data_2L5U
# 
_entry.id   2L5U 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.391 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2L5U         pdb_00002l5u 10.2210/pdb2l5u/pdb 
RCSB  RCSB101994   ?            ?                   
WWPDB D_1000101994 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-01-19 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2024-05-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Data collection'           
3 3 'Structure model' 'Database references'       
4 3 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' chem_comp_atom         
2 3 'Structure model' chem_comp_bond         
3 3 'Structure model' database_2             
4 3 'Structure model' pdbx_nmr_software      
5 3 'Structure model' pdbx_struct_conn_angle 
6 3 'Structure model' struct_conn            
7 3 'Structure model' struct_ref_seq_dif     
8 3 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_database_2.pdbx_DOI'                        
2  3 'Structure model' '_database_2.pdbx_database_accession'         
3  3 'Structure model' '_pdbx_nmr_software.name'                     
4  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
5  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
6  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
7  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
8  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
9  3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
14 3 'Structure model' '_pdbx_struct_conn_angle.value'               
15 3 'Structure model' '_struct_conn.pdbx_dist_value'                
16 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
17 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
18 3 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
19 3 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
20 3 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
21 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
22 3 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
23 3 'Structure model' '_struct_ref_seq_dif.details'                 
24 3 'Structure model' '_struct_site.pdbx_auth_asym_id'              
25 3 'Structure model' '_struct_site.pdbx_auth_comp_id'              
26 3 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2L5U 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2010-11-08 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.db_id          17285 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mansfield, R.E.' 1 
'Kwan, A.H.'      2 
'Mackay, J.P.'    3 
# 
_citation.id                        primary 
_citation.title                     
'Plant Homeodomain (PHD) Fingers of CHD4 Are Histone H3-binding Modules with Preference for Unmodified H3K4 and Methylated H3K9' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            286 
_citation.page_first                11779 
_citation.page_last                 11791 
_citation.year                      2011 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21278251 
_citation.pdbx_database_id_DOI      10.1074/jbc.M110.208207 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Mansfield, R.E.'   1 ? 
primary 'Musselman, C.A.'   2 ? 
primary 'Kwan, A.H.'        3 ? 
primary 'Oliver, S.S.'      4 ? 
primary 'Garske, A.L.'      5 ? 
primary 'Davrazou, F.'      6 ? 
primary 'Denu, J.M.'        7 ? 
primary 'Kutateladze, T.G.' 8 ? 
primary 'Mackay, J.P.'      9 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Chromodomain-helicase-DNA-binding protein 4' 6852.672 1 ? ? 'PHD1 domain, UNP residues 365-420' ? 
2 non-polymer syn 'ZINC ION'                                    65.409   2 ? ? ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'CHD-4, ATP-dependent helicase CHD4, Mi-2 autoantigen 218 kDa protein, Mi2-beta' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GPLGSYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQ 
_entity_poly.pdbx_seq_one_letter_code_can   GPLGSYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQ 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'ZINC ION' 
_pdbx_entity_nonpoly.comp_id     ZN 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  PRO n 
1 3  LEU n 
1 4  GLY n 
1 5  SER n 
1 6  TYR n 
1 7  GLU n 
1 8  THR n 
1 9  ASP n 
1 10 HIS n 
1 11 GLN n 
1 12 ASP n 
1 13 TYR n 
1 14 CYS n 
1 15 GLU n 
1 16 VAL n 
1 17 CYS n 
1 18 GLN n 
1 19 GLN n 
1 20 GLY n 
1 21 GLY n 
1 22 GLU n 
1 23 ILE n 
1 24 ILE n 
1 25 LEU n 
1 26 CYS n 
1 27 ASP n 
1 28 THR n 
1 29 CYS n 
1 30 PRO n 
1 31 ARG n 
1 32 ALA n 
1 33 TYR n 
1 34 HIS n 
1 35 MET n 
1 36 VAL n 
1 37 CYS n 
1 38 LEU n 
1 39 ASP n 
1 40 PRO n 
1 41 ASP n 
1 42 MET n 
1 43 GLU n 
1 44 LYS n 
1 45 ALA n 
1 46 PRO n 
1 47 GLU n 
1 48 GLY n 
1 49 LYS n 
1 50 TRP n 
1 51 SER n 
1 52 CYS n 
1 53 PRO n 
1 54 HIS n 
1 55 CYS n 
1 56 GLU n 
1 57 LYS n 
1 58 GLU n 
1 59 GLY n 
1 60 ILE n 
1 61 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 CHD4 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pGEX-6PE 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   
'pGEX-6PE is an edited version of pGEX-2T which contains an HRV3C protease cleavage site.' 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  1  1  GLY GLY A . n 
A 1 2  PRO 2  2  2  PRO PRO A . n 
A 1 3  LEU 3  3  3  LEU LEU A . n 
A 1 4  GLY 4  4  4  GLY GLY A . n 
A 1 5  SER 5  5  5  SER SER A . n 
A 1 6  TYR 6  6  6  TYR TYR A . n 
A 1 7  GLU 7  7  7  GLU GLU A . n 
A 1 8  THR 8  8  8  THR THR A . n 
A 1 9  ASP 9  9  9  ASP ASP A . n 
A 1 10 HIS 10 10 10 HIS HIS A . n 
A 1 11 GLN 11 11 11 GLN GLN A . n 
A 1 12 ASP 12 12 12 ASP ASP A . n 
A 1 13 TYR 13 13 13 TYR TYR A . n 
A 1 14 CYS 14 14 14 CYS CYS A . n 
A 1 15 GLU 15 15 15 GLU GLU A . n 
A 1 16 VAL 16 16 16 VAL VAL A . n 
A 1 17 CYS 17 17 17 CYS CYS A . n 
A 1 18 GLN 18 18 18 GLN GLN A . n 
A 1 19 GLN 19 19 19 GLN GLN A . n 
A 1 20 GLY 20 20 20 GLY GLY A . n 
A 1 21 GLY 21 21 21 GLY GLY A . n 
A 1 22 GLU 22 22 22 GLU GLU A . n 
A 1 23 ILE 23 23 23 ILE ILE A . n 
A 1 24 ILE 24 24 24 ILE ILE A . n 
A 1 25 LEU 25 25 25 LEU LEU A . n 
A 1 26 CYS 26 26 26 CYS CYS A . n 
A 1 27 ASP 27 27 27 ASP ASP A . n 
A 1 28 THR 28 28 28 THR THR A . n 
A 1 29 CYS 29 29 29 CYS CYS A . n 
A 1 30 PRO 30 30 30 PRO PRO A . n 
A 1 31 ARG 31 31 31 ARG ARG A . n 
A 1 32 ALA 32 32 32 ALA ALA A . n 
A 1 33 TYR 33 33 33 TYR TYR A . n 
A 1 34 HIS 34 34 34 HIS HIS A . n 
A 1 35 MET 35 35 35 MET MET A . n 
A 1 36 VAL 36 36 36 VAL VAL A . n 
A 1 37 CYS 37 37 37 CYS CYS A . n 
A 1 38 LEU 38 38 38 LEU LEU A . n 
A 1 39 ASP 39 39 39 ASP ASP A . n 
A 1 40 PRO 40 40 40 PRO PRO A . n 
A 1 41 ASP 41 41 41 ASP ASP A . n 
A 1 42 MET 42 42 42 MET MET A . n 
A 1 43 GLU 43 43 43 GLU GLU A . n 
A 1 44 LYS 44 44 44 LYS LYS A . n 
A 1 45 ALA 45 45 45 ALA ALA A . n 
A 1 46 PRO 46 46 46 PRO PRO A . n 
A 1 47 GLU 47 47 47 GLU GLU A . n 
A 1 48 GLY 48 48 48 GLY GLY A . n 
A 1 49 LYS 49 49 49 LYS LYS A . n 
A 1 50 TRP 50 50 50 TRP TRP A . n 
A 1 51 SER 51 51 51 SER SER A . n 
A 1 52 CYS 52 52 52 CYS CYS A . n 
A 1 53 PRO 53 53 53 PRO PRO A . n 
A 1 54 HIS 54 54 54 HIS HIS A . n 
A 1 55 CYS 55 55 55 CYS CYS A . n 
A 1 56 GLU 56 56 56 GLU GLU A . n 
A 1 57 LYS 57 57 57 LYS LYS A . n 
A 1 58 GLU 58 58 58 GLU GLU A . n 
A 1 59 GLY 59 59 59 GLY GLY A . n 
A 1 60 ILE 60 60 60 ILE ILE A . n 
A 1 61 GLN 61 61 61 GLN GLN A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN 1 62 62 ZN ZN A . 
C 2 ZN 1 63 63 ZN ZN A . 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2L5U 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2L5U 
_struct.title                     'Structure of the first PHD finger (PHD1) from CHD4 (Mi2b)' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2L5U 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            'CHD4, Mi2b, Mi2-beta, PHD, PROTEIN BINDING, peptide binding protein, METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CHD4_HUMAN 
_struct_ref.pdbx_db_accession          Q14839 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   YETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQ 
_struct_ref.pdbx_align_begin           365 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2L5U 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 6 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 61 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q14839 
_struct_ref_seq.db_align_beg                  365 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  420 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       6 
_struct_ref_seq.pdbx_auth_seq_align_end       61 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2L5U GLY A 1 ? UNP Q14839 ? ? 'expression tag' 1 1 
1 2L5U PRO A 2 ? UNP Q14839 ? ? 'expression tag' 2 2 
1 2L5U LEU A 3 ? UNP Q14839 ? ? 'expression tag' 3 3 
1 2L5U GLY A 4 ? UNP Q14839 ? ? 'expression tag' 4 4 
1 2L5U SER A 5 ? UNP Q14839 ? ? 'expression tag' 5 5 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 HIS A 34 ? ASP A 39 ? HIS A 34 ASP A 39 1 ? 6 
HELX_P HELX_P2 2 HIS A 54 ? GLY A 59 ? HIS A 54 GLY A 59 5 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A CYS 14 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 14 A ZN 63 1_555 ? ? ? ? ? ? ? 2.271 ? ? 
metalc2 metalc ? ? A CYS 17 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 17 A ZN 63 1_555 ? ? ? ? ? ? ? 2.278 ? ? 
metalc3 metalc ? ? A CYS 26 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 26 A ZN 62 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc4 metalc ? ? A CYS 29 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 29 A ZN 62 1_555 ? ? ? ? ? ? ? 2.268 ? ? 
metalc5 metalc ? ? A HIS 34 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 34 A ZN 63 1_555 ? ? ? ? ? ? ? 1.989 ? ? 
metalc6 metalc ? ? A CYS 37 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 37 A ZN 63 1_555 ? ? ? ? ? ? ? 2.252 ? ? 
metalc7 metalc ? ? A CYS 52 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 52 A ZN 62 1_555 ? ? ? ? ? ? ? 2.313 ? ? 
metalc8 metalc ? ? A CYS 55 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 55 A ZN 62 1_555 ? ? ? ? ? ? ? 2.301 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? C ZN . ? A ZN 63 ? 1_555 SG  ? A CYS 17 ? A CYS 17 ? 1_555 109.4 ? 
2  SG  ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? C ZN . ? A ZN 63 ? 1_555 ND1 ? A HIS 34 ? A HIS 34 ? 1_555 107.2 ? 
3  SG  ? A CYS 17 ? A CYS 17 ? 1_555 ZN ? C ZN . ? A ZN 63 ? 1_555 ND1 ? A HIS 34 ? A HIS 34 ? 1_555 110.1 ? 
4  SG  ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? C ZN . ? A ZN 63 ? 1_555 SG  ? A CYS 37 ? A CYS 37 ? 1_555 111.1 ? 
5  SG  ? A CYS 17 ? A CYS 17 ? 1_555 ZN ? C ZN . ? A ZN 63 ? 1_555 SG  ? A CYS 37 ? A CYS 37 ? 1_555 110.9 ? 
6  ND1 ? A HIS 34 ? A HIS 34 ? 1_555 ZN ? C ZN . ? A ZN 63 ? 1_555 SG  ? A CYS 37 ? A CYS 37 ? 1_555 107.9 ? 
7  SG  ? A CYS 26 ? A CYS 26 ? 1_555 ZN ? B ZN . ? A ZN 62 ? 1_555 SG  ? A CYS 29 ? A CYS 29 ? 1_555 110.0 ? 
8  SG  ? A CYS 26 ? A CYS 26 ? 1_555 ZN ? B ZN . ? A ZN 62 ? 1_555 SG  ? A CYS 52 ? A CYS 52 ? 1_555 111.8 ? 
9  SG  ? A CYS 29 ? A CYS 29 ? 1_555 ZN ? B ZN . ? A ZN 62 ? 1_555 SG  ? A CYS 52 ? A CYS 52 ? 1_555 108.4 ? 
10 SG  ? A CYS 26 ? A CYS 26 ? 1_555 ZN ? B ZN . ? A ZN 62 ? 1_555 SG  ? A CYS 55 ? A CYS 55 ? 1_555 107.6 ? 
11 SG  ? A CYS 29 ? A CYS 29 ? 1_555 ZN ? B ZN . ? A ZN 62 ? 1_555 SG  ? A CYS 55 ? A CYS 55 ? 1_555 107.7 ? 
12 SG  ? A CYS 52 ? A CYS 52 ? 1_555 ZN ? B ZN . ? A ZN 62 ? 1_555 SG  ? A CYS 55 ? A CYS 55 ? 1_555 111.3 ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 24 ? LEU A 25 ? ILE A 24 LEU A 25 
A 2 ALA A 32 ? TYR A 33 ? ALA A 32 TYR A 33 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ILE 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    24 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ILE 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     24 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   TYR 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    33 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    TYR 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     33 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 62 ? 5 'BINDING SITE FOR RESIDUE ZN A 62' 
AC2 Software A ZN 63 ? 4 'BINDING SITE FOR RESIDUE ZN A 63' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 5 CYS A 26 ? CYS A 26 . ? 1_555 ? 
2 AC1 5 THR A 28 ? THR A 28 . ? 1_555 ? 
3 AC1 5 CYS A 29 ? CYS A 29 . ? 1_555 ? 
4 AC1 5 CYS A 52 ? CYS A 52 . ? 1_555 ? 
5 AC1 5 CYS A 55 ? CYS A 55 . ? 1_555 ? 
6 AC2 4 CYS A 14 ? CYS A 14 . ? 1_555 ? 
7 AC2 4 CYS A 17 ? CYS A 17 . ? 1_555 ? 
8 AC2 4 HIS A 34 ? HIS A 34 . ? 1_555 ? 
9 AC2 4 CYS A 37 ? CYS A 37 . ? 1_555 ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1  HZ3  A LYS 44 ? ? OE1 A GLU 47 ? ? 1.57 
2  2  HG2  A GLU 15 ? ? HD2 A TYR 33 ? ? 1.30 
3  3  HB3  A ASP 39 ? ? HB2 A MET 42 ? ? 1.27 
4  3  HG2  A GLU 15 ? ? HD2 A TYR 33 ? ? 1.33 
5  4  HH   A TYR 33 ? ? HB2 A CYS 52 ? ? 1.31 
6  6  HH   A TYR 33 ? ? HB2 A CYS 52 ? ? 1.16 
7  6  HB3  A HIS 10 ? ? HA  A PRO 30 ? ? 1.30 
8  8  HB2  A GLU 7  ? ? H   A THR 8  ? ? 1.28 
9  12 H1   A GLY 1  ? ? OD1 A ASP 27 ? ? 1.54 
10 13 HH   A TYR 33 ? ? HB2 A CYS 52 ? ? 1.28 
11 14 HH   A TYR 33 ? ? HB2 A CYS 52 ? ? 1.30 
12 14 OE1  A GLU 7  ? ? HD1 A HIS 10 ? ? 1.59 
13 16 HE1  A TYR 6  ? ? HA  A ASP 9  ? ? 1.29 
14 16 OE1  A GLU 7  ? ? HD1 A HIS 10 ? ? 1.59 
15 16 HH12 A ARG 31 ? ? OE1 A GLU 58 ? ? 1.59 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  GLU A 7  ? ? -68.54  -73.33  
2  1  PRO A 30 ? ? -78.14  24.63   
3  1  ASP A 39 ? ? -172.01 118.94  
4  1  ILE A 60 ? ? -90.63  51.27   
5  2  PRO A 2  ? ? -76.04  48.10   
6  3  SER A 5  ? ? -76.59  45.82   
7  3  TYR A 6  ? ? -150.41 -75.09  
8  3  THR A 8  ? ? 48.24   -148.20 
9  3  GLN A 18 ? ? 63.71   74.72   
10 3  GLN A 19 ? ? 78.42   -148.18 
11 3  PRO A 30 ? ? -81.49  33.21   
12 4  ASP A 39 ? ? -177.56 101.73  
13 4  PRO A 40 ? ? -70.52  26.66   
14 4  GLU A 43 ? ? -136.50 -95.37  
15 4  PRO A 46 ? ? -73.96  45.65   
16 4  ILE A 60 ? ? -83.65  33.78   
17 5  PRO A 2  ? ? -69.13  96.50   
18 5  GLU A 7  ? ? 176.78  -89.70  
19 5  PRO A 30 ? ? -77.52  31.82   
20 5  ASP A 39 ? ? -165.55 93.41   
21 6  GLU A 7  ? ? 64.27   -107.55 
22 6  GLU A 22 ? ? -82.76  46.92   
23 6  ASP A 39 ? ? -178.60 133.76  
24 6  ASP A 41 ? ? -94.32  55.66   
25 6  PRO A 46 ? ? -77.76  34.63   
26 6  ILE A 60 ? ? -99.25  58.94   
27 7  GLU A 7  ? ? -116.20 -84.76  
28 7  ASP A 39 ? ? -170.24 98.01   
29 7  GLU A 43 ? ? -145.32 -74.76  
30 7  GLU A 47 ? ? -90.76  59.51   
31 8  TYR A 6  ? ? -102.87 -82.93  
32 8  GLU A 7  ? ? -148.35 -100.17 
33 9  LEU A 3  ? ? -144.37 -44.77  
34 9  GLU A 7  ? ? 69.12   -75.08  
35 9  GLN A 19 ? ? -105.66 -165.36 
36 10 GLN A 19 ? ? -170.07 118.60  
37 10 ASP A 41 ? ? -154.80 56.24   
38 10 GLU A 43 ? ? -93.80  55.44   
39 11 ASP A 39 ? ? -162.52 108.21  
40 11 ASP A 41 ? ? -141.32 -36.45  
41 11 GLU A 43 ? ? -141.93 -55.62  
42 12 SER A 5  ? ? -85.15  46.42   
43 12 TYR A 6  ? ? -170.47 144.62  
44 12 GLU A 7  ? ? -107.27 -67.33  
45 12 GLN A 19 ? ? -116.63 -74.63  
46 12 ASP A 39 ? ? -162.49 106.59  
47 13 TYR A 6  ? ? -118.33 -115.09 
48 13 PRO A 30 ? ? -79.81  38.69   
49 13 ASP A 39 ? ? -176.89 125.11  
50 13 GLU A 43 ? ? -136.56 -73.84  
51 14 TYR A 6  ? ? -160.94 -45.47  
52 14 GLU A 7  ? ? -162.09 -149.93 
53 14 ASP A 9  ? ? 64.57   78.67   
54 14 GLN A 19 ? ? -102.35 -166.02 
55 14 ASP A 41 ? ? -161.04 -30.05  
56 14 GLU A 43 ? ? -121.65 -106.63 
57 14 GLU A 47 ? ? -93.16  48.13   
58 15 GLU A 7  ? ? 70.11   -61.44  
59 15 PRO A 30 ? ? -86.18  30.13   
60 15 ASP A 39 ? ? -173.27 120.17  
61 15 GLU A 43 ? ? -104.40 59.23   
62 16 LEU A 3  ? ? -101.51 58.27   
63 16 TYR A 6  ? ? -143.20 -38.22  
64 16 GLU A 7  ? ? -164.20 -114.77 
65 16 ASP A 9  ? ? 67.88   106.07  
66 16 HIS A 10 ? ? -121.04 -160.85 
67 16 ASP A 12 ? ? -111.23 53.09   
68 16 PRO A 46 ? ? -82.61  32.73   
69 17 SER A 5  ? ? -83.85  40.40   
70 17 GLU A 7  ? ? -126.27 -80.16  
71 17 PRO A 30 ? ? -90.75  33.87   
72 18 PRO A 2  ? ? -69.44  75.22   
73 18 LEU A 3  ? ? -142.07 24.79   
74 18 GLU A 7  ? ? -111.52 -77.26  
75 18 ASP A 12 ? ? -106.11 46.49   
76 19 LEU A 3  ? ? -156.73 -40.81  
77 19 GLU A 7  ? ? 77.32   -65.93  
78 19 GLN A 19 ? ? -109.49 -96.44  
79 19 ASP A 39 ? ? -171.45 135.94  
80 19 PRO A 46 ? ? -64.35  83.41   
81 20 LEU A 3  ? ? -147.73 -88.45  
82 20 GLU A 7  ? ? 34.29   -108.90 
83 20 ASP A 9  ? ? 67.25   113.33  
84 20 HIS A 10 ? ? -128.88 -154.38 
85 20 ASP A 39 ? ? 178.36  123.86  
86 20 GLU A 43 ? ? -113.82 53.54   
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            1000 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2L5U 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2L5U 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
;0.7 mM [U-100% 13C; U-100% 15N] CHD4 PHD1-1, 10 mM sodium phosphate-2, 50 mM sodium chloride-3, 1 mM DTT-4, 20 uM DSS-5, 93% H2O/7% D2O
;
1 '93% H2O/7% D2O' 
'1 mM CHD4 PHD1-6, 10 mM sodium phosphate-7, 50 mM sodium chloride-8, 1 mM DTT-9, 20 uM DSS-10, 93% H2O/7% D2O' 2 '93% H2O/7% D2O' 
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
'CHD4 PHD1-1'        0.7 ? mM '[U-100% 13C; U-100% 15N]' 1 
'sodium phosphate-2' 10  ? mM ?                          1 
'sodium chloride-3'  50  ? mM ?                          1 
DTT-4                1   ? mM ?                          1 
DSS-5                20  ? uM ?                          1 
'CHD4 PHD1-6'        1   ? mM ?                          2 
'sodium phosphate-7' 10  ? mM ?                          2 
'sodium chloride-8'  50  ? mM ?                          2 
DTT-9                1   ? mM ?                          2 
DSS-10               20  ? uM ?                          2 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      60 
_pdbx_nmr_exptl_sample_conditions.pH                  7.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  2 '2D 1H-1H NOESY'      
1 2  1 '2D 1H-15N HSQC'      
1 3  1 '2D 1H-13C HSQC'      
1 4  1 '3D HNCA'             
1 5  1 '3D CBCA(CO)NH'       
1 6  1 '3D HNCACB'           
1 7  1 '3D HNHA'             
1 8  1 '3D HBHA(CO)NH'       
1 9  1 '3D HNCO'             
1 10 1 '3D HN(CA)CO'         
1 11 1 '3D HCCH-TOCSY'       
1 12 1 '3D HNHB'             
1 13 1 '2D (HB)CB(CGCD)HD'   
1 14 1 '2D (HB)CB(CGCDCE)HE' 
1 15 1 '3D 1H-15N NOESY'     
1 16 2 '2D 1H-1H TOCSY'      
# 
_pdbx_nmr_refine.entry_id           2L5U 
_pdbx_nmr_refine.method             'simulated annealing, molecular dynamics' 
_pdbx_nmr_refine.details            
;Structure calculations were performed using the package ARIA1.2. Final structures are based on 988 NOE-derived distance constraints and 79 additional dihedral angle restraints.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Bruker Biospin'               collection                             TopSpin ?   1 
'Bruker Biospin'               processing                             TopSpin ?   2 
Goddard                        'data analysis'                        Sparky  ?   3 
;Linge, O'Donoghue and Nilges
;
'structure solution'                   ARIA    1.2 4 
'Cornilescu, Delaglio and Bax' 'dihedral angles from chemical shifts' TALOS   ?   5 
;Linge, O'Donoghue and Nilges
;
refinement                             ARIA    1.2 6 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASP N    N  N N 41  
ASP CA   C  N S 42  
ASP C    C  N N 43  
ASP O    O  N N 44  
ASP CB   C  N N 45  
ASP CG   C  N N 46  
ASP OD1  O  N N 47  
ASP OD2  O  N N 48  
ASP OXT  O  N N 49  
ASP H    H  N N 50  
ASP H2   H  N N 51  
ASP HA   H  N N 52  
ASP HB2  H  N N 53  
ASP HB3  H  N N 54  
ASP HD2  H  N N 55  
ASP HXT  H  N N 56  
CYS N    N  N N 57  
CYS CA   C  N R 58  
CYS C    C  N N 59  
CYS O    O  N N 60  
CYS CB   C  N N 61  
CYS SG   S  N N 62  
CYS OXT  O  N N 63  
CYS H    H  N N 64  
CYS H2   H  N N 65  
CYS HA   H  N N 66  
CYS HB2  H  N N 67  
CYS HB3  H  N N 68  
CYS HG   H  N N 69  
CYS HXT  H  N N 70  
GLN N    N  N N 71  
GLN CA   C  N S 72  
GLN C    C  N N 73  
GLN O    O  N N 74  
GLN CB   C  N N 75  
GLN CG   C  N N 76  
GLN CD   C  N N 77  
GLN OE1  O  N N 78  
GLN NE2  N  N N 79  
GLN OXT  O  N N 80  
GLN H    H  N N 81  
GLN H2   H  N N 82  
GLN HA   H  N N 83  
GLN HB2  H  N N 84  
GLN HB3  H  N N 85  
GLN HG2  H  N N 86  
GLN HG3  H  N N 87  
GLN HE21 H  N N 88  
GLN HE22 H  N N 89  
GLN HXT  H  N N 90  
GLU N    N  N N 91  
GLU CA   C  N S 92  
GLU C    C  N N 93  
GLU O    O  N N 94  
GLU CB   C  N N 95  
GLU CG   C  N N 96  
GLU CD   C  N N 97  
GLU OE1  O  N N 98  
GLU OE2  O  N N 99  
GLU OXT  O  N N 100 
GLU H    H  N N 101 
GLU H2   H  N N 102 
GLU HA   H  N N 103 
GLU HB2  H  N N 104 
GLU HB3  H  N N 105 
GLU HG2  H  N N 106 
GLU HG3  H  N N 107 
GLU HE2  H  N N 108 
GLU HXT  H  N N 109 
GLY N    N  N N 110 
GLY CA   C  N N 111 
GLY C    C  N N 112 
GLY O    O  N N 113 
GLY OXT  O  N N 114 
GLY H    H  N N 115 
GLY H2   H  N N 116 
GLY HA2  H  N N 117 
GLY HA3  H  N N 118 
GLY HXT  H  N N 119 
HIS N    N  N N 120 
HIS CA   C  N S 121 
HIS C    C  N N 122 
HIS O    O  N N 123 
HIS CB   C  N N 124 
HIS CG   C  Y N 125 
HIS ND1  N  Y N 126 
HIS CD2  C  Y N 127 
HIS CE1  C  Y N 128 
HIS NE2  N  Y N 129 
HIS OXT  O  N N 130 
HIS H    H  N N 131 
HIS H2   H  N N 132 
HIS HA   H  N N 133 
HIS HB2  H  N N 134 
HIS HB3  H  N N 135 
HIS HD1  H  N N 136 
HIS HD2  H  N N 137 
HIS HE1  H  N N 138 
HIS HE2  H  N N 139 
HIS HXT  H  N N 140 
ILE N    N  N N 141 
ILE CA   C  N S 142 
ILE C    C  N N 143 
ILE O    O  N N 144 
ILE CB   C  N S 145 
ILE CG1  C  N N 146 
ILE CG2  C  N N 147 
ILE CD1  C  N N 148 
ILE OXT  O  N N 149 
ILE H    H  N N 150 
ILE H2   H  N N 151 
ILE HA   H  N N 152 
ILE HB   H  N N 153 
ILE HG12 H  N N 154 
ILE HG13 H  N N 155 
ILE HG21 H  N N 156 
ILE HG22 H  N N 157 
ILE HG23 H  N N 158 
ILE HD11 H  N N 159 
ILE HD12 H  N N 160 
ILE HD13 H  N N 161 
ILE HXT  H  N N 162 
LEU N    N  N N 163 
LEU CA   C  N S 164 
LEU C    C  N N 165 
LEU O    O  N N 166 
LEU CB   C  N N 167 
LEU CG   C  N N 168 
LEU CD1  C  N N 169 
LEU CD2  C  N N 170 
LEU OXT  O  N N 171 
LEU H    H  N N 172 
LEU H2   H  N N 173 
LEU HA   H  N N 174 
LEU HB2  H  N N 175 
LEU HB3  H  N N 176 
LEU HG   H  N N 177 
LEU HD11 H  N N 178 
LEU HD12 H  N N 179 
LEU HD13 H  N N 180 
LEU HD21 H  N N 181 
LEU HD22 H  N N 182 
LEU HD23 H  N N 183 
LEU HXT  H  N N 184 
LYS N    N  N N 185 
LYS CA   C  N S 186 
LYS C    C  N N 187 
LYS O    O  N N 188 
LYS CB   C  N N 189 
LYS CG   C  N N 190 
LYS CD   C  N N 191 
LYS CE   C  N N 192 
LYS NZ   N  N N 193 
LYS OXT  O  N N 194 
LYS H    H  N N 195 
LYS H2   H  N N 196 
LYS HA   H  N N 197 
LYS HB2  H  N N 198 
LYS HB3  H  N N 199 
LYS HG2  H  N N 200 
LYS HG3  H  N N 201 
LYS HD2  H  N N 202 
LYS HD3  H  N N 203 
LYS HE2  H  N N 204 
LYS HE3  H  N N 205 
LYS HZ1  H  N N 206 
LYS HZ2  H  N N 207 
LYS HZ3  H  N N 208 
LYS HXT  H  N N 209 
MET N    N  N N 210 
MET CA   C  N S 211 
MET C    C  N N 212 
MET O    O  N N 213 
MET CB   C  N N 214 
MET CG   C  N N 215 
MET SD   S  N N 216 
MET CE   C  N N 217 
MET OXT  O  N N 218 
MET H    H  N N 219 
MET H2   H  N N 220 
MET HA   H  N N 221 
MET HB2  H  N N 222 
MET HB3  H  N N 223 
MET HG2  H  N N 224 
MET HG3  H  N N 225 
MET HE1  H  N N 226 
MET HE2  H  N N 227 
MET HE3  H  N N 228 
MET HXT  H  N N 229 
PRO N    N  N N 230 
PRO CA   C  N S 231 
PRO C    C  N N 232 
PRO O    O  N N 233 
PRO CB   C  N N 234 
PRO CG   C  N N 235 
PRO CD   C  N N 236 
PRO OXT  O  N N 237 
PRO H    H  N N 238 
PRO HA   H  N N 239 
PRO HB2  H  N N 240 
PRO HB3  H  N N 241 
PRO HG2  H  N N 242 
PRO HG3  H  N N 243 
PRO HD2  H  N N 244 
PRO HD3  H  N N 245 
PRO HXT  H  N N 246 
SER N    N  N N 247 
SER CA   C  N S 248 
SER C    C  N N 249 
SER O    O  N N 250 
SER CB   C  N N 251 
SER OG   O  N N 252 
SER OXT  O  N N 253 
SER H    H  N N 254 
SER H2   H  N N 255 
SER HA   H  N N 256 
SER HB2  H  N N 257 
SER HB3  H  N N 258 
SER HG   H  N N 259 
SER HXT  H  N N 260 
THR N    N  N N 261 
THR CA   C  N S 262 
THR C    C  N N 263 
THR O    O  N N 264 
THR CB   C  N R 265 
THR OG1  O  N N 266 
THR CG2  C  N N 267 
THR OXT  O  N N 268 
THR H    H  N N 269 
THR H2   H  N N 270 
THR HA   H  N N 271 
THR HB   H  N N 272 
THR HG1  H  N N 273 
THR HG21 H  N N 274 
THR HG22 H  N N 275 
THR HG23 H  N N 276 
THR HXT  H  N N 277 
TRP N    N  N N 278 
TRP CA   C  N S 279 
TRP C    C  N N 280 
TRP O    O  N N 281 
TRP CB   C  N N 282 
TRP CG   C  Y N 283 
TRP CD1  C  Y N 284 
TRP CD2  C  Y N 285 
TRP NE1  N  Y N 286 
TRP CE2  C  Y N 287 
TRP CE3  C  Y N 288 
TRP CZ2  C  Y N 289 
TRP CZ3  C  Y N 290 
TRP CH2  C  Y N 291 
TRP OXT  O  N N 292 
TRP H    H  N N 293 
TRP H2   H  N N 294 
TRP HA   H  N N 295 
TRP HB2  H  N N 296 
TRP HB3  H  N N 297 
TRP HD1  H  N N 298 
TRP HE1  H  N N 299 
TRP HE3  H  N N 300 
TRP HZ2  H  N N 301 
TRP HZ3  H  N N 302 
TRP HH2  H  N N 303 
TRP HXT  H  N N 304 
TYR N    N  N N 305 
TYR CA   C  N S 306 
TYR C    C  N N 307 
TYR O    O  N N 308 
TYR CB   C  N N 309 
TYR CG   C  Y N 310 
TYR CD1  C  Y N 311 
TYR CD2  C  Y N 312 
TYR CE1  C  Y N 313 
TYR CE2  C  Y N 314 
TYR CZ   C  Y N 315 
TYR OH   O  N N 316 
TYR OXT  O  N N 317 
TYR H    H  N N 318 
TYR H2   H  N N 319 
TYR HA   H  N N 320 
TYR HB2  H  N N 321 
TYR HB3  H  N N 322 
TYR HD1  H  N N 323 
TYR HD2  H  N N 324 
TYR HE1  H  N N 325 
TYR HE2  H  N N 326 
TYR HH   H  N N 327 
TYR HXT  H  N N 328 
VAL N    N  N N 329 
VAL CA   C  N S 330 
VAL C    C  N N 331 
VAL O    O  N N 332 
VAL CB   C  N N 333 
VAL CG1  C  N N 334 
VAL CG2  C  N N 335 
VAL OXT  O  N N 336 
VAL H    H  N N 337 
VAL H2   H  N N 338 
VAL HA   H  N N 339 
VAL HB   H  N N 340 
VAL HG11 H  N N 341 
VAL HG12 H  N N 342 
VAL HG13 H  N N 343 
VAL HG21 H  N N 344 
VAL HG22 H  N N 345 
VAL HG23 H  N N 346 
VAL HXT  H  N N 347 
ZN  ZN   ZN N N 348 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASP N   CA   sing N N 39  
ASP N   H    sing N N 40  
ASP N   H2   sing N N 41  
ASP CA  C    sing N N 42  
ASP CA  CB   sing N N 43  
ASP CA  HA   sing N N 44  
ASP C   O    doub N N 45  
ASP C   OXT  sing N N 46  
ASP CB  CG   sing N N 47  
ASP CB  HB2  sing N N 48  
ASP CB  HB3  sing N N 49  
ASP CG  OD1  doub N N 50  
ASP CG  OD2  sing N N 51  
ASP OD2 HD2  sing N N 52  
ASP OXT HXT  sing N N 53  
CYS N   CA   sing N N 54  
CYS N   H    sing N N 55  
CYS N   H2   sing N N 56  
CYS CA  C    sing N N 57  
CYS CA  CB   sing N N 58  
CYS CA  HA   sing N N 59  
CYS C   O    doub N N 60  
CYS C   OXT  sing N N 61  
CYS CB  SG   sing N N 62  
CYS CB  HB2  sing N N 63  
CYS CB  HB3  sing N N 64  
CYS SG  HG   sing N N 65  
CYS OXT HXT  sing N N 66  
GLN N   CA   sing N N 67  
GLN N   H    sing N N 68  
GLN N   H2   sing N N 69  
GLN CA  C    sing N N 70  
GLN CA  CB   sing N N 71  
GLN CA  HA   sing N N 72  
GLN C   O    doub N N 73  
GLN C   OXT  sing N N 74  
GLN CB  CG   sing N N 75  
GLN CB  HB2  sing N N 76  
GLN CB  HB3  sing N N 77  
GLN CG  CD   sing N N 78  
GLN CG  HG2  sing N N 79  
GLN CG  HG3  sing N N 80  
GLN CD  OE1  doub N N 81  
GLN CD  NE2  sing N N 82  
GLN NE2 HE21 sing N N 83  
GLN NE2 HE22 sing N N 84  
GLN OXT HXT  sing N N 85  
GLU N   CA   sing N N 86  
GLU N   H    sing N N 87  
GLU N   H2   sing N N 88  
GLU CA  C    sing N N 89  
GLU CA  CB   sing N N 90  
GLU CA  HA   sing N N 91  
GLU C   O    doub N N 92  
GLU C   OXT  sing N N 93  
GLU CB  CG   sing N N 94  
GLU CB  HB2  sing N N 95  
GLU CB  HB3  sing N N 96  
GLU CG  CD   sing N N 97  
GLU CG  HG2  sing N N 98  
GLU CG  HG3  sing N N 99  
GLU CD  OE1  doub N N 100 
GLU CD  OE2  sing N N 101 
GLU OE2 HE2  sing N N 102 
GLU OXT HXT  sing N N 103 
GLY N   CA   sing N N 104 
GLY N   H    sing N N 105 
GLY N   H2   sing N N 106 
GLY CA  C    sing N N 107 
GLY CA  HA2  sing N N 108 
GLY CA  HA3  sing N N 109 
GLY C   O    doub N N 110 
GLY C   OXT  sing N N 111 
GLY OXT HXT  sing N N 112 
HIS N   CA   sing N N 113 
HIS N   H    sing N N 114 
HIS N   H2   sing N N 115 
HIS CA  C    sing N N 116 
HIS CA  CB   sing N N 117 
HIS CA  HA   sing N N 118 
HIS C   O    doub N N 119 
HIS C   OXT  sing N N 120 
HIS CB  CG   sing N N 121 
HIS CB  HB2  sing N N 122 
HIS CB  HB3  sing N N 123 
HIS CG  ND1  sing Y N 124 
HIS CG  CD2  doub Y N 125 
HIS ND1 CE1  doub Y N 126 
HIS ND1 HD1  sing N N 127 
HIS CD2 NE2  sing Y N 128 
HIS CD2 HD2  sing N N 129 
HIS CE1 NE2  sing Y N 130 
HIS CE1 HE1  sing N N 131 
HIS NE2 HE2  sing N N 132 
HIS OXT HXT  sing N N 133 
ILE N   CA   sing N N 134 
ILE N   H    sing N N 135 
ILE N   H2   sing N N 136 
ILE CA  C    sing N N 137 
ILE CA  CB   sing N N 138 
ILE CA  HA   sing N N 139 
ILE C   O    doub N N 140 
ILE C   OXT  sing N N 141 
ILE CB  CG1  sing N N 142 
ILE CB  CG2  sing N N 143 
ILE CB  HB   sing N N 144 
ILE CG1 CD1  sing N N 145 
ILE CG1 HG12 sing N N 146 
ILE CG1 HG13 sing N N 147 
ILE CG2 HG21 sing N N 148 
ILE CG2 HG22 sing N N 149 
ILE CG2 HG23 sing N N 150 
ILE CD1 HD11 sing N N 151 
ILE CD1 HD12 sing N N 152 
ILE CD1 HD13 sing N N 153 
ILE OXT HXT  sing N N 154 
LEU N   CA   sing N N 155 
LEU N   H    sing N N 156 
LEU N   H2   sing N N 157 
LEU CA  C    sing N N 158 
LEU CA  CB   sing N N 159 
LEU CA  HA   sing N N 160 
LEU C   O    doub N N 161 
LEU C   OXT  sing N N 162 
LEU CB  CG   sing N N 163 
LEU CB  HB2  sing N N 164 
LEU CB  HB3  sing N N 165 
LEU CG  CD1  sing N N 166 
LEU CG  CD2  sing N N 167 
LEU CG  HG   sing N N 168 
LEU CD1 HD11 sing N N 169 
LEU CD1 HD12 sing N N 170 
LEU CD1 HD13 sing N N 171 
LEU CD2 HD21 sing N N 172 
LEU CD2 HD22 sing N N 173 
LEU CD2 HD23 sing N N 174 
LEU OXT HXT  sing N N 175 
LYS N   CA   sing N N 176 
LYS N   H    sing N N 177 
LYS N   H2   sing N N 178 
LYS CA  C    sing N N 179 
LYS CA  CB   sing N N 180 
LYS CA  HA   sing N N 181 
LYS C   O    doub N N 182 
LYS C   OXT  sing N N 183 
LYS CB  CG   sing N N 184 
LYS CB  HB2  sing N N 185 
LYS CB  HB3  sing N N 186 
LYS CG  CD   sing N N 187 
LYS CG  HG2  sing N N 188 
LYS CG  HG3  sing N N 189 
LYS CD  CE   sing N N 190 
LYS CD  HD2  sing N N 191 
LYS CD  HD3  sing N N 192 
LYS CE  NZ   sing N N 193 
LYS CE  HE2  sing N N 194 
LYS CE  HE3  sing N N 195 
LYS NZ  HZ1  sing N N 196 
LYS NZ  HZ2  sing N N 197 
LYS NZ  HZ3  sing N N 198 
LYS OXT HXT  sing N N 199 
MET N   CA   sing N N 200 
MET N   H    sing N N 201 
MET N   H2   sing N N 202 
MET CA  C    sing N N 203 
MET CA  CB   sing N N 204 
MET CA  HA   sing N N 205 
MET C   O    doub N N 206 
MET C   OXT  sing N N 207 
MET CB  CG   sing N N 208 
MET CB  HB2  sing N N 209 
MET CB  HB3  sing N N 210 
MET CG  SD   sing N N 211 
MET CG  HG2  sing N N 212 
MET CG  HG3  sing N N 213 
MET SD  CE   sing N N 214 
MET CE  HE1  sing N N 215 
MET CE  HE2  sing N N 216 
MET CE  HE3  sing N N 217 
MET OXT HXT  sing N N 218 
PRO N   CA   sing N N 219 
PRO N   CD   sing N N 220 
PRO N   H    sing N N 221 
PRO CA  C    sing N N 222 
PRO CA  CB   sing N N 223 
PRO CA  HA   sing N N 224 
PRO C   O    doub N N 225 
PRO C   OXT  sing N N 226 
PRO CB  CG   sing N N 227 
PRO CB  HB2  sing N N 228 
PRO CB  HB3  sing N N 229 
PRO CG  CD   sing N N 230 
PRO CG  HG2  sing N N 231 
PRO CG  HG3  sing N N 232 
PRO CD  HD2  sing N N 233 
PRO CD  HD3  sing N N 234 
PRO OXT HXT  sing N N 235 
SER N   CA   sing N N 236 
SER N   H    sing N N 237 
SER N   H2   sing N N 238 
SER CA  C    sing N N 239 
SER CA  CB   sing N N 240 
SER CA  HA   sing N N 241 
SER C   O    doub N N 242 
SER C   OXT  sing N N 243 
SER CB  OG   sing N N 244 
SER CB  HB2  sing N N 245 
SER CB  HB3  sing N N 246 
SER OG  HG   sing N N 247 
SER OXT HXT  sing N N 248 
THR N   CA   sing N N 249 
THR N   H    sing N N 250 
THR N   H2   sing N N 251 
THR CA  C    sing N N 252 
THR CA  CB   sing N N 253 
THR CA  HA   sing N N 254 
THR C   O    doub N N 255 
THR C   OXT  sing N N 256 
THR CB  OG1  sing N N 257 
THR CB  CG2  sing N N 258 
THR CB  HB   sing N N 259 
THR OG1 HG1  sing N N 260 
THR CG2 HG21 sing N N 261 
THR CG2 HG22 sing N N 262 
THR CG2 HG23 sing N N 263 
THR OXT HXT  sing N N 264 
TRP N   CA   sing N N 265 
TRP N   H    sing N N 266 
TRP N   H2   sing N N 267 
TRP CA  C    sing N N 268 
TRP CA  CB   sing N N 269 
TRP CA  HA   sing N N 270 
TRP C   O    doub N N 271 
TRP C   OXT  sing N N 272 
TRP CB  CG   sing N N 273 
TRP CB  HB2  sing N N 274 
TRP CB  HB3  sing N N 275 
TRP CG  CD1  doub Y N 276 
TRP CG  CD2  sing Y N 277 
TRP CD1 NE1  sing Y N 278 
TRP CD1 HD1  sing N N 279 
TRP CD2 CE2  doub Y N 280 
TRP CD2 CE3  sing Y N 281 
TRP NE1 CE2  sing Y N 282 
TRP NE1 HE1  sing N N 283 
TRP CE2 CZ2  sing Y N 284 
TRP CE3 CZ3  doub Y N 285 
TRP CE3 HE3  sing N N 286 
TRP CZ2 CH2  doub Y N 287 
TRP CZ2 HZ2  sing N N 288 
TRP CZ3 CH2  sing Y N 289 
TRP CZ3 HZ3  sing N N 290 
TRP CH2 HH2  sing N N 291 
TRP OXT HXT  sing N N 292 
TYR N   CA   sing N N 293 
TYR N   H    sing N N 294 
TYR N   H2   sing N N 295 
TYR CA  C    sing N N 296 
TYR CA  CB   sing N N 297 
TYR CA  HA   sing N N 298 
TYR C   O    doub N N 299 
TYR C   OXT  sing N N 300 
TYR CB  CG   sing N N 301 
TYR CB  HB2  sing N N 302 
TYR CB  HB3  sing N N 303 
TYR CG  CD1  doub Y N 304 
TYR CG  CD2  sing Y N 305 
TYR CD1 CE1  sing Y N 306 
TYR CD1 HD1  sing N N 307 
TYR CD2 CE2  doub Y N 308 
TYR CD2 HD2  sing N N 309 
TYR CE1 CZ   doub Y N 310 
TYR CE1 HE1  sing N N 311 
TYR CE2 CZ   sing Y N 312 
TYR CE2 HE2  sing N N 313 
TYR CZ  OH   sing N N 314 
TYR OH  HH   sing N N 315 
TYR OXT HXT  sing N N 316 
VAL N   CA   sing N N 317 
VAL N   H    sing N N 318 
VAL N   H2   sing N N 319 
VAL CA  C    sing N N 320 
VAL CA  CB   sing N N 321 
VAL CA  HA   sing N N 322 
VAL C   O    doub N N 323 
VAL C   OXT  sing N N 324 
VAL CB  CG1  sing N N 325 
VAL CB  CG2  sing N N 326 
VAL CB  HB   sing N N 327 
VAL CG1 HG11 sing N N 328 
VAL CG1 HG12 sing N N 329 
VAL CG1 HG13 sing N N 330 
VAL CG2 HG21 sing N N 331 
VAL CG2 HG22 sing N N 332 
VAL CG2 HG23 sing N N 333 
VAL OXT HXT  sing N N 334 
# 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             DRX 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker DRX' 
# 
_atom_sites.entry_id                    2L5U 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_