CYS 17 ? A CYS 17 ? 1_555 ZN ? C ZN . ? A ZN 63 ? 1_555 SG ? A CYS 37 ? A CYS 37 ? 1_555 110.9 ? 6 ND1 ? A HIS 34 ? A HIS 34 ? 1_555 ZN ? C ZN . ? A ZN 63 ? 1_555 SG ? A CYS 37 ? A CYS 37 ? 1_555 107.9 ? 7 SG ? A CYS 26 ? A CYS 26 ? 1_555 ZN ? B ZN . ? A ZN 62 ? 1_555 SG ? A CYS 29 ? A CYS 29 ? 1_555 110.0 ? 8 SG ? A CYS 26 ? A CYS 26 ? 1_555 ZN ? B ZN . ? A ZN 62 ? 1_555 SG ? A CYS 52 ? A CYS 52 ? 1_555 111.8 ? 9 SG ? A CYS 29 ? A CYS 29 ? 1_555 ZN ? B ZN . ? A ZN 62 ? 1_555 SG ? A CYS 52 ? A CYS 52 ? 1_555 108.4 ? 10 SG ? A CYS 26 ? A CYS 26 ? 1_555 ZN ? B ZN . ? A ZN 62 ? 1_555 SG ? A CYS 55 ? A CYS 55 ? 1_555 107.6 ? 11 SG ? A CYS 29 ? A CYS 29 ? 1_555 ZN ? B ZN . ? A ZN 62 ? 1_555 SG ? A CYS 55 ? A CYS 55 ? 1_555 107.7 ? 12 SG ? A CYS 52 ? A CYS 52 ? 1_555 ZN ? B ZN . ? A ZN 62 ? 1_555 SG ? A CYS 55 ? A CYS 55 ? 1_555 111.3 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 24 ? LEU A 25 ? ILE A 24 LEU A 25 A 2 ALA A 32 ? TYR A 33 ? ALA A 32 TYR A 33 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 24 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 24 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 33 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 33 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 62 ? 5 'BINDING SITE FOR RESIDUE ZN A 62' AC2 Software A ZN 63 ? 4 'BINDING SITE FOR RESIDUE ZN A 63' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 CYS A 26 ? CYS A 26 . ? 1_555 ? 2 AC1 5 THR A 28 ? THR A 28 . ? 1_555 ? 3 AC1 5 CYS A 29 ? CYS A 29 . ? 1_555 ? 4 AC1 5 CYS A 52 ? CYS A 52 . ? 1_555 ? 5 AC1 5 CYS A 55 ? CYS A 55 . ? 1_555 ? 6 AC2 4 CYS A 14 ? CYS A 14 . ? 1_555 ? 7 AC2 4 CYS A 17 ? CYS A 17 . ? 1_555 ? 8 AC2 4 HIS A 34 ? HIS A 34 . ? 1_555 ? 9 AC2 4 CYS A 37 ? CYS A 37 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ3 A LYS 44 ? ? OE1 A GLU 47 ? ? 1.57 2 2 HG2 A GLU 15 ? ? HD2 A TYR 33 ? ? 1.30 3 3 HB3 A ASP 39 ? ? HB2 A MET 42 ? ? 1.27 4 3 HG2 A GLU 15 ? ? HD2 A TYR 33 ? ? 1.33 5 4 HH A TYR 33 ? ? HB2 A CYS 52 ? ? 1.31 6 6 HH A TYR 33 ? ? HB2 A CYS 52 ? ? 1.16 7 6 HB3 A HIS 10 ? ? HA A PRO 30 ? ? 1.30 8 8 HB2 A GLU 7 ? ? H A THR 8 ? ? 1.28 9 12 H1 A GLY 1 ? ? OD1 A ASP 27 ? ? 1.54 10 13 HH A TYR 33 ? ? HB2 A CYS 52 ? ? 1.28 11 14 HH A TYR 33 ? ? HB2 A CYS 52 ? ? 1.30 12 14 OE1 A GLU 7 ? ? HD1 A HIS 10 ? ? 1.59 13 16 HE1 A TYR 6 ? ? HA A ASP 9 ? ? 1.29 14 16 OE1 A GLU 7 ? ? HD1 A HIS 10 ? ? 1.59 15 16 HH12 A ARG 31 ? ? OE1 A GLU 58 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 7 ? ? -68.54 -73.33 2 1 PRO A 30 ? ? -78.14 24.63 3 1 ASP A 39 ? ? -172.01 118.94 4 1 ILE A 60 ? ? -90.63 51.27 5 2 PRO A 2 ? ? -76.04 48.10 6 3 SER A 5 ? ? -76.59 45.82 7 3 TYR A 6 ? ? -150.41 -75.09 8 3 THR A 8 ? ? 48.24 -148.20 9 3 GLN A 18 ? ? 63.71 74.72 10 3 GLN A 19 ? ? 78.42 -148.18 11 3 PRO A 30 ? ? -81.49 33.21 12 4 ASP A 39 ? ? -177.56 101.73 13 4 PRO A 40 ? ? -70.52 26.66 14 4 GLU A 43 ? ? -136.50 -95.37 15 4 PRO A 46 ? ? -73.96 45.65 16 4 ILE A 60 ? ? -83.65 33.78 17 5 PRO A 2 ? ? -69.13 96.50 18 5 GLU A 7 ? ? 176.78 -89.70 19 5 PRO A 30 ? ? -77.52 31.82 20 5 ASP A 39 ? ? -165.55 93.41 21 6 GLU A 7 ? ? 64.27 -107.55 22 6 GLU A 22 ? ? -82.76 46.92 23 6 ASP A 39 ? ? -178.60 133.76 24 6 ASP A 41 ? ? -94.32 55.66 25 6 PRO A 46 ? ? -77.76 34.63 26 6 ILE A 60 ? ? -99.25 58.94 27 7 GLU A 7 ? ? -116.20 -84.76 28 7 ASP A 39 ? ? -170.24 98.01 29 7 GLU A 43 ? ? -145.32 -74.76 30 7 GLU A 47 ? ? -90.76 59.51 31 8 TYR A 6 ? ? -102.87 -82.93 32 8 GLU A 7 ? ? -148.35 -100.17 33 9 LEU A 3 ? ? -144.37 -44.77 34 9 GLU A 7 ? ? 69.12 -75.08 35 9 GLN A 19 ? ? -105.66 -165.36 36 10 GLN A 19 ? ? -170.07 118.60 37 10 ASP A 41 ? ? -154.80 56.24 38 10 GLU A 43 ? ? -93.80 55.44 39 11 ASP A 39 ? ? -162.52 108.21 40 11 ASP A 41 ? ? -141.32 -36.45 41 11 GLU A 43 ? ? -141.93 -55.62 42 12 SER A 5 ? ? -85.15 46.42 43 12 TYR A 6 ? ? -170.47 144.62 44 12 GLU A 7 ? ? -107.27 -67.33 45 12 GLN A 19 ? ? -116.63 -74.63 46 12 ASP A 39 ? ? -162.49 106.59 47 13 TYR A 6 ? ? -118.33 -115.09 48 13 PRO A 30 ? ? -79.81 38.69 49 13 ASP A 39 ? ? -176.89 125.11 50 13 GLU A 43 ? ? -136.56 -73.84 51 14 TYR A 6 ? ? -160.94 -45.47 52 14 GLU A 7 ? ? -162.09 -149.93 53 14 ASP A 9 ? ? 64.57 78.67 54 14 GLN A 19 ? ? -102.35 -166.02 55 14 ASP A 41 ? ? -161.04 -30.05 56 14 GLU A 43 ? ? -121.65 -106.63 57 14 GLU A 47 ? ? -93.16 48.13 58 15 GLU A 7 ? ? 70.11 -61.44 59 15 PRO A 30 ? ? -86.18 30.13 60 15 ASP A 39 ? ? -173.27 120.17 61 15 GLU A 43 ? ? -104.40 59.23 62 16 LEU A 3 ? ? -101.51 58.27 63 16 TYR A 6 ? ? -143.20 -38.22 64 16 GLU A 7 ? ? -164.20 -114.77 65 16 ASP A 9 ? ? 67.88 106.07 66 16 HIS A 10 ? ? -121.04 -160.85 67 16 ASP A 12 ? ? -111.23 53.09 68 16 PRO A 46 ? ? -82.61 32.73 69 17 SER A 5 ? ? -83.85 40.40 70 17 GLU A 7 ? ? -126.27 -80.16 71 17 PRO A 30 ? ? -90.75 33.87 72 18 PRO A 2 ? ? -69.44 75.22 73 18 LEU A 3 ? ? -142.07 24.79 74 18 GLU A 7 ? ? -111.52 -77.26 75 18 ASP A 12 ? ? -106.11 46.49 76 19 LEU A 3 ? ? -156.73 -40.81 77 19 GLU A 7 ? ? 77.32 -65.93 78 19 GLN A 19 ? ? -109.49 -96.44 79 19 ASP A 39 ? ? -171.45 135.94 80 19 PRO A 46 ? ? -64.35 83.41 81 20 LEU A 3 ? ? -147.73 -88.45 82 20 GLU A 7 ? ? 34.29 -108.90 83 20 ASP A 9 ? ? 67.25 113.33 84 20 HIS A 10 ? ? -128.88 -154.38 85 20 ASP A 39 ? ? 178.36 123.86 86 20 GLU A 43 ? ? -113.82 53.54 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 1000 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L5U _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L5U _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.7 mM [U-100% 13C; U-100% 15N] CHD4 PHD1-1, 10 mM sodium phosphate-2, 50 mM sodium chloride-3, 1 mM DTT-4, 20 uM DSS-5, 93% H2O/7% D2O ; 1 '93% H2O/7% D2O' '1 mM CHD4 PHD1-6, 10 mM sodium phosphate-7, 50 mM sodium chloride-8, 1 mM DTT-9, 20 uM DSS-10, 93% H2O/7% D2O' 2 '93% H2O/7% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'CHD4 PHD1-1' 0.7 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium phosphate-2' 10 ? mM ? 1 'sodium chloride-3' 50 ? mM ? 1 DTT-4 1 ? mM ? 1 DSS-5 20 ? uM ? 1 'CHD4 PHD1-6' 1 ? mM ? 2 'sodium phosphate-7' 10 ? mM ? 2 'sodium chloride-8' 50 ? mM ? 2 DTT-9 1 ? mM ? 2 DSS-10 20 ? uM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 60 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 2 '2D 1H-1H NOESY' 1 2 1 '2D 1H-15N HSQC' 1 3 1 '2D 1H-13C HSQC' 1 4 1 '3D HNCA' 1 5 1 '3D CBCA(CO)NH' 1 6 1 '3D HNCACB' 1 7 1 '3D HNHA' 1 8 1 '3D HBHA(CO)NH' 1 9 1 '3D HNCO' 1 10 1 '3D HN(CA)CO' 1 11 1 '3D HCCH-TOCSY' 1 12 1 '3D HNHB' 1 13 1 '2D (HB)CB(CGCD)HD' 1 14 1 '2D (HB)CB(CGCDCE)HE' 1 15 1 '3D 1H-15N NOESY' 1 16 2 '2D 1H-1H TOCSY' # _pdbx_nmr_refine.entry_id 2L5U _pdbx_nmr_refine.method 'simulated annealing, molecular dynamics' _pdbx_nmr_refine.details ;Structure calculations were performed using the package ARIA1.2. Final structures are based on 988 NOE-derived distance constraints and 79 additional dihedral angle restraints. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin ? 1 'Bruker Biospin' processing TopSpin ? 2 Goddard 'data analysis' Sparky ? 3 ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 1.2 4 'Cornilescu, Delaglio and Bax' 'dihedral angles from chemical shifts' TALOS ? 5 ;Linge, O'Donoghue and Nilges ; refinement ARIA 1.2 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLU N N N N 91 GLU CA C N S 92 GLU C C N N 93 GLU O O N N 94 GLU CB C N N 95 GLU CG C N N 96 GLU CD C N N 97 GLU OE1 O N N 98 GLU OE2 O N N 99 GLU OXT O N N 100 GLU H H N N 101 GLU H2 H N N 102 GLU HA H N N 103 GLU HB2 H N N 104 GLU HB3 H N N 105 GLU HG2 H N N 106 GLU HG3 H N N 107 GLU HE2 H N N 108 GLU HXT H N N 109 GLY N N N N 110 GLY CA C N N 111 GLY C C N N 112 GLY O O N N 113 GLY OXT O N N 114 GLY H H N N 115 GLY H2 H N N 116 GLY HA2 H N N 117 GLY HA3 H N N 118 GLY HXT H N N 119 HIS N N N N 120 HIS CA C N S 121 HIS C C N N 122 HIS O O N N 123 HIS CB C N N 124 HIS CG C Y N 125 HIS ND1 N Y N 126 HIS CD2 C Y N 127 HIS CE1 C Y N 128 HIS NE2 N Y N 129 HIS OXT O N N 130 HIS H H N N 131 HIS H2 H N N 132 HIS HA H N N 133 HIS HB2 H N N 134 HIS HB3 H N N 135 HIS HD1 H N N 136 HIS HD2 H N N 137 HIS HE1 H N N 138 HIS HE2 H N N 139 HIS HXT H N N 140 ILE N N N N 141 ILE CA C N S 142 ILE C C N N 143 ILE O O N N 144 ILE CB C N S 145 ILE CG1 C N N 146 ILE CG2 C N N 147 ILE CD1 C N N 148 ILE OXT O N N 149 ILE H H N N 150 ILE H2 H N N 151 ILE HA H N N 152 ILE HB H N N 153 ILE HG12 H N N 154 ILE HG13 H N N 155 ILE HG21 H N N 156 ILE HG22 H N N 157 ILE HG23 H N N 158 ILE HD11 H N N 159 ILE HD12 H N N 160 ILE HD13 H N N 161 ILE HXT H N N 162 LEU N N N N 163 LEU CA C N S 164 LEU C C N N 165 LEU O O N N 166 LEU CB C N N 167 LEU CG C N N 168 LEU CD1 C N N 169 LEU CD2 C N N 170 LEU OXT O N N 171 LEU H H N N 172 LEU H2 H N N 173 LEU HA H N N 174 LEU HB2 H N N 175 LEU HB3 H N N 176 LEU HG H N N 177 LEU HD11 H N N 178 LEU HD12 H N N 179 LEU HD13 H N N 180 LEU HD21 H N N 181 LEU HD22 H N N 182 LEU HD23 H N N 183 LEU HXT H N N 184 LYS N N N N 185 LYS CA C N S 186 LYS C C N N 187 LYS O O N N 188 LYS CB C N N 189 LYS CG C N N 190 LYS CD C N N 191 LYS CE C N N 192 LYS NZ N N N 193 LYS OXT O N N 194 LYS H H N N 195 LYS H2 H N N 196 LYS HA H N N 197 LYS HB2 H N N 198 LYS HB3 H N N 199 LYS HG2 H N N 200 LYS HG3 H N N 201 LYS HD2 H N N 202 LYS HD3 H N N 203 LYS HE2 H N N 204 LYS HE3 H N N 205 LYS HZ1 H N N 206 LYS HZ2 H N N 207 LYS HZ3 H N N 208 LYS HXT H N N 209 MET N N N N 210 MET CA C N S 211 MET C C N N 212 MET O O N N 213 MET CB C N N 214 MET CG C N N 215 MET SD S N N 216 MET CE C N N 217 MET OXT O N N 218 MET H H N N 219 MET H2 H N N 220 MET HA H N N 221 MET HB2 H N N 222 MET HB3 H N N 223 MET HG2 H N N 224 MET HG3 H N N 225 MET HE1 H N N 226 MET HE2 H N N 227 MET HE3 H N N 228 MET HXT H N N 229 PRO N N N N 230 PRO CA C N S 231 PRO C C N N 232 PRO O O N N 233 PRO CB C N N 234 PRO CG C N N 235 PRO CD C N N 236 PRO OXT O N N 237 PRO H H N N 238 PRO HA H N N 239 PRO HB2 H N N 240 PRO HB3 H N N 241 PRO HG2 H N N 242 PRO HG3 H N N 243 PRO HD2 H N N 244 PRO HD3 H N N 245 PRO HXT H N N 246 SER N N N N 247 SER CA C N S 248 SER C C N N 249 SER O O N N 250 SER CB C N N 251 SER OG O N N 252 SER OXT O N N 253 SER H H N N 254 SER H2 H N N 255 SER HA H N N 256 SER HB2 H N N 257 SER HB3 H N N 258 SER HG H N N 259 SER HXT H N N 260 THR N N N N 261 THR CA C N S 262 THR C C N N 263 THR O O N N 264 THR CB C N R 265 THR OG1 O N N 266 THR CG2 C N N 267 THR OXT O N N 268 THR H H N N 269 THR H2 H N N 270 THR HA H N N 271 THR HB H N N 272 THR HG1 H N N 273 THR HG21 H N N 274 THR HG22 H N N 275 THR HG23 H N N 276 THR HXT H N N 277 TRP N N N N 278 TRP CA C N S 279 TRP C C N N 280 TRP O O N N 281 TRP CB C N N 282 TRP CG C Y N 283 TRP CD1 C Y N 284 TRP CD2 C Y N 285 TRP NE1 N Y N 286 TRP CE2 C Y N 287 TRP CE3 C Y N 288 TRP CZ2 C Y N 289 TRP CZ3 C Y N 290 TRP CH2 C Y N 291 TRP OXT O N N 292 TRP H H N N 293 TRP H2 H N N 294 TRP HA H N N 295 TRP HB2 H N N 296 TRP HB3 H N N 297 TRP HD1 H N N 298 TRP HE1 H N N 299 TRP HE3 H N N 300 TRP HZ2 H N N 301 TRP HZ3 H N N 302 TRP HH2 H N N 303 TRP HXT H N N 304 TYR N N N N 305 TYR CA C N S 306 TYR C C N N 307 TYR O O N N 308 TYR CB C N N 309 TYR CG C Y N 310 TYR CD1 C Y N 311 TYR CD2 C Y N 312 TYR CE1 C Y N 313 TYR CE2 C Y N 314 TYR CZ C Y N 315 TYR OH O N N 316 TYR OXT O N N 317 TYR H H N N 318 TYR H2 H N N 319 TYR HA H N N 320 TYR HB2 H N N 321 TYR HB3 H N N 322 TYR HD1 H N N 323 TYR HD2 H N N 324 TYR HE1 H N N 325 TYR HE2 H N N 326 TYR HH H N N 327 TYR HXT H N N 328 VAL N N N N 329 VAL CA C N S 330 VAL C C N N 331 VAL O O N N 332 VAL CB C N N 333 VAL CG1 C N N 334 VAL CG2 C N N 335 VAL OXT O N N 336 VAL H H N N 337 VAL H2 H N N 338 VAL HA H N N 339 VAL HB H N N 340 VAL HG11 H N N 341 VAL HG12 H N N 342 VAL HG13 H N N 343 VAL HG21 H N N 344 VAL HG22 H N N 345 VAL HG23 H N N 346 VAL HXT H N N 347 ZN ZN ZN N N 348 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 HIS N CA sing N N 113 HIS N H sing N N 114 HIS N H2 sing N N 115 HIS CA C sing N N 116 HIS CA CB sing N N 117 HIS CA HA sing N N 118 HIS C O doub N N 119 HIS C OXT sing N N 120 HIS CB CG sing N N 121 HIS CB HB2 sing N N 122 HIS CB HB3 sing N N 123 HIS CG ND1 sing Y N 124 HIS CG CD2 doub Y N 125 HIS ND1 CE1 doub Y N 126 HIS ND1 HD1 sing N N 127 HIS CD2 NE2 sing Y N 128 HIS CD2 HD2 sing N N 129 HIS CE1 NE2 sing Y N 130 HIS CE1 HE1 sing N N 131 HIS NE2 HE2 sing N N 132 HIS OXT HXT sing N N 133 ILE N CA sing N N 134 ILE N H sing N N 135 ILE N H2 sing N N 136 ILE CA C sing N N 137 ILE CA CB sing N N 138 ILE CA HA sing N N 139 ILE C O doub N N 140 ILE C OXT sing N N 141 ILE CB CG1 sing N N 142 ILE CB CG2 sing N N 143 ILE CB HB sing N N 144 ILE CG1 CD1 sing N N 145 ILE CG1 HG12 sing N N 146 ILE CG1 HG13 sing N N 147 ILE CG2 HG21 sing N N 148 ILE CG2 HG22 sing N N 149 ILE CG2 HG23 sing N N 150 ILE CD1 HD11 sing N N 151 ILE CD1 HD12 sing N N 152 ILE CD1 HD13 sing N N 153 ILE OXT HXT sing N N 154 LEU N CA sing N N 155 LEU N H sing N N 156 LEU N H2 sing N N 157 LEU CA C sing N N 158 LEU CA CB sing N N 159 LEU CA HA sing N N 160 LEU C O doub N N 161 LEU C OXT sing N N 162 LEU CB CG sing N N 163 LEU CB HB2 sing N N 164 LEU CB HB3 sing N N 165 LEU CG CD1 sing N N 166 LEU CG CD2 sing N N 167 LEU CG HG sing N N 168 LEU CD1 HD11 sing N N 169 LEU CD1 HD12 sing N N 170 LEU CD1 HD13 sing N N 171 LEU CD2 HD21 sing N N 172 LEU CD2 HD22 sing N N 173 LEU CD2 HD23 sing N N 174 LEU OXT HXT sing N N 175 LYS N CA sing N N 176 LYS N H sing N N 177 LYS N H2 sing N N 178 LYS CA C sing N N 179 LYS CA CB sing N N 180 LYS CA HA sing N N 181 LYS C O doub N N 182 LYS C OXT sing N N 183 LYS CB CG sing N N 184 LYS CB HB2 sing N N 185 LYS CB HB3 sing N N 186 LYS CG CD sing N N 187 LYS CG HG2 sing N N 188 LYS CG HG3 sing N N 189 LYS CD CE sing N N 190 LYS CD HD2 sing N N 191 LYS CD HD3 sing N N 192 LYS CE NZ sing N N 193 LYS CE HE2 sing N N 194 LYS CE HE3 sing N N 195 LYS NZ HZ1 sing N N 196 LYS NZ HZ2 sing N N 197 LYS NZ HZ3 sing N N 198 LYS OXT HXT sing N N 199 MET N CA sing N N 200 MET N H sing N N 201 MET N H2 sing N N 202 MET CA C sing N N 203 MET CA CB sing N N 204 MET CA HA sing N N 205 MET C O doub N N 206 MET C OXT sing N N 207 MET CB CG sing N N 208 MET CB HB2 sing N N 209 MET CB HB3 sing N N 210 MET CG SD sing N N 211 MET CG HG2 sing N N 212 MET CG HG3 sing N N 213 MET SD CE sing N N 214 MET CE HE1 sing N N 215 MET CE HE2 sing N N 216 MET CE HE3 sing N N 217 MET OXT HXT sing N N 218 PRO N CA sing N N 219 PRO N CD sing N N 220 PRO N H sing N N 221 PRO CA C sing N N 222 PRO CA CB sing N N 223 PRO CA HA sing N N 224 PRO C O doub N N 225 PRO C OXT sing N N 226 PRO CB CG sing N N 227 PRO CB HB2 sing N N 228 PRO CB HB3 sing N N 229 PRO CG CD sing N N 230 PRO CG HG2 sing N N 231 PRO CG HG3 sing N N 232 PRO CD HD2 sing N N 233 PRO CD HD3 sing N N 234 PRO OXT HXT sing N N 235 SER N CA sing N N 236 SER N H sing N N 237 SER N H2 sing N N 238 SER CA C sing N N 239 SER CA CB sing N N 240 SER CA HA sing N N 241 SER C O doub N N 242 SER C OXT sing N N 243 SER CB OG sing N N 244 SER CB HB2 sing N N 245 SER CB HB3 sing N N 246 SER OG HG sing N N 247 SER OXT HXT sing N N 248 THR N CA sing N N 249 THR N H sing N N 250 THR N H2 sing N N 251 THR CA C sing N N 252 THR CA CB sing N N 253 THR CA HA sing N N 254 THR C O doub N N 255 THR C OXT sing N N 256 THR CB OG1 sing N N 257 THR CB CG2 sing N N 258 THR CB HB sing N N 259 THR OG1 HG1 sing N N 260 THR CG2 HG21 sing N N 261 THR CG2 HG22 sing N N 262 THR CG2 HG23 sing N N 263 THR OXT HXT sing N N 264 TRP N CA sing N N 265 TRP N H sing N N 266 TRP N H2 sing N N 267 TRP CA C sing N N 268 TRP CA CB sing N N 269 TRP CA HA sing N N 270 TRP C O doub N N 271 TRP C OXT sing N N 272 TRP CB CG sing N N 273 TRP CB HB2 sing N N 274 TRP CB HB3 sing N N 275 TRP CG CD1 doub Y N 276 TRP CG CD2 sing Y N 277 TRP CD1 NE1 sing Y N 278 TRP CD1 HD1 sing N N 279 TRP CD2 CE2 doub Y N 280 TRP CD2 CE3 sing Y N 281 TRP NE1 CE2 sing Y N 282 TRP NE1 HE1 sing N N 283 TRP CE2 CZ2 sing Y N 284 TRP CE3 CZ3 doub Y N 285 TRP CE3 HE3 sing N N 286 TRP CZ2 CH2 doub Y N 287 TRP CZ2 HZ2 sing N N 288 TRP CZ3 CH2 sing Y N 289 TRP CZ3 HZ3 sing N N 290 TRP CH2 HH2 sing N N 291 TRP OXT HXT sing N N 292 TYR N CA sing N N 293 TYR N H sing N N 294 TYR N H2 sing N N 295 TYR CA C sing N N 296 TYR CA CB sing N N 297 TYR CA HA sing N N 298 TYR C O doub N N 299 TYR C OXT sing N N 300 TYR CB CG sing N N 301 TYR CB HB2 sing N N 302 TYR CB HB3 sing N N 303 TYR CG CD1 doub Y N 304 TYR CG CD2 sing Y N 305 TYR CD1 CE1 sing Y N 306 TYR CD1 HD1 sing N N 307 TYR CD2 CE2 doub Y N 308 TYR CD2 HD2 sing N N 309 TYR CE1 CZ doub Y N 310 TYR CE1 HE1 sing N N 311 TYR CE2 CZ sing Y N 312 TYR CE2 HE2 sing N N 313 TYR CZ OH sing N N 314 TYR OH HH sing N N 315 TYR OXT HXT sing N N 316 VAL N CA sing N N 317 VAL N H sing N N 318 VAL N H2 sing N N 319 VAL CA C sing N N 320 VAL CA CB sing N N 321 VAL CA HA sing N N 322 VAL C O doub N N 323 VAL C OXT sing N N 324 VAL CB CG1 sing N N 325 VAL CB CG2 sing N N 326 VAL CB HB sing N N 327 VAL CG1 HG11 sing N N 328 VAL CG1 HG12 sing N N 329 VAL CG1 HG13 sing N N 330 VAL CG2 HG21 sing N N 331 VAL CG2 HG22 sing N N 332 VAL CG2 HG23 sing N N 333 VAL OXT HXT sing N N 334 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DRX' # _atom_sites.entry_id 2L5U _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_