data_2L5Y # _entry.id 2L5Y # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2L5Y pdb_00002l5y 10.2210/pdb2l5y/pdb RCSB RCSB101998 ? ? WWPDB D_1000101998 ? ? BMRB 17289 ? 10.13018/BMR17289 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-01-19 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-05 4 'Structure model' 1 3 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' struct_ref_seq_dif 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_struct_conn_angle 9 4 'Structure model' struct_conn 10 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_spectrometer.model' 3 3 'Structure model' '_struct_ref_seq_dif.details' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.value' 17 4 'Structure model' '_struct_conn.pdbx_dist_value' 18 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 24 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 25 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L5Y _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-11-09 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 17289 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zheng, L.' 1 'Stathopulos, P.B.' 2 'Ikura, M.' 3 # _citation.id primary _citation.title 'Auto-inhibitory role of the EF-SAM domain of STIM proteins in store-operated calcium entry.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 108 _citation.page_first 1337 _citation.page_last 1342 _citation.year 2011 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21217057 _citation.pdbx_database_id_DOI 10.1073/pnas.1015125108 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zheng, L.' 1 ? primary 'Stathopulos, P.B.' 2 ? primary 'Schindl, R.' 3 ? primary 'Li, G.Y.' 4 ? primary 'Romanin, C.' 5 ? primary 'Ikura, M.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Stromal interaction molecule 2' 17830.967 1 ? ? 'UNP residues 62-205' ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMASTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHITIEDLWKRWKTSEVHN WTLEDTLQWLIEFVELPQYEKNFRDNNVKGTTLPRIAVHEPSFMISQLKISDRSHRQKLQLKALDVVLFG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMASTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHITIEDLWKRWKTSEVHN WTLEDTLQWLIEFVELPQYEKNFRDNNVKGTTLPRIAVHEPSFMISQLKISDRSHRQKLQLKALDVVLFG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ALA n 1 6 SER n 1 7 THR n 1 8 GLU n 1 9 GLU n 1 10 ASP n 1 11 ARG n 1 12 PHE n 1 13 SER n 1 14 LEU n 1 15 GLU n 1 16 ALA n 1 17 LEU n 1 18 GLN n 1 19 THR n 1 20 ILE n 1 21 HIS n 1 22 LYS n 1 23 GLN n 1 24 MET n 1 25 ASP n 1 26 ASP n 1 27 ASP n 1 28 LYS n 1 29 ASP n 1 30 GLY n 1 31 GLY n 1 32 ILE n 1 33 GLU n 1 34 VAL n 1 35 GLU n 1 36 GLU n 1 37 SER n 1 38 ASP n 1 39 GLU n 1 40 PHE n 1 41 ILE n 1 42 ARG n 1 43 GLU n 1 44 ASP n 1 45 MET n 1 46 LYS n 1 47 TYR n 1 48 LYS n 1 49 ASP n 1 50 ALA n 1 51 THR n 1 52 ASN n 1 53 LYS n 1 54 HIS n 1 55 SER n 1 56 HIS n 1 57 LEU n 1 58 HIS n 1 59 ARG n 1 60 GLU n 1 61 ASP n 1 62 LYS n 1 63 HIS n 1 64 ILE n 1 65 THR n 1 66 ILE n 1 67 GLU n 1 68 ASP n 1 69 LEU n 1 70 TRP n 1 71 LYS n 1 72 ARG n 1 73 TRP n 1 74 LYS n 1 75 THR n 1 76 SER n 1 77 GLU n 1 78 VAL n 1 79 HIS n 1 80 ASN n 1 81 TRP n 1 82 THR n 1 83 LEU n 1 84 GLU n 1 85 ASP n 1 86 THR n 1 87 LEU n 1 88 GLN n 1 89 TRP n 1 90 LEU n 1 91 ILE n 1 92 GLU n 1 93 PHE n 1 94 VAL n 1 95 GLU n 1 96 LEU n 1 97 PRO n 1 98 GLN n 1 99 TYR n 1 100 GLU n 1 101 LYS n 1 102 ASN n 1 103 PHE n 1 104 ARG n 1 105 ASP n 1 106 ASN n 1 107 ASN n 1 108 VAL n 1 109 LYS n 1 110 GLY n 1 111 THR n 1 112 THR n 1 113 LEU n 1 114 PRO n 1 115 ARG n 1 116 ILE n 1 117 ALA n 1 118 VAL n 1 119 HIS n 1 120 GLU n 1 121 PRO n 1 122 SER n 1 123 PHE n 1 124 MET n 1 125 ILE n 1 126 SER n 1 127 GLN n 1 128 LEU n 1 129 LYS n 1 130 ILE n 1 131 SER n 1 132 ASP n 1 133 ARG n 1 134 SER n 1 135 HIS n 1 136 ARG n 1 137 GLN n 1 138 LYS n 1 139 LEU n 1 140 GLN n 1 141 LEU n 1 142 LYS n 1 143 ALA n 1 144 LEU n 1 145 ASP n 1 146 VAL n 1 147 VAL n 1 148 LEU n 1 149 PHE n 1 150 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'KIAA1482, STIM2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET28a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -5 -5 GLY GLY A . n A 1 2 SER 2 -4 -4 SER SER A . n A 1 3 HIS 3 -3 -3 HIS HIS A . n A 1 4 MET 4 -2 -2 MET MET A . n A 1 5 ALA 5 -1 -1 ALA ALA A . n A 1 6 SER 6 0 0 SER SER A . n A 1 7 THR 7 62 62 THR THR A . n A 1 8 GLU 8 63 63 GLU GLU A . n A 1 9 GLU 9 64 64 GLU GLU A . n A 1 10 ASP 10 65 65 ASP ASP A . n A 1 11 ARG 11 66 66 ARG ARG A . n A 1 12 PHE 12 67 67 PHE PHE A . n A 1 13 SER 13 68 68 SER SER A . n A 1 14 LEU 14 69 69 LEU LEU A . n A 1 15 GLU 15 70 70 GLU GLU A . n A 1 16 ALA 16 71 71 ALA ALA A . n A 1 17 LEU 17 72 72 LEU LEU A . n A 1 18 GLN 18 73 73 GLN GLN A . n A 1 19 THR 19 74 74 THR THR A . n A 1 20 ILE 20 75 75 ILE ILE A . n A 1 21 HIS 21 76 76 HIS HIS A . n A 1 22 LYS 22 77 77 LYS LYS A . n A 1 23 GLN 23 78 78 GLN GLN A . n A 1 24 MET 24 79 79 MET MET A . n A 1 25 ASP 25 80 80 ASP ASP A . n A 1 26 ASP 26 81 81 ASP ASP A . n A 1 27 ASP 27 82 82 ASP ASP A . n A 1 28 LYS 28 83 83 LYS LYS A . n A 1 29 ASP 29 84 84 ASP ASP A . n A 1 30 GLY 30 85 85 GLY GLY A . n A 1 31 GLY 31 86 86 GLY GLY A . n A 1 32 ILE 32 87 87 ILE ILE A . n A 1 33 GLU 33 88 88 GLU GLU A . n A 1 34 VAL 34 89 89 VAL VAL A . n A 1 35 GLU 35 90 90 GLU GLU A . n A 1 36 GLU 36 91 91 GLU GLU A . n A 1 37 SER 37 92 92 SER SER A . n A 1 38 ASP 38 93 93 ASP ASP A . n A 1 39 GLU 39 94 94 GLU GLU A . n A 1 40 PHE 40 95 95 PHE PHE A . n A 1 41 ILE 41 96 96 ILE ILE A . n A 1 42 ARG 42 97 97 ARG ARG A . n A 1 43 GLU 43 98 98 GLU GLU A . n A 1 44 ASP 44 99 99 ASP ASP A . n A 1 45 MET 45 100 100 MET MET A . n A 1 46 LYS 46 101 101 LYS LYS A . n A 1 47 TYR 47 102 102 TYR TYR A . n A 1 48 LYS 48 103 103 LYS LYS A . n A 1 49 ASP 49 104 104 ASP ASP A . n A 1 50 ALA 50 105 105 ALA ALA A . n A 1 51 THR 51 106 106 THR THR A . n A 1 52 ASN 52 107 107 ASN ASN A . n A 1 53 LYS 53 108 108 LYS LYS A . n A 1 54 HIS 54 109 109 HIS HIS A . n A 1 55 SER 55 110 110 SER SER A . n A 1 56 HIS 56 111 111 HIS HIS A . n A 1 57 LEU 57 112 112 LEU LEU A . n A 1 58 HIS 58 113 113 HIS HIS A . n A 1 59 ARG 59 114 114 ARG ARG A . n A 1 60 GLU 60 115 115 GLU GLU A . n A 1 61 ASP 61 116 116 ASP ASP A . n A 1 62 LYS 62 117 117 LYS LYS A . n A 1 63 HIS 63 118 118 HIS HIS A . n A 1 64 ILE 64 119 119 ILE ILE A . n A 1 65 THR 65 120 120 THR THR A . n A 1 66 ILE 66 121 121 ILE ILE A . n A 1 67 GLU 67 122 122 GLU GLU A . n A 1 68 ASP 68 123 123 ASP ASP A . n A 1 69 LEU 69 124 124 LEU LEU A . n A 1 70 TRP 70 125 125 TRP TRP A . n A 1 71 LYS 71 126 126 LYS LYS A . n A 1 72 ARG 72 127 127 ARG ARG A . n A 1 73 TRP 73 128 128 TRP TRP A . n A 1 74 LYS 74 129 129 LYS LYS A . n A 1 75 THR 75 130 130 THR THR A . n A 1 76 SER 76 131 131 SER SER A . n A 1 77 GLU 77 132 132 GLU GLU A . n A 1 78 VAL 78 133 133 VAL VAL A . n A 1 79 HIS 79 134 134 HIS HIS A . n A 1 80 ASN 80 135 135 ASN ASN A . n A 1 81 TRP 81 136 136 TRP TRP A . n A 1 82 THR 82 137 137 THR THR A . n A 1 83 LEU 83 138 138 LEU LEU A . n A 1 84 GLU 84 139 139 GLU GLU A . n A 1 85 ASP 85 140 140 ASP ASP A . n A 1 86 THR 86 141 141 THR THR A . n A 1 87 LEU 87 142 142 LEU LEU A . n A 1 88 GLN 88 143 143 GLN GLN A . n A 1 89 TRP 89 144 144 TRP TRP A . n A 1 90 LEU 90 145 145 LEU LEU A . n A 1 91 ILE 91 146 146 ILE ILE A . n A 1 92 GLU 92 147 147 GLU GLU A . n A 1 93 PHE 93 148 148 PHE PHE A . n A 1 94 VAL 94 149 149 VAL VAL A . n A 1 95 GLU 95 150 150 GLU GLU A . n A 1 96 LEU 96 151 151 LEU LEU A . n A 1 97 PRO 97 152 152 PRO PRO A . n A 1 98 GLN 98 153 153 GLN GLN A . n A 1 99 TYR 99 154 154 TYR TYR A . n A 1 100 GLU 100 155 155 GLU GLU A . n A 1 101 LYS 101 156 156 LYS LYS A . n A 1 102 ASN 102 157 157 ASN ASN A . n A 1 103 PHE 103 158 158 PHE PHE A . n A 1 104 ARG 104 159 159 ARG ARG A . n A 1 105 ASP 105 160 160 ASP ASP A . n A 1 106 ASN 106 161 161 ASN ASN A . n A 1 107 ASN 107 162 162 ASN ASN A . n A 1 108 VAL 108 163 163 VAL VAL A . n A 1 109 LYS 109 164 164 LYS LYS A . n A 1 110 GLY 110 165 165 GLY GLY A . n A 1 111 THR 111 166 166 THR THR A . n A 1 112 THR 112 167 167 THR THR A . n A 1 113 LEU 113 168 168 LEU LEU A . n A 1 114 PRO 114 169 169 PRO PRO A . n A 1 115 ARG 115 170 170 ARG ARG A . n A 1 116 ILE 116 171 171 ILE ILE A . n A 1 117 ALA 117 172 172 ALA ALA A . n A 1 118 VAL 118 173 173 VAL VAL A . n A 1 119 HIS 119 174 174 HIS HIS A . n A 1 120 GLU 120 175 175 GLU GLU A . n A 1 121 PRO 121 176 176 PRO PRO A . n A 1 122 SER 122 177 177 SER SER A . n A 1 123 PHE 123 178 178 PHE PHE A . n A 1 124 MET 124 179 179 MET MET A . n A 1 125 ILE 125 180 180 ILE ILE A . n A 1 126 SER 126 181 181 SER SER A . n A 1 127 GLN 127 182 182 GLN GLN A . n A 1 128 LEU 128 183 183 LEU LEU A . n A 1 129 LYS 129 184 184 LYS LYS A . n A 1 130 ILE 130 185 185 ILE ILE A . n A 1 131 SER 131 186 186 SER SER A . n A 1 132 ASP 132 187 187 ASP ASP A . n A 1 133 ARG 133 188 188 ARG ARG A . n A 1 134 SER 134 189 189 SER SER A . n A 1 135 HIS 135 190 190 HIS HIS A . n A 1 136 ARG 136 191 191 ARG ARG A . n A 1 137 GLN 137 192 192 GLN GLN A . n A 1 138 LYS 138 193 193 LYS LYS A . n A 1 139 LEU 139 194 194 LEU LEU A . n A 1 140 GLN 140 195 195 GLN GLN A . n A 1 141 LEU 141 196 196 LEU LEU A . n A 1 142 LYS 142 197 197 LYS LYS A . n A 1 143 ALA 143 198 198 ALA ALA A . n A 1 144 LEU 144 199 199 LEU LEU A . n A 1 145 ASP 145 200 200 ASP ASP A . n A 1 146 VAL 146 201 201 VAL VAL A . n A 1 147 VAL 147 202 202 VAL VAL A . n A 1 148 LEU 148 203 203 LEU LEU A . n A 1 149 PHE 149 204 204 PHE PHE A . n A 1 150 GLY 150 205 205 GLY GLY A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id CA _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 300 _pdbx_nonpoly_scheme.auth_seq_num 300 _pdbx_nonpoly_scheme.pdb_mon_id CA _pdbx_nonpoly_scheme.auth_mon_id CA _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _cell.entry_id 2L5Y _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2L5Y _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ;NMR structural ensemble of the calcium sensing region of stromal interaction molecule-2 consisting of the EF-hand together with the SAM domains (residues 62-205). ; _exptl.entry_id 2L5Y _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L5Y _struct.title 'NMR structure of calcium-loaded STIM2 EF-SAM.' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L5Y _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'stromal interaction molecule, EF-hand, SAM domain, store operated calcium entry, SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code STIM2_HUMAN _struct_ref.pdbx_db_accession Q9P246 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHITIEDLWKRWKTSEVHNWTLEDT LQWLIEFVELPQYEKNFRDNNVKGTTLPRIAVHEPSFMISQLKISDRSHRQKLQLKALDVVLFG ; _struct_ref.pdbx_align_begin 62 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L5Y _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 7 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 150 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9P246 _struct_ref_seq.db_align_beg 62 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 205 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 62 _struct_ref_seq.pdbx_auth_seq_align_end 205 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2L5Y GLY A 1 ? UNP Q9P246 ? ? 'expression tag' -5 1 1 2L5Y SER A 2 ? UNP Q9P246 ? ? 'expression tag' -4 2 1 2L5Y HIS A 3 ? UNP Q9P246 ? ? 'expression tag' -3 3 1 2L5Y MET A 4 ? UNP Q9P246 ? ? 'expression tag' -2 4 1 2L5Y ALA A 5 ? UNP Q9P246 ? ? 'expression tag' -1 5 1 2L5Y SER A 6 ? UNP Q9P246 ? ? 'expression tag' 0 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 7 ? ASP A 25 ? THR A 62 ASP A 80 1 ? 19 HELX_P HELX_P2 2 GLU A 33 ? ARG A 42 ? GLU A 88 ARG A 97 1 ? 10 HELX_P HELX_P3 3 ALA A 50 ? HIS A 58 ? ALA A 105 HIS A 113 1 ? 9 HELX_P HELX_P4 4 THR A 65 ? THR A 75 ? THR A 120 THR A 130 1 ? 11 HELX_P HELX_P5 5 SER A 76 ? TRP A 81 ? SER A 131 TRP A 136 1 ? 6 HELX_P HELX_P6 6 THR A 82 ? VAL A 94 ? THR A 137 VAL A 149 1 ? 13 HELX_P HELX_P7 7 TYR A 99 ? VAL A 108 ? TYR A 154 VAL A 163 1 ? 10 HELX_P HELX_P8 8 ASP A 132 ? GLY A 150 ? ASP A 187 GLY A 205 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 29 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 84 A CA 300 1_555 ? ? ? ? ? ? ? 1.921 ? ? metalc2 metalc ? ? A GLY 31 O ? ? ? 1_555 B CA . CA ? ? A GLY 86 A CA 300 1_555 ? ? ? ? ? ? ? 2.933 ? ? metalc3 metalc ? ? A GLU 33 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 88 A CA 300 1_555 ? ? ? ? ? ? ? 1.884 ? ? metalc4 metalc ? ? A GLU 36 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 91 A CA 300 1_555 ? ? ? ? ? ? ? 1.856 ? ? metalc5 metalc ? ? A GLU 36 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 91 A CA 300 1_555 ? ? ? ? ? ? ? 2.906 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 29 ? A ASP 84 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 O ? A GLY 31 ? A GLY 86 ? 1_555 71.0 ? 2 OD2 ? A ASP 29 ? A ASP 84 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 OE2 ? A GLU 33 ? A GLU 88 ? 1_555 86.9 ? 3 O ? A GLY 31 ? A GLY 86 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 OE2 ? A GLU 33 ? A GLU 88 ? 1_555 92.5 ? 4 OD2 ? A ASP 29 ? A ASP 84 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 OE1 ? A GLU 36 ? A GLU 91 ? 1_555 153.6 ? 5 O ? A GLY 31 ? A GLY 86 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 OE1 ? A GLU 36 ? A GLU 91 ? 1_555 84.3 ? 6 OE2 ? A GLU 33 ? A GLU 88 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 OE1 ? A GLU 36 ? A GLU 91 ? 1_555 85.0 ? 7 OD2 ? A ASP 29 ? A ASP 84 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 OE2 ? A GLU 36 ? A GLU 91 ? 1_555 159.0 ? 8 O ? A GLY 31 ? A GLY 86 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 OE2 ? A GLU 36 ? A GLU 91 ? 1_555 129.4 ? 9 OE2 ? A GLU 33 ? A GLU 88 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 OE2 ? A GLU 36 ? A GLU 91 ? 1_555 96.0 ? 10 OE1 ? A GLU 36 ? A GLU 91 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 OE2 ? A GLU 36 ? A GLU 91 ? 1_555 47.3 ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CA _struct_site.pdbx_auth_seq_id 300 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'BINDING SITE FOR RESIDUE CA A 300' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASP A 25 ? ASP A 80 . ? 1_555 ? 2 AC1 6 ASP A 27 ? ASP A 82 . ? 1_555 ? 3 AC1 6 ASP A 29 ? ASP A 84 . ? 1_555 ? 4 AC1 6 GLY A 31 ? GLY A 86 . ? 1_555 ? 5 AC1 6 GLU A 33 ? GLU A 88 . ? 1_555 ? 6 AC1 6 GLU A 36 ? GLU A 91 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ2 A LYS 103 ? ? OD1 A ASP 200 ? ? 1.56 2 2 HZ1 A LYS 108 ? ? OD2 A ASP 200 ? ? 1.54 3 2 HG A SER -4 ? ? OE1 A GLU 70 ? ? 1.59 4 3 HZ3 A LYS 103 ? ? OD1 A ASP 200 ? ? 1.57 5 3 O A ASP 65 ? ? H A LEU 69 ? ? 1.60 6 4 OD2 A ASP 123 ? ? HE A ARG 127 ? ? 1.59 7 5 HZ3 A LYS 108 ? ? OD1 A ASP 200 ? ? 1.55 8 5 HZ2 A LYS 103 ? ? OD1 A ASP 200 ? ? 1.59 9 6 HZ3 A LYS 108 ? ? OD1 A ASP 200 ? ? 1.58 10 8 HZ2 A LYS 108 ? ? OD1 A ASP 200 ? ? 1.56 11 9 HZ2 A LYS 108 ? ? OD1 A ASP 200 ? ? 1.59 12 10 HZ2 A LYS 103 ? ? OD1 A ASP 200 ? ? 1.55 13 10 H2 A GLY -5 ? ? OE2 A GLU 70 ? ? 1.60 14 11 OD2 A ASP 123 ? ? HE A ARG 127 ? ? 1.59 15 13 HZ1 A LYS 103 ? ? OD1 A ASP 200 ? ? 1.54 16 15 HZ3 A LYS 103 ? ? OD1 A ASP 200 ? ? 1.59 17 20 H1 A GLY -5 ? ? OD1 A ASP 65 ? ? 1.59 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 4 N A GLY 86 ? ? CA A GLY 86 ? ? 1.361 1.456 -0.095 0.015 N 2 6 N A GLY 86 ? ? CA A GLY 86 ? ? 1.364 1.456 -0.092 0.015 N 3 9 CD A GLU 91 ? ? OE1 A GLU 91 ? ? 1.173 1.252 -0.079 0.011 N 4 18 N A GLY 86 ? ? CA A GLY 86 ? ? 1.364 1.456 -0.092 0.015 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 9 OE1 A GLU 91 ? ? CD A GLU 91 ? ? OE2 A GLU 91 ? ? 114.79 123.30 -8.51 1.20 N 2 16 OE1 A GLU 91 ? ? CD A GLU 91 ? ? OE2 A GLU 91 ? ? 115.44 123.30 -7.86 1.20 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 98 ? ? -131.27 -64.75 2 1 LYS A 103 ? ? -132.91 -56.14 3 1 ALA A 105 ? ? -121.08 -66.18 4 1 GLU A 115 ? ? -166.01 -46.44 5 1 ASN A 162 ? ? 94.53 79.68 6 1 THR A 166 ? ? -99.32 -65.52 7 1 SER A 186 ? ? -81.26 43.51 8 2 MET A -2 ? ? -133.48 -55.31 9 2 ALA A -1 ? ? 59.65 -157.05 10 2 SER A 0 ? ? -146.38 -66.05 11 2 GLU A 98 ? ? -139.86 -60.74 12 2 TYR A 102 ? ? -39.39 -34.45 13 2 ALA A 105 ? ? -123.66 -63.32 14 2 LEU A 151 ? ? -117.71 65.36 15 2 ASN A 162 ? ? 99.56 70.08 16 2 THR A 166 ? ? -103.62 -67.89 17 2 GLU A 175 ? ? -173.45 -68.66 18 2 PHE A 178 ? ? -68.09 -74.12 19 2 SER A 186 ? ? -93.81 33.29 20 2 PHE A 204 ? ? -97.14 -61.17 21 3 SER A 0 ? ? -96.61 -67.55 22 3 LYS A 83 ? ? 49.12 75.02 23 3 GLU A 98 ? ? -139.04 -55.04 24 3 LYS A 103 ? ? -131.46 -42.01 25 3 ALA A 105 ? ? -155.63 -73.48 26 3 LYS A 117 ? ? -126.27 -51.35 27 3 GLU A 150 ? ? 74.84 33.71 28 3 LEU A 151 ? ? -118.76 70.72 29 3 ASN A 162 ? ? 94.99 71.98 30 3 PRO A 176 ? ? -57.89 -76.82 31 3 SER A 186 ? ? -86.26 43.10 32 4 SER A -4 ? ? 66.51 98.49 33 4 GLU A 98 ? ? -139.24 -57.10 34 4 ALA A 105 ? ? -147.25 -81.11 35 4 GLU A 115 ? ? -148.48 -46.36 36 4 LYS A 117 ? ? -97.18 -61.24 37 4 LEU A 151 ? ? -119.20 65.68 38 4 ASN A 162 ? ? 100.38 69.66 39 4 THR A 166 ? ? -93.30 -68.42 40 4 PRO A 176 ? ? -62.09 -79.90 41 4 SER A 177 ? ? 172.69 176.80 42 4 SER A 186 ? ? 68.90 150.46 43 4 ASP A 187 ? ? -148.42 -26.71 44 5 GLU A 98 ? ? -130.26 -59.45 45 5 LYS A 103 ? ? -137.27 -77.57 46 5 GLU A 115 ? ? -168.16 -44.78 47 5 HIS A 118 ? ? -69.15 98.00 48 5 ASN A 162 ? ? 94.80 73.64 49 5 PHE A 178 ? ? -49.87 -70.96 50 5 LYS A 184 ? ? 58.94 -106.43 51 5 ILE A 185 ? ? -147.25 18.34 52 6 MET A -2 ? ? -112.55 -80.24 53 6 GLU A 98 ? ? -127.32 -59.30 54 6 LYS A 103 ? ? -129.54 -77.01 55 6 GLU A 115 ? ? -152.35 -61.32 56 6 LYS A 117 ? ? -95.60 -68.98 57 6 ASN A 162 ? ? 96.16 72.59 58 6 THR A 166 ? ? -100.93 -69.09 59 6 HIS A 174 ? ? -76.37 -71.70 60 6 GLU A 175 ? ? -168.78 -44.61 61 6 PRO A 176 ? ? -45.26 109.49 62 6 PHE A 178 ? ? -94.14 -92.47 63 6 LYS A 184 ? ? 60.11 -82.71 64 6 ILE A 185 ? ? -145.56 10.16 65 7 SER A -4 ? ? 70.52 95.22 66 7 SER A 0 ? ? -148.52 33.05 67 7 GLU A 98 ? ? -141.50 -59.08 68 7 LYS A 103 ? ? -120.27 -51.85 69 7 ALA A 105 ? ? -135.14 -67.85 70 7 GLU A 115 ? ? -147.76 -56.45 71 7 GLU A 150 ? ? 72.20 33.63 72 7 LEU A 151 ? ? -119.75 64.61 73 7 ASN A 162 ? ? 93.68 67.61 74 7 LYS A 164 ? ? -118.55 -155.91 75 7 THR A 166 ? ? -110.07 -71.02 76 7 SER A 177 ? ? -75.98 -167.34 77 7 GLN A 182 ? ? -176.88 125.96 78 7 LYS A 184 ? ? 66.54 -78.54 79 7 ILE A 185 ? ? -141.59 -0.49 80 7 ASP A 187 ? ? -142.68 -21.05 81 8 ALA A -1 ? ? 69.74 153.88 82 8 GLU A 98 ? ? -139.37 -61.33 83 8 TYR A 102 ? ? -56.70 -9.21 84 8 LYS A 103 ? ? -135.46 -49.79 85 8 ALA A 105 ? ? -126.04 -59.74 86 8 LYS A 117 ? ? -93.17 -71.33 87 8 HIS A 118 ? ? -60.67 86.08 88 8 LEU A 151 ? ? -116.34 65.42 89 8 ASN A 162 ? ? 100.76 76.53 90 8 THR A 166 ? ? -98.25 -70.22 91 8 HIS A 174 ? ? 77.11 -12.10 92 8 SER A 186 ? ? 32.73 89.16 93 9 GLU A 98 ? ? -128.36 -65.52 94 9 LYS A 103 ? ? -133.32 -43.22 95 9 ALA A 105 ? ? -108.96 -65.58 96 9 GLU A 115 ? ? -141.18 -30.40 97 9 LEU A 151 ? ? -119.57 63.09 98 9 ASN A 162 ? ? 97.43 71.73 99 9 THR A 166 ? ? -93.58 -72.02 100 9 VAL A 173 ? ? 72.67 -52.30 101 9 HIS A 174 ? ? -138.14 -45.68 102 9 GLU A 175 ? ? -123.72 -65.66 103 9 PRO A 176 ? ? -68.29 81.80 104 9 PHE A 178 ? ? -118.06 -79.95 105 9 LYS A 184 ? ? 67.80 -74.53 106 10 SER A -4 ? ? -75.18 -80.17 107 10 HIS A -3 ? ? -124.09 -73.87 108 10 ALA A -1 ? ? -170.81 111.57 109 10 GLU A 98 ? ? -130.54 -65.69 110 10 LYS A 103 ? ? -128.19 -67.29 111 10 HIS A 113 ? ? -91.50 30.69 112 10 GLU A 115 ? ? -155.76 -41.23 113 10 LEU A 151 ? ? -112.56 74.27 114 10 ASN A 162 ? ? 97.42 74.64 115 10 THR A 166 ? ? -91.64 -70.03 116 10 ILE A 171 ? ? -59.70 172.74 117 10 LYS A 184 ? ? 59.54 -91.57 118 10 ILE A 185 ? ? -151.24 17.05 119 11 GLU A 98 ? ? -135.06 -64.34 120 11 LYS A 103 ? ? -125.40 -55.68 121 11 ALA A 105 ? ? -144.85 -61.25 122 11 GLU A 115 ? ? -158.88 -40.65 123 11 LYS A 117 ? ? -97.61 -62.06 124 11 LEU A 151 ? ? -114.15 63.54 125 11 ASN A 162 ? ? 90.36 58.49 126 11 THR A 166 ? ? -92.08 -61.11 127 11 HIS A 174 ? ? -121.16 -64.46 128 11 PRO A 176 ? ? -25.26 89.81 129 11 ILE A 185 ? ? -74.91 -72.42 130 12 GLU A 98 ? ? -139.14 -58.80 131 12 LYS A 103 ? ? -123.68 -72.80 132 12 ASP A 104 ? ? -120.08 -163.71 133 12 ALA A 105 ? ? -163.40 -73.77 134 12 GLU A 115 ? ? -107.88 -66.92 135 12 ASN A 162 ? ? 93.64 68.94 136 12 LYS A 164 ? ? -135.04 -152.17 137 12 THR A 166 ? ? -121.70 -69.61 138 12 PHE A 178 ? ? -44.71 -73.18 139 12 LYS A 184 ? ? 61.82 -84.37 140 12 ILE A 185 ? ? -144.77 -71.25 141 13 HIS A -3 ? ? 67.03 -134.46 142 13 MET A -2 ? ? 67.05 -77.00 143 13 GLU A 98 ? ? -139.10 -61.94 144 13 LYS A 103 ? ? -132.45 -41.35 145 13 ALA A 105 ? ? -124.95 -62.17 146 13 ASN A 162 ? ? 95.93 71.30 147 13 LYS A 164 ? ? -137.90 -153.94 148 13 THR A 166 ? ? -110.80 -74.58 149 13 SER A 177 ? ? -63.76 25.23 150 13 PHE A 178 ? ? 60.27 -74.92 151 13 SER A 186 ? ? 68.99 -60.42 152 13 ASP A 187 ? ? 64.05 -67.53 153 14 GLU A 98 ? ? -135.77 -65.50 154 14 LYS A 103 ? ? -130.92 -56.10 155 14 LEU A 151 ? ? -118.07 62.67 156 14 ASN A 162 ? ? 91.87 69.92 157 14 VAL A 173 ? ? 70.41 -65.32 158 14 ILE A 185 ? ? -60.47 91.29 159 14 SER A 186 ? ? 175.47 118.03 160 15 GLU A 98 ? ? -134.46 -59.75 161 15 LYS A 103 ? ? -139.66 -48.70 162 15 ALA A 105 ? ? -151.87 -61.54 163 15 GLU A 115 ? ? -142.51 -47.40 164 15 LEU A 151 ? ? -111.00 63.30 165 15 ASN A 162 ? ? 93.65 70.93 166 15 THR A 166 ? ? -98.13 -69.51 167 15 LYS A 184 ? ? 62.56 -88.37 168 15 ILE A 185 ? ? -141.03 13.01 169 15 SER A 186 ? ? 63.70 86.11 170 15 PHE A 204 ? ? -90.77 -65.20 171 16 ALA A -1 ? ? 60.67 79.32 172 16 ARG A 97 ? ? -48.00 -17.81 173 16 GLU A 98 ? ? -134.27 -61.66 174 16 LYS A 103 ? ? -123.27 -62.62 175 16 ALA A 105 ? ? -131.02 -66.30 176 16 GLU A 115 ? ? -171.58 -40.60 177 16 HIS A 118 ? ? -62.19 89.05 178 16 LEU A 151 ? ? -119.13 69.29 179 16 ASN A 162 ? ? 96.69 67.06 180 16 THR A 166 ? ? -89.47 -74.05 181 16 LYS A 184 ? ? -79.94 -74.94 182 16 SER A 186 ? ? 62.08 -174.73 183 17 SER A -4 ? ? 68.67 -81.23 184 17 ALA A -1 ? ? 71.56 78.37 185 17 GLU A 98 ? ? -140.53 -59.11 186 17 ALA A 105 ? ? -149.11 -55.51 187 17 GLU A 115 ? ? -161.89 -40.46 188 17 LYS A 117 ? ? -96.17 -68.40 189 17 LEU A 151 ? ? -108.18 75.91 190 17 ASN A 162 ? ? 98.55 70.89 191 17 THR A 166 ? ? -101.10 -70.09 192 18 HIS A -3 ? ? -92.76 -63.64 193 18 GLU A 98 ? ? -132.01 -64.61 194 18 LYS A 103 ? ? -128.20 -50.63 195 18 ALA A 105 ? ? -152.73 -70.48 196 18 GLU A 115 ? ? -153.20 -43.06 197 18 HIS A 118 ? ? -66.79 85.99 198 18 ASN A 162 ? ? 94.07 68.09 199 18 HIS A 174 ? ? -146.60 -51.61 200 18 ILE A 185 ? ? 77.16 -68.37 201 19 SER A -4 ? ? 60.06 -151.97 202 19 GLU A 98 ? ? -136.78 -56.68 203 19 LYS A 103 ? ? -129.30 -66.76 204 19 ASP A 104 ? ? -131.24 -158.88 205 19 ALA A 105 ? ? -159.27 -77.39 206 19 GLU A 115 ? ? -99.65 -64.01 207 19 GLU A 150 ? ? 70.55 34.54 208 19 ASN A 162 ? ? 94.09 65.80 209 19 THR A 166 ? ? -97.65 -63.96 210 19 PHE A 178 ? ? -87.73 -104.23 211 19 LYS A 184 ? ? 61.09 -79.71 212 20 HIS A -3 ? ? 61.48 -95.66 213 20 LYS A 83 ? ? 48.33 75.69 214 20 GLU A 98 ? ? -137.54 -60.10 215 20 ALA A 105 ? ? -130.34 -75.90 216 20 GLU A 115 ? ? -135.11 -46.07 217 20 LEU A 151 ? ? -117.42 63.68 218 20 ASN A 162 ? ? 98.51 79.72 219 20 THR A 166 ? ? -102.83 -68.22 220 20 HIS A 174 ? ? 76.64 -22.94 221 20 PHE A 178 ? ? -42.00 -73.39 222 20 LYS A 184 ? ? 61.27 -89.82 223 20 ILE A 185 ? ? -148.90 11.81 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 4 ARG A 114 ? ? 0.087 'SIDE CHAIN' 2 20 ARG A 188 ? ? 0.072 'SIDE CHAIN' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation 0.1162 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 400 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L5Y _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 6.251 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation -4.19 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method 'Violation analysis scripts from RECOORD in CNS.' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.0296 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.0134 _pdbx_nmr_ensemble_rms.entry_id 2L5Y _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L5Y _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.5-0.7 mM [U-99% 15N] PROTEIN (Stromal Interaction Molecule 2)-1, 20 mM TRIS-2, 100 mM sodium chloride-3, 10 mM Calcium Ion-4, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;0.5-0.7 mM [U-99% 13C; U-99% 15N] PROTEIN (Stromal Interaction Molecule 2)-5, 20 mM TRIS-6, 100 mM sodium chloride-7, 10 mM Calcium Ion-8, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' ;0.5-0.7 mM [U-99% 13C; U-99% 15N] PROTEIN (Stromal Interaction Molecule 2)-9, 20 mM TRIS-10, 100 mM sodium chloride-11, 10 mM CALCIUM ION-12, 100% D2O ; 3 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'PROTEIN (Stromal Interaction Molecule 2)-1' ? 0.5-0.7 mM '[U-99% 15N]' 1 TRIS-2 20 ? mM ? 1 'sodium chloride-3' 100 ? mM ? 1 'Calcium Ion-4' 10 ? mM ? 1 'PROTEIN (Stromal Interaction Molecule 2)-5' ? 0.5-0.7 mM '[U-99% 13C; U-99% 15N]' 2 TRIS-6 20 ? mM ? 2 'sodium chloride-7' 100 ? mM ? 2 'Calcium Ion-8' 10 ? mM ? 2 'PROTEIN (Stromal Interaction Molecule 2)-9' ? 0.5-0.7 mM '[U-99% 13C; U-99% 15N]' 3 TRIS-10 20 ? mM ? 3 'sodium chloride-11' 100 ? mM ? 3 'CALCIUM ION-12' 10 ? mM ? 3 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.temperature_units 1 105 7.5 ambient ? 288 K 2 105 ? ambient ? 288 K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '3D CBCA(CO)NH' 1 3 2 '3D HNCACB' 1 4 1 '3D 1H-15N NOESY' 2 5 3 '3D 1H-13C NOESY' 1 6 2 '3D HN(CO)CA' 1 7 2 '3D HNCA' 1 8 2 '3D HNCO' 1 9 2 '3D HBHA(CO)NH' 2 10 3 '2D 1H-13C HSQC' 2 11 3 '3D HCCH-TOCSY' 2 12 3 '3D HCCH-COSY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2L5Y _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 91 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2714 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 757 _pdbx_nmr_constraints.NOE_long_range_total_count 617 _pdbx_nmr_constraints.NOE_medium_range_total_count 667 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 667 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 88 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 88 # _pdbx_nmr_refine.entry_id 2L5Y _pdbx_nmr_refine.method 'torsion angle dynamics, DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ;Water refinement was performed using the RECOORD scripts (Nederveen et al., 2005) in CNS (v1.1) (Brunger et al., 1998)., Water refinement was performed using the RECOORD scripts (Nederveen et al., 2005) in CNS (v1.1) (Brunger et al., 1998). ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS v1.1 1 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA v2.1 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 3 'Bartels et al.' 'chemical shift assignment' XEASY ? 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 ILE N N N N 145 ILE CA C N S 146 ILE C C N N 147 ILE O O N N 148 ILE CB C N S 149 ILE CG1 C N N 150 ILE CG2 C N N 151 ILE CD1 C N N 152 ILE OXT O N N 153 ILE H H N N 154 ILE H2 H N N 155 ILE HA H N N 156 ILE HB H N N 157 ILE HG12 H N N 158 ILE HG13 H N N 159 ILE HG21 H N N 160 ILE HG22 H N N 161 ILE HG23 H N N 162 ILE HD11 H N N 163 ILE HD12 H N N 164 ILE HD13 H N N 165 ILE HXT H N N 166 LEU N N N N 167 LEU CA C N S 168 LEU C C N N 169 LEU O O N N 170 LEU CB C N N 171 LEU CG C N N 172 LEU CD1 C N N 173 LEU CD2 C N N 174 LEU OXT O N N 175 LEU H H N N 176 LEU H2 H N N 177 LEU HA H N N 178 LEU HB2 H N N 179 LEU HB3 H N N 180 LEU HG H N N 181 LEU HD11 H N N 182 LEU HD12 H N N 183 LEU HD13 H N N 184 LEU HD21 H N N 185 LEU HD22 H N N 186 LEU HD23 H N N 187 LEU HXT H N N 188 LYS N N N N 189 LYS CA C N S 190 LYS C C N N 191 LYS O O N N 192 LYS CB C N N 193 LYS CG C N N 194 LYS CD C N N 195 LYS CE C N N 196 LYS NZ N N N 197 LYS OXT O N N 198 LYS H H N N 199 LYS H2 H N N 200 LYS HA H N N 201 LYS HB2 H N N 202 LYS HB3 H N N 203 LYS HG2 H N N 204 LYS HG3 H N N 205 LYS HD2 H N N 206 LYS HD3 H N N 207 LYS HE2 H N N 208 LYS HE3 H N N 209 LYS HZ1 H N N 210 LYS HZ2 H N N 211 LYS HZ3 H N N 212 LYS HXT H N N 213 MET N N N N 214 MET CA C N S 215 MET C C N N 216 MET O O N N 217 MET CB C N N 218 MET CG C N N 219 MET SD S N N 220 MET CE C N N 221 MET OXT O N N 222 MET H H N N 223 MET H2 H N N 224 MET HA H N N 225 MET HB2 H N N 226 MET HB3 H N N 227 MET HG2 H N N 228 MET HG3 H N N 229 MET HE1 H N N 230 MET HE2 H N N 231 MET HE3 H N N 232 MET HXT H N N 233 PHE N N N N 234 PHE CA C N S 235 PHE C C N N 236 PHE O O N N 237 PHE CB C N N 238 PHE CG C Y N 239 PHE CD1 C Y N 240 PHE CD2 C Y N 241 PHE CE1 C Y N 242 PHE CE2 C Y N 243 PHE CZ C Y N 244 PHE OXT O N N 245 PHE H H N N 246 PHE H2 H N N 247 PHE HA H N N 248 PHE HB2 H N N 249 PHE HB3 H N N 250 PHE HD1 H N N 251 PHE HD2 H N N 252 PHE HE1 H N N 253 PHE HE2 H N N 254 PHE HZ H N N 255 PHE HXT H N N 256 PRO N N N N 257 PRO CA C N S 258 PRO C C N N 259 PRO O O N N 260 PRO CB C N N 261 PRO CG C N N 262 PRO CD C N N 263 PRO OXT O N N 264 PRO H H N N 265 PRO HA H N N 266 PRO HB2 H N N 267 PRO HB3 H N N 268 PRO HG2 H N N 269 PRO HG3 H N N 270 PRO HD2 H N N 271 PRO HD3 H N N 272 PRO HXT H N N 273 SER N N N N 274 SER CA C N S 275 SER C C N N 276 SER O O N N 277 SER CB C N N 278 SER OG O N N 279 SER OXT O N N 280 SER H H N N 281 SER H2 H N N 282 SER HA H N N 283 SER HB2 H N N 284 SER HB3 H N N 285 SER HG H N N 286 SER HXT H N N 287 THR N N N N 288 THR CA C N S 289 THR C C N N 290 THR O O N N 291 THR CB C N R 292 THR OG1 O N N 293 THR CG2 C N N 294 THR OXT O N N 295 THR H H N N 296 THR H2 H N N 297 THR HA H N N 298 THR HB H N N 299 THR HG1 H N N 300 THR HG21 H N N 301 THR HG22 H N N 302 THR HG23 H N N 303 THR HXT H N N 304 TRP N N N N 305 TRP CA C N S 306 TRP C C N N 307 TRP O O N N 308 TRP CB C N N 309 TRP CG C Y N 310 TRP CD1 C Y N 311 TRP CD2 C Y N 312 TRP NE1 N Y N 313 TRP CE2 C Y N 314 TRP CE3 C Y N 315 TRP CZ2 C Y N 316 TRP CZ3 C Y N 317 TRP CH2 C Y N 318 TRP OXT O N N 319 TRP H H N N 320 TRP H2 H N N 321 TRP HA H N N 322 TRP HB2 H N N 323 TRP HB3 H N N 324 TRP HD1 H N N 325 TRP HE1 H N N 326 TRP HE3 H N N 327 TRP HZ2 H N N 328 TRP HZ3 H N N 329 TRP HH2 H N N 330 TRP HXT H N N 331 TYR N N N N 332 TYR CA C N S 333 TYR C C N N 334 TYR O O N N 335 TYR CB C N N 336 TYR CG C Y N 337 TYR CD1 C Y N 338 TYR CD2 C Y N 339 TYR CE1 C Y N 340 TYR CE2 C Y N 341 TYR CZ C Y N 342 TYR OH O N N 343 TYR OXT O N N 344 TYR H H N N 345 TYR H2 H N N 346 TYR HA H N N 347 TYR HB2 H N N 348 TYR HB3 H N N 349 TYR HD1 H N N 350 TYR HD2 H N N 351 TYR HE1 H N N 352 TYR HE2 H N N 353 TYR HH H N N 354 TYR HXT H N N 355 VAL N N N N 356 VAL CA C N S 357 VAL C C N N 358 VAL O O N N 359 VAL CB C N N 360 VAL CG1 C N N 361 VAL CG2 C N N 362 VAL OXT O N N 363 VAL H H N N 364 VAL H2 H N N 365 VAL HA H N N 366 VAL HB H N N 367 VAL HG11 H N N 368 VAL HG12 H N N 369 VAL HG13 H N N 370 VAL HG21 H N N 371 VAL HG22 H N N 372 VAL HG23 H N N 373 VAL HXT H N N 374 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 800 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2L5Y _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_