data_2L6M # _entry.id 2L6M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2L6M pdb_00002l6m 10.2210/pdb2l6m/pdb RCSB RCSB102022 ? ? BMRB 17315 ? ? WWPDB D_1000102022 ? ? # _pdbx_database_related.db_id 17315 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L6M _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-11-23 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Barraud, P.' 1 'Allain, F.H.-T.' 2 # _citation.id primary _citation.title 'An extended dsRBD with a novel zinc-binding motif mediates nuclear retention of fission yeast Dicer.' _citation.journal_abbrev 'Embo J.' _citation.journal_volume 30 _citation.page_first 4223 _citation.page_last 4235 _citation.year 2011 _citation.journal_id_ASTM EMJODG _citation.country UK _citation.journal_id_ISSN 0261-4189 _citation.journal_id_CSD 0897 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21847092 _citation.pdbx_database_id_DOI 10.1038/emboj.2011.300 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Barraud, P.' 1 ? primary 'Emmerth, S.' 2 ? primary 'Shimada, Y.' 3 ? primary 'Hotz, H.R.' 4 ? primary 'Allain, F.H.' 5 ? primary 'Buhler, M.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein Dicer' 13978.260 1 '3.1.26.-, 3.6.4.-' ? 'UNP residues 1259-1358' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cell cycle control protein dcr1, RNA interference pathway protein dcr1, Endoribonuclease dcr1, ATP-dependent helicase dcr1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMKGDIEHKVYQLLKDQGCEDFGTKCVIEEVKSSHKTLLNTELHLTKYYGFSFFRHGNIVA YGKSRKVANAKYIMKQRLLKLLEDKSNLLLYSCNCKFSKKK ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMKGDIEHKVYQLLKDQGCEDFGTKCVIEEVKSSHKTLLNTELHLTKYYGFSFFRHGNIVA YGKSRKVANAKYIMKQRLLKLLEDKSNLLLYSCNCKFSKKK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 LYS n 1 23 GLY n 1 24 ASP n 1 25 ILE n 1 26 GLU n 1 27 HIS n 1 28 LYS n 1 29 VAL n 1 30 TYR n 1 31 GLN n 1 32 LEU n 1 33 LEU n 1 34 LYS n 1 35 ASP n 1 36 GLN n 1 37 GLY n 1 38 CYS n 1 39 GLU n 1 40 ASP n 1 41 PHE n 1 42 GLY n 1 43 THR n 1 44 LYS n 1 45 CYS n 1 46 VAL n 1 47 ILE n 1 48 GLU n 1 49 GLU n 1 50 VAL n 1 51 LYS n 1 52 SER n 1 53 SER n 1 54 HIS n 1 55 LYS n 1 56 THR n 1 57 LEU n 1 58 LEU n 1 59 ASN n 1 60 THR n 1 61 GLU n 1 62 LEU n 1 63 HIS n 1 64 LEU n 1 65 THR n 1 66 LYS n 1 67 TYR n 1 68 TYR n 1 69 GLY n 1 70 PHE n 1 71 SER n 1 72 PHE n 1 73 PHE n 1 74 ARG n 1 75 HIS n 1 76 GLY n 1 77 ASN n 1 78 ILE n 1 79 VAL n 1 80 ALA n 1 81 TYR n 1 82 GLY n 1 83 LYS n 1 84 SER n 1 85 ARG n 1 86 LYS n 1 87 VAL n 1 88 ALA n 1 89 ASN n 1 90 ALA n 1 91 LYS n 1 92 TYR n 1 93 ILE n 1 94 MET n 1 95 LYS n 1 96 GLN n 1 97 ARG n 1 98 LEU n 1 99 LEU n 1 100 LYS n 1 101 LEU n 1 102 LEU n 1 103 GLU n 1 104 ASP n 1 105 LYS n 1 106 SER n 1 107 ASN n 1 108 LEU n 1 109 LEU n 1 110 LEU n 1 111 TYR n 1 112 SER n 1 113 CYS n 1 114 ASN n 1 115 CYS n 1 116 LYS n 1 117 PHE n 1 118 SER n 1 119 LYS n 1 120 LYS n 1 121 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Fission yeast' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'dcr1, SPCC188.13c, SPCC584.10c' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Schizosaccharomyces pombe' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4896 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3) codon-plus (RIL)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET28a+ _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DCR1_SCHPO _struct_ref.pdbx_db_accession Q09884 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KGDIEHKVYQLLKDQGCEDFGTKCVIEEVKSSHKTLLNTELHLTKYYGFSFFRHGNIVAYGKSRKVANAKYIMKQRLLKL LEDKSNLLLYSCNCKFSKKK ; _struct_ref.pdbx_align_begin 1259 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L6M _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 22 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 121 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q09884 _struct_ref_seq.db_align_beg 1259 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1358 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 101 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2L6M MET A 1 ? UNP Q09884 ? ? 'expression tag' -19 1 1 2L6M GLY A 2 ? UNP Q09884 ? ? 'expression tag' -18 2 1 2L6M SER A 3 ? UNP Q09884 ? ? 'expression tag' -17 3 1 2L6M SER A 4 ? UNP Q09884 ? ? 'expression tag' -16 4 1 2L6M HIS A 5 ? UNP Q09884 ? ? 'expression tag' -15 5 1 2L6M HIS A 6 ? UNP Q09884 ? ? 'expression tag' -14 6 1 2L6M HIS A 7 ? UNP Q09884 ? ? 'expression tag' -13 7 1 2L6M HIS A 8 ? UNP Q09884 ? ? 'expression tag' -12 8 1 2L6M HIS A 9 ? UNP Q09884 ? ? 'expression tag' -11 9 1 2L6M HIS A 10 ? UNP Q09884 ? ? 'expression tag' -10 10 1 2L6M SER A 11 ? UNP Q09884 ? ? 'expression tag' -9 11 1 2L6M SER A 12 ? UNP Q09884 ? ? 'expression tag' -8 12 1 2L6M GLY A 13 ? UNP Q09884 ? ? 'expression tag' -7 13 1 2L6M LEU A 14 ? UNP Q09884 ? ? 'expression tag' -6 14 1 2L6M VAL A 15 ? UNP Q09884 ? ? 'expression tag' -5 15 1 2L6M PRO A 16 ? UNP Q09884 ? ? 'expression tag' -4 16 1 2L6M ARG A 17 ? UNP Q09884 ? ? 'expression tag' -3 17 1 2L6M GLY A 18 ? UNP Q09884 ? ? 'expression tag' -2 18 1 2L6M SER A 19 ? UNP Q09884 ? ? 'expression tag' -1 19 1 2L6M HIS A 20 ? UNP Q09884 ? ? 'expression tag' 0 20 1 2L6M MET A 21 ? UNP Q09884 ? ? 'expression tag' 1 21 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 3 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCA' 1 4 1 '3D HNCACB' 1 5 1 '3D CBCA(CO)NH' 1 6 3 '3D 1H-15N TOCSY' 1 7 1 '3D HCCH-TOCSY' 1 8 3 '3D 1H-15N NOESY' 1 9 1 '3D 1H-13C NOESY' 1 10 2 '2D 1H-1H TOCSY' 1 11 2 '2D 1H-1H NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298.0 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.5 mM [U-100% 13C; U-100% 15N] dsRBD-1, 25 mM sodium phosphate-2, 75 mM potassium chloride-3, 2 mM DTT-4, 0.01 mM ZINC ION-5, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' '0.5 mM dsRBD-6, 25 mM sodium phosphate-7, 75 mM potassium chloride-8, 2 mM DTT-9, 0.01 mM ZINC ION-10, 100% D2O' 2 '100% D2O' ;0.5 mM [U-100% 15N] dsRBD-11, 25 mM sodium phosphate-12, 75 mM potassium chloride-13, 2 mM DTT-14, 0.01 mM ZINC ION-15, 90% H2O/10% D2O ; 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 700 Bruker AVANCE 2 'Bruker Avance' 900 Bruker AVANCE 3 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2L6M _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L6M _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.43 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L6M _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'automatic noe assignment' CYANA ? 1 'Guntert, Mumenthaler and Wuthrich' 'structure calculation' CYANA ? 2 Goddard 'data analysis' Sparky ? 3 Goddard 'chemical shift assignment' Sparky ? 4 'Herrmann, Guntert and Wuthrich' 'peak picking' ATNOS/CANDID ? 5 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L6M _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L6M _struct.title 'Structure of C-terminal dsRBD of the Fission Yeast DICER (Dcr1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L6M _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'dsRBD, dicer, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 24 ? LYS A 34 ? ASP A 4 LYS A 14 1 ? 11 HELX_P HELX_P2 2 LYS A 86 ? LYS A 105 ? LYS A 66 LYS A 85 1 ? 20 HELX_P HELX_P3 3 SER A 106 ? TYR A 111 ? SER A 86 TYR A 91 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 38 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 18 A ZN 201 1_555 ? ? ? ? ? ? ? 2.326 ? ? metalc2 metalc ? ? A HIS 75 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 55 A ZN 201 1_555 ? ? ? ? ? ? ? 2.047 ? ? metalc3 metalc ? ? A CYS 113 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 93 A ZN 201 1_555 ? ? ? ? ? ? ? 2.310 ? ? metalc4 metalc ? ? A CYS 115 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 95 A ZN 201 1_555 ? ? ? ? ? ? ? 2.321 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 41 ? GLU A 49 ? PHE A 21 GLU A 29 A 2 LYS A 66 ? ARG A 74 ? LYS A 46 ARG A 54 A 3 ASN A 77 ? SER A 84 ? ASN A 57 SER A 64 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 42 ? N GLY A 22 O PHE A 73 ? O PHE A 53 A 2 3 N TYR A 68 ? N TYR A 48 O SER A 84 ? O SER A 64 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 38 ? CYS A 18 . ? 1_555 ? 2 AC1 4 HIS A 75 ? HIS A 55 . ? 1_555 ? 3 AC1 4 CYS A 113 ? CYS A 93 . ? 1_555 ? 4 AC1 4 CYS A 115 ? CYS A 95 . ? 1_555 ? # _atom_sites.entry_id 2L6M _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 LEU 14 -6 ? ? ? A . n A 1 15 VAL 15 -5 ? ? ? A . n A 1 16 PRO 16 -4 ? ? ? A . n A 1 17 ARG 17 -3 ? ? ? A . n A 1 18 GLY 18 -2 ? ? ? A . n A 1 19 SER 19 -1 ? ? ? A . n A 1 20 HIS 20 0 ? ? ? A . n A 1 21 MET 21 1 1 MET MET A . n A 1 22 LYS 22 2 2 LYS LYS A . n A 1 23 GLY 23 3 3 GLY GLY A . n A 1 24 ASP 24 4 4 ASP ASP A . n A 1 25 ILE 25 5 5 ILE ILE A . n A 1 26 GLU 26 6 6 GLU GLU A . n A 1 27 HIS 27 7 7 HIS HIS A . n A 1 28 LYS 28 8 8 LYS LYS A . n A 1 29 VAL 29 9 9 VAL VAL A . n A 1 30 TYR 30 10 10 TYR TYR A . n A 1 31 GLN 31 11 11 GLN GLN A . n A 1 32 LEU 32 12 12 LEU LEU A . n A 1 33 LEU 33 13 13 LEU LEU A . n A 1 34 LYS 34 14 14 LYS LYS A . n A 1 35 ASP 35 15 15 ASP ASP A . n A 1 36 GLN 36 16 16 GLN GLN A . n A 1 37 GLY 37 17 17 GLY GLY A . n A 1 38 CYS 38 18 18 CYS CYS A . n A 1 39 GLU 39 19 19 GLU GLU A . n A 1 40 ASP 40 20 20 ASP ASP A . n A 1 41 PHE 41 21 21 PHE PHE A . n A 1 42 GLY 42 22 22 GLY GLY A . n A 1 43 THR 43 23 23 THR THR A . n A 1 44 LYS 44 24 24 LYS LYS A . n A 1 45 CYS 45 25 25 CYS CYS A . n A 1 46 VAL 46 26 26 VAL VAL A . n A 1 47 ILE 47 27 27 ILE ILE A . n A 1 48 GLU 48 28 28 GLU GLU A . n A 1 49 GLU 49 29 29 GLU GLU A . n A 1 50 VAL 50 30 30 VAL VAL A . n A 1 51 LYS 51 31 31 LYS LYS A . n A 1 52 SER 52 32 32 SER SER A . n A 1 53 SER 53 33 33 SER SER A . n A 1 54 HIS 54 34 34 HIS HIS A . n A 1 55 LYS 55 35 35 LYS LYS A . n A 1 56 THR 56 36 36 THR THR A . n A 1 57 LEU 57 37 37 LEU LEU A . n A 1 58 LEU 58 38 38 LEU LEU A . n A 1 59 ASN 59 39 39 ASN ASN A . n A 1 60 THR 60 40 40 THR THR A . n A 1 61 GLU 61 41 41 GLU GLU A . n A 1 62 LEU 62 42 42 LEU LEU A . n A 1 63 HIS 63 43 43 HIS HIS A . n A 1 64 LEU 64 44 44 LEU LEU A . n A 1 65 THR 65 45 45 THR THR A . n A 1 66 LYS 66 46 46 LYS LYS A . n A 1 67 TYR 67 47 47 TYR TYR A . n A 1 68 TYR 68 48 48 TYR TYR A . n A 1 69 GLY 69 49 49 GLY GLY A . n A 1 70 PHE 70 50 50 PHE PHE A . n A 1 71 SER 71 51 51 SER SER A . n A 1 72 PHE 72 52 52 PHE PHE A . n A 1 73 PHE 73 53 53 PHE PHE A . n A 1 74 ARG 74 54 54 ARG ARG A . n A 1 75 HIS 75 55 55 HIS HIS A . n A 1 76 GLY 76 56 56 GLY GLY A . n A 1 77 ASN 77 57 57 ASN ASN A . n A 1 78 ILE 78 58 58 ILE ILE A . n A 1 79 VAL 79 59 59 VAL VAL A . n A 1 80 ALA 80 60 60 ALA ALA A . n A 1 81 TYR 81 61 61 TYR TYR A . n A 1 82 GLY 82 62 62 GLY GLY A . n A 1 83 LYS 83 63 63 LYS LYS A . n A 1 84 SER 84 64 64 SER SER A . n A 1 85 ARG 85 65 65 ARG ARG A . n A 1 86 LYS 86 66 66 LYS LYS A . n A 1 87 VAL 87 67 67 VAL VAL A . n A 1 88 ALA 88 68 68 ALA ALA A . n A 1 89 ASN 89 69 69 ASN ASN A . n A 1 90 ALA 90 70 70 ALA ALA A . n A 1 91 LYS 91 71 71 LYS LYS A . n A 1 92 TYR 92 72 72 TYR TYR A . n A 1 93 ILE 93 73 73 ILE ILE A . n A 1 94 MET 94 74 74 MET MET A . n A 1 95 LYS 95 75 75 LYS LYS A . n A 1 96 GLN 96 76 76 GLN GLN A . n A 1 97 ARG 97 77 77 ARG ARG A . n A 1 98 LEU 98 78 78 LEU LEU A . n A 1 99 LEU 99 79 79 LEU LEU A . n A 1 100 LYS 100 80 80 LYS LYS A . n A 1 101 LEU 101 81 81 LEU LEU A . n A 1 102 LEU 102 82 82 LEU LEU A . n A 1 103 GLU 103 83 83 GLU GLU A . n A 1 104 ASP 104 84 84 ASP ASP A . n A 1 105 LYS 105 85 85 LYS LYS A . n A 1 106 SER 106 86 86 SER SER A . n A 1 107 ASN 107 87 87 ASN ASN A . n A 1 108 LEU 108 88 88 LEU LEU A . n A 1 109 LEU 109 89 89 LEU LEU A . n A 1 110 LEU 110 90 90 LEU LEU A . n A 1 111 TYR 111 91 91 TYR TYR A . n A 1 112 SER 112 92 92 SER SER A . n A 1 113 CYS 113 93 93 CYS CYS A . n A 1 114 ASN 114 94 94 ASN ASN A . n A 1 115 CYS 115 95 95 CYS CYS A . n A 1 116 LYS 116 96 96 LYS LYS A . n A 1 117 PHE 117 97 97 PHE PHE A . n A 1 118 SER 118 98 98 SER SER A . n A 1 119 LYS 119 99 99 LYS LYS A . n A 1 120 LYS 120 100 100 LYS LYS A . n A 1 121 LYS 121 101 101 LYS LYS A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 38 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 75 ? A HIS 55 ? 1_555 110.4 ? 2 SG ? A CYS 38 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 113 ? A CYS 93 ? 1_555 109.2 ? 3 NE2 ? A HIS 75 ? A HIS 55 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 113 ? A CYS 93 ? 1_555 107.2 ? 4 SG ? A CYS 38 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 115 ? A CYS 95 ? 1_555 112.0 ? 5 NE2 ? A HIS 75 ? A HIS 55 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 115 ? A CYS 95 ? 1_555 106.3 ? 6 SG ? A CYS 113 ? A CYS 93 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 115 ? A CYS 95 ? 1_555 111.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-08-24 2 'Structure model' 1 1 2011-10-26 3 'Structure model' 1 2 2020-02-05 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' struct_ref_seq_dif 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_database_status 7 4 'Structure model' pdbx_struct_conn_angle 8 4 'Structure model' struct_conn 9 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' 7 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.value' 19 4 'Structure model' '_struct_conn.pdbx_dist_value' 20 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 21 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 24 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 25 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 26 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 27 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id dsRBD-1 0.5 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium phosphate-2' 25 ? mM ? 1 'potassium chloride-3' 75 ? mM ? 1 DTT-4 2 ? mM ? 1 'ZINC ION-5' 0.01 ? mM ? 1 dsRBD-6 0.5 ? mM ? 2 'sodium phosphate-7' 25 ? mM ? 2 'potassium chloride-8' 75 ? mM ? 2 DTT-9 2 ? mM ? 2 'ZINC ION-10' 0.01 ? mM ? 2 dsRBD-11 0.5 ? mM '[U-100% 15N]' 3 'sodium phosphate-12' 25 ? mM ? 3 'potassium chloride-13' 75 ? mM ? 3 DTT-14 2 ? mM ? 3 'ZINC ION-15' 0.01 ? mM ? 3 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2L6M _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2308 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 520 _pdbx_nmr_constraints.NOE_long_range_total_count 667 _pdbx_nmr_constraints.NOE_medium_range_total_count 521 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 600 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 28 ? ? HZ1 A LYS 63 ? ? 1.59 2 1 HG1 A THR 36 ? ? OE1 A GLU 41 ? ? 1.59 3 3 HZ1 A LYS 31 ? ? OE2 A GLU 41 ? ? 1.58 4 5 HZ1 A LYS 100 ? ? OXT A LYS 101 ? ? 1.60 5 8 HG A LEU 38 ? ? H A ASN 39 ? ? 1.34 6 8 HZ1 A LYS 35 ? ? OE1 A GLU 41 ? ? 1.59 7 10 OE1 A GLU 29 ? ? HZ1 A LYS 35 ? ? 1.58 8 15 HD12 A LEU 13 ? ? HH11 A ARG 54 ? ? 1.30 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 41 ? ? -54.86 96.08 2 1 ASN A 94 ? ? -105.18 40.61 3 1 LYS A 96 ? ? -134.18 -57.50 4 1 PHE A 97 ? ? -160.90 -168.05 5 1 SER A 98 ? ? -68.80 -167.22 6 2 LYS A 2 ? ? -143.59 -78.90 7 2 SER A 33 ? ? -82.67 37.81 8 2 ASN A 39 ? ? -49.95 -80.09 9 2 THR A 40 ? ? -106.24 -165.24 10 2 ASN A 94 ? ? -108.05 73.40 11 2 LYS A 96 ? ? -150.98 -47.81 12 3 PHE A 21 ? ? -170.34 149.00 13 3 LYS A 31 ? ? -51.85 106.38 14 3 ASN A 39 ? ? -48.46 -75.64 15 3 GLU A 41 ? ? -55.11 99.47 16 3 ASN A 94 ? ? -116.96 69.33 17 3 LYS A 96 ? ? -161.49 -48.42 18 4 SER A 32 ? ? -129.83 -168.96 19 4 HIS A 34 ? ? -66.76 99.32 20 4 LYS A 35 ? ? -168.44 -45.42 21 4 LEU A 37 ? ? 54.10 88.51 22 4 THR A 40 ? ? -111.82 -151.06 23 4 LEU A 42 ? ? 67.46 -71.83 24 4 HIS A 43 ? ? -170.30 97.58 25 4 LYS A 96 ? ? -150.46 -46.86 26 4 LYS A 99 ? ? 72.12 48.59 27 5 GLU A 41 ? ? -56.26 101.29 28 5 THR A 45 ? ? -66.04 97.06 29 5 LYS A 96 ? ? -156.82 -44.48 30 5 SER A 98 ? ? 177.75 148.86 31 5 LYS A 99 ? ? 72.07 -36.65 32 6 LYS A 2 ? ? 74.96 116.10 33 6 LYS A 31 ? ? -177.13 -165.88 34 6 HIS A 34 ? ? -83.29 45.52 35 6 LEU A 37 ? ? 58.55 93.30 36 6 LEU A 38 ? ? -144.40 -150.56 37 6 THR A 45 ? ? -58.72 107.16 38 6 ASN A 94 ? ? -113.39 66.33 39 6 LYS A 96 ? ? -158.07 -45.66 40 7 ASP A 20 ? ? -159.27 76.65 41 7 PHE A 21 ? ? -171.34 147.54 42 7 SER A 33 ? ? -108.88 -168.67 43 7 LEU A 38 ? ? -122.80 -163.26 44 7 ASN A 39 ? ? -44.97 -70.22 45 7 THR A 40 ? ? -118.10 -151.58 46 7 HIS A 43 ? ? -67.40 98.57 47 7 ASN A 94 ? ? -108.79 68.02 48 8 HIS A 34 ? ? 71.91 30.05 49 8 LEU A 38 ? ? -140.29 -69.26 50 8 ASN A 39 ? ? -145.30 -75.84 51 8 GLU A 41 ? ? -66.00 99.02 52 8 LEU A 42 ? ? -24.50 -73.00 53 8 LYS A 85 ? ? 63.07 60.74 54 8 ASN A 94 ? ? -113.57 73.10 55 8 LYS A 96 ? ? -155.56 -42.43 56 8 LYS A 100 ? ? -113.98 -169.55 57 9 PHE A 21 ? ? -173.11 149.50 58 9 VAL A 30 ? ? -90.23 -97.06 59 9 ASN A 39 ? ? 175.00 -82.61 60 9 THR A 40 ? ? -104.95 -152.52 61 9 THR A 45 ? ? -58.38 107.12 62 10 THR A 40 ? ? -118.57 -158.40 63 10 HIS A 43 ? ? -171.33 100.13 64 10 LYS A 96 ? ? -171.29 -37.43 65 10 LYS A 100 ? ? 175.04 -28.28 66 11 ASN A 39 ? ? -54.28 -70.41 67 11 THR A 40 ? ? -95.35 -110.35 68 11 HIS A 43 ? ? 63.23 85.40 69 11 HIS A 55 ? ? 59.53 19.42 70 11 ASN A 94 ? ? -111.76 75.05 71 11 LYS A 96 ? ? -147.75 -54.03 72 11 SER A 98 ? ? 179.07 -174.12 73 12 LYS A 35 ? ? -63.66 -75.16 74 12 LEU A 37 ? ? -116.46 67.92 75 12 LEU A 38 ? ? -168.73 -162.09 76 12 ASN A 39 ? ? -53.03 -74.53 77 12 HIS A 43 ? ? -160.65 103.15 78 12 THR A 45 ? ? -58.19 98.21 79 12 LYS A 85 ? ? 72.46 38.71 80 12 ASN A 87 ? ? -67.83 1.23 81 12 ASN A 94 ? ? -105.15 73.13 82 13 ASN A 39 ? ? 31.85 -93.37 83 13 THR A 45 ? ? -56.56 107.11 84 13 ASN A 94 ? ? -112.95 65.87 85 13 LYS A 96 ? ? -158.07 -42.27 86 13 SER A 98 ? ? -174.61 146.57 87 13 LYS A 99 ? ? 61.29 78.01 88 14 ASP A 4 ? ? -96.00 43.66 89 14 ASN A 39 ? ? -52.47 -73.46 90 14 GLU A 41 ? ? -58.69 97.30 91 14 THR A 45 ? ? -66.38 94.78 92 14 ASN A 94 ? ? -106.74 70.13 93 14 SER A 98 ? ? -179.62 -152.11 94 14 LYS A 100 ? ? -81.47 -73.24 95 15 LYS A 2 ? ? -172.77 139.79 96 15 SER A 32 ? ? -105.58 -166.65 97 15 ASN A 94 ? ? -113.87 76.61 98 15 LYS A 96 ? ? -163.50 -56.52 99 15 SER A 98 ? ? 174.38 175.79 100 16 ASP A 20 ? ? -153.01 80.83 101 16 HIS A 43 ? ? 58.13 74.16 102 16 THR A 45 ? ? -58.48 102.87 103 16 ASN A 94 ? ? -108.96 77.42 104 17 LEU A 38 ? ? 179.43 -159.39 105 17 THR A 40 ? ? -145.30 -81.65 106 17 LEU A 42 ? ? -38.35 127.03 107 17 ASN A 94 ? ? -109.83 68.95 108 17 LYS A 96 ? ? -153.53 -46.09 109 18 LEU A 38 ? ? -168.16 -166.47 110 18 ASN A 39 ? ? -50.42 -71.11 111 18 THR A 40 ? ? -104.30 -160.11 112 18 ASN A 94 ? ? -111.61 73.01 113 18 LYS A 96 ? ? -156.25 -34.73 114 19 LEU A 38 ? ? -135.72 -66.46 115 19 ASN A 39 ? ? -173.82 -73.08 116 19 GLU A 41 ? ? -57.94 94.33 117 19 LEU A 42 ? ? -33.73 -75.75 118 19 THR A 45 ? ? -67.69 98.69 119 19 ASN A 94 ? ? -110.90 71.91 120 19 LYS A 96 ? ? -149.67 -44.37 121 19 SER A 98 ? ? -176.60 -179.38 122 19 LYS A 99 ? ? 55.91 71.04 123 20 THR A 36 ? ? -177.26 145.57 124 20 LEU A 38 ? ? -162.16 -166.67 125 20 THR A 40 ? ? -113.39 -154.70 126 20 GLU A 41 ? ? -90.24 30.45 127 20 LEU A 42 ? ? 60.95 -86.88 128 20 ASN A 94 ? ? -111.27 66.37 129 20 LYS A 96 ? ? -136.97 -48.05 130 20 SER A 98 ? ? 172.27 -163.50 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 14 1 Y 1 A LEU -6 ? A LEU 14 15 1 Y 1 A VAL -5 ? A VAL 15 16 1 Y 1 A PRO -4 ? A PRO 16 17 1 Y 1 A ARG -3 ? A ARG 17 18 1 Y 1 A GLY -2 ? A GLY 18 19 1 Y 1 A SER -1 ? A SER 19 20 1 Y 1 A HIS 0 ? A HIS 20 21 2 Y 1 A MET -19 ? A MET 1 22 2 Y 1 A GLY -18 ? A GLY 2 23 2 Y 1 A SER -17 ? A SER 3 24 2 Y 1 A SER -16 ? A SER 4 25 2 Y 1 A HIS -15 ? A HIS 5 26 2 Y 1 A HIS -14 ? A HIS 6 27 2 Y 1 A HIS -13 ? A HIS 7 28 2 Y 1 A HIS -12 ? A HIS 8 29 2 Y 1 A HIS -11 ? A HIS 9 30 2 Y 1 A HIS -10 ? A HIS 10 31 2 Y 1 A SER -9 ? A SER 11 32 2 Y 1 A SER -8 ? A SER 12 33 2 Y 1 A GLY -7 ? A GLY 13 34 2 Y 1 A LEU -6 ? A LEU 14 35 2 Y 1 A VAL -5 ? A VAL 15 36 2 Y 1 A PRO -4 ? A PRO 16 37 2 Y 1 A ARG -3 ? A ARG 17 38 2 Y 1 A GLY -2 ? A GLY 18 39 2 Y 1 A SER -1 ? A SER 19 40 2 Y 1 A HIS 0 ? A HIS 20 41 3 Y 1 A MET -19 ? A MET 1 42 3 Y 1 A GLY -18 ? A GLY 2 43 3 Y 1 A SER -17 ? A SER 3 44 3 Y 1 A SER -16 ? A SER 4 45 3 Y 1 A HIS -15 ? A HIS 5 46 3 Y 1 A HIS -14 ? A HIS 6 47 3 Y 1 A HIS -13 ? A HIS 7 48 3 Y 1 A HIS -12 ? A HIS 8 49 3 Y 1 A HIS -11 ? A HIS 9 50 3 Y 1 A HIS -10 ? A HIS 10 51 3 Y 1 A SER -9 ? A SER 11 52 3 Y 1 A SER -8 ? A SER 12 53 3 Y 1 A GLY -7 ? A GLY 13 54 3 Y 1 A LEU -6 ? A LEU 14 55 3 Y 1 A VAL -5 ? A VAL 15 56 3 Y 1 A PRO -4 ? A PRO 16 57 3 Y 1 A ARG -3 ? A ARG 17 58 3 Y 1 A GLY -2 ? A GLY 18 59 3 Y 1 A SER -1 ? A SER 19 60 3 Y 1 A HIS 0 ? A HIS 20 61 4 Y 1 A MET -19 ? A MET 1 62 4 Y 1 A GLY -18 ? A GLY 2 63 4 Y 1 A SER -17 ? A SER 3 64 4 Y 1 A SER -16 ? A SER 4 65 4 Y 1 A HIS -15 ? A HIS 5 66 4 Y 1 A HIS -14 ? A HIS 6 67 4 Y 1 A HIS -13 ? A HIS 7 68 4 Y 1 A HIS -12 ? A HIS 8 69 4 Y 1 A HIS -11 ? A HIS 9 70 4 Y 1 A HIS -10 ? A HIS 10 71 4 Y 1 A SER -9 ? A SER 11 72 4 Y 1 A SER -8 ? A SER 12 73 4 Y 1 A GLY -7 ? A GLY 13 74 4 Y 1 A LEU -6 ? A LEU 14 75 4 Y 1 A VAL -5 ? A VAL 15 76 4 Y 1 A PRO -4 ? A PRO 16 77 4 Y 1 A ARG -3 ? A ARG 17 78 4 Y 1 A GLY -2 ? A GLY 18 79 4 Y 1 A SER -1 ? A SER 19 80 4 Y 1 A HIS 0 ? A HIS 20 81 5 Y 1 A MET -19 ? A MET 1 82 5 Y 1 A GLY -18 ? A GLY 2 83 5 Y 1 A SER -17 ? A SER 3 84 5 Y 1 A SER -16 ? A SER 4 85 5 Y 1 A HIS -15 ? A HIS 5 86 5 Y 1 A HIS -14 ? A HIS 6 87 5 Y 1 A HIS -13 ? A HIS 7 88 5 Y 1 A HIS -12 ? A HIS 8 89 5 Y 1 A HIS -11 ? A HIS 9 90 5 Y 1 A HIS -10 ? A HIS 10 91 5 Y 1 A SER -9 ? A SER 11 92 5 Y 1 A SER -8 ? A SER 12 93 5 Y 1 A GLY -7 ? A GLY 13 94 5 Y 1 A LEU -6 ? A LEU 14 95 5 Y 1 A VAL -5 ? A VAL 15 96 5 Y 1 A PRO -4 ? A PRO 16 97 5 Y 1 A ARG -3 ? A ARG 17 98 5 Y 1 A GLY -2 ? A GLY 18 99 5 Y 1 A SER -1 ? A SER 19 100 5 Y 1 A HIS 0 ? A HIS 20 101 6 Y 1 A MET -19 ? A MET 1 102 6 Y 1 A GLY -18 ? A GLY 2 103 6 Y 1 A SER -17 ? A SER 3 104 6 Y 1 A SER -16 ? A SER 4 105 6 Y 1 A HIS -15 ? A HIS 5 106 6 Y 1 A HIS -14 ? A HIS 6 107 6 Y 1 A HIS -13 ? A HIS 7 108 6 Y 1 A HIS -12 ? A HIS 8 109 6 Y 1 A HIS -11 ? A HIS 9 110 6 Y 1 A HIS -10 ? A HIS 10 111 6 Y 1 A SER -9 ? A SER 11 112 6 Y 1 A SER -8 ? A SER 12 113 6 Y 1 A GLY -7 ? A GLY 13 114 6 Y 1 A LEU -6 ? A LEU 14 115 6 Y 1 A VAL -5 ? A VAL 15 116 6 Y 1 A PRO -4 ? A PRO 16 117 6 Y 1 A ARG -3 ? A ARG 17 118 6 Y 1 A GLY -2 ? A GLY 18 119 6 Y 1 A SER -1 ? A SER 19 120 6 Y 1 A HIS 0 ? A HIS 20 121 7 Y 1 A MET -19 ? A MET 1 122 7 Y 1 A GLY -18 ? A GLY 2 123 7 Y 1 A SER -17 ? A SER 3 124 7 Y 1 A SER -16 ? A SER 4 125 7 Y 1 A HIS -15 ? A HIS 5 126 7 Y 1 A HIS -14 ? A HIS 6 127 7 Y 1 A HIS -13 ? A HIS 7 128 7 Y 1 A HIS -12 ? A HIS 8 129 7 Y 1 A HIS -11 ? A HIS 9 130 7 Y 1 A HIS -10 ? A HIS 10 131 7 Y 1 A SER -9 ? A SER 11 132 7 Y 1 A SER -8 ? A SER 12 133 7 Y 1 A GLY -7 ? A GLY 13 134 7 Y 1 A LEU -6 ? A LEU 14 135 7 Y 1 A VAL -5 ? A VAL 15 136 7 Y 1 A PRO -4 ? A PRO 16 137 7 Y 1 A ARG -3 ? A ARG 17 138 7 Y 1 A GLY -2 ? A GLY 18 139 7 Y 1 A SER -1 ? A SER 19 140 7 Y 1 A HIS 0 ? A HIS 20 141 8 Y 1 A MET -19 ? A MET 1 142 8 Y 1 A GLY -18 ? A GLY 2 143 8 Y 1 A SER -17 ? A SER 3 144 8 Y 1 A SER -16 ? A SER 4 145 8 Y 1 A HIS -15 ? A HIS 5 146 8 Y 1 A HIS -14 ? A HIS 6 147 8 Y 1 A HIS -13 ? A HIS 7 148 8 Y 1 A HIS -12 ? A HIS 8 149 8 Y 1 A HIS -11 ? A HIS 9 150 8 Y 1 A HIS -10 ? A HIS 10 151 8 Y 1 A SER -9 ? A SER 11 152 8 Y 1 A SER -8 ? A SER 12 153 8 Y 1 A GLY -7 ? A GLY 13 154 8 Y 1 A LEU -6 ? A LEU 14 155 8 Y 1 A VAL -5 ? A VAL 15 156 8 Y 1 A PRO -4 ? A PRO 16 157 8 Y 1 A ARG -3 ? A ARG 17 158 8 Y 1 A GLY -2 ? A GLY 18 159 8 Y 1 A SER -1 ? A SER 19 160 8 Y 1 A HIS 0 ? A HIS 20 161 9 Y 1 A MET -19 ? A MET 1 162 9 Y 1 A GLY -18 ? A GLY 2 163 9 Y 1 A SER -17 ? A SER 3 164 9 Y 1 A SER -16 ? A SER 4 165 9 Y 1 A HIS -15 ? A HIS 5 166 9 Y 1 A HIS -14 ? A HIS 6 167 9 Y 1 A HIS -13 ? A HIS 7 168 9 Y 1 A HIS -12 ? A HIS 8 169 9 Y 1 A HIS -11 ? A HIS 9 170 9 Y 1 A HIS -10 ? A HIS 10 171 9 Y 1 A SER -9 ? A SER 11 172 9 Y 1 A SER -8 ? A SER 12 173 9 Y 1 A GLY -7 ? A GLY 13 174 9 Y 1 A LEU -6 ? A LEU 14 175 9 Y 1 A VAL -5 ? A VAL 15 176 9 Y 1 A PRO -4 ? A PRO 16 177 9 Y 1 A ARG -3 ? A ARG 17 178 9 Y 1 A GLY -2 ? A GLY 18 179 9 Y 1 A SER -1 ? A SER 19 180 9 Y 1 A HIS 0 ? A HIS 20 181 10 Y 1 A MET -19 ? A MET 1 182 10 Y 1 A GLY -18 ? A GLY 2 183 10 Y 1 A SER -17 ? A SER 3 184 10 Y 1 A SER -16 ? A SER 4 185 10 Y 1 A HIS -15 ? A HIS 5 186 10 Y 1 A HIS -14 ? A HIS 6 187 10 Y 1 A HIS -13 ? A HIS 7 188 10 Y 1 A HIS -12 ? A HIS 8 189 10 Y 1 A HIS -11 ? A HIS 9 190 10 Y 1 A HIS -10 ? A HIS 10 191 10 Y 1 A SER -9 ? A SER 11 192 10 Y 1 A SER -8 ? A SER 12 193 10 Y 1 A GLY -7 ? A GLY 13 194 10 Y 1 A LEU -6 ? A LEU 14 195 10 Y 1 A VAL -5 ? A VAL 15 196 10 Y 1 A PRO -4 ? A PRO 16 197 10 Y 1 A ARG -3 ? A ARG 17 198 10 Y 1 A GLY -2 ? A GLY 18 199 10 Y 1 A SER -1 ? A SER 19 200 10 Y 1 A HIS 0 ? A HIS 20 201 11 Y 1 A MET -19 ? A MET 1 202 11 Y 1 A GLY -18 ? A GLY 2 203 11 Y 1 A SER -17 ? A SER 3 204 11 Y 1 A SER -16 ? A SER 4 205 11 Y 1 A HIS -15 ? A HIS 5 206 11 Y 1 A HIS -14 ? A HIS 6 207 11 Y 1 A HIS -13 ? A HIS 7 208 11 Y 1 A HIS -12 ? A HIS 8 209 11 Y 1 A HIS -11 ? A HIS 9 210 11 Y 1 A HIS -10 ? A HIS 10 211 11 Y 1 A SER -9 ? A SER 11 212 11 Y 1 A SER -8 ? A SER 12 213 11 Y 1 A GLY -7 ? A GLY 13 214 11 Y 1 A LEU -6 ? A LEU 14 215 11 Y 1 A VAL -5 ? A VAL 15 216 11 Y 1 A PRO -4 ? A PRO 16 217 11 Y 1 A ARG -3 ? A ARG 17 218 11 Y 1 A GLY -2 ? A GLY 18 219 11 Y 1 A SER -1 ? A SER 19 220 11 Y 1 A HIS 0 ? A HIS 20 221 12 Y 1 A MET -19 ? A MET 1 222 12 Y 1 A GLY -18 ? A GLY 2 223 12 Y 1 A SER -17 ? A SER 3 224 12 Y 1 A SER -16 ? A SER 4 225 12 Y 1 A HIS -15 ? A HIS 5 226 12 Y 1 A HIS -14 ? A HIS 6 227 12 Y 1 A HIS -13 ? A HIS 7 228 12 Y 1 A HIS -12 ? A HIS 8 229 12 Y 1 A HIS -11 ? A HIS 9 230 12 Y 1 A HIS -10 ? A HIS 10 231 12 Y 1 A SER -9 ? A SER 11 232 12 Y 1 A SER -8 ? A SER 12 233 12 Y 1 A GLY -7 ? A GLY 13 234 12 Y 1 A LEU -6 ? A LEU 14 235 12 Y 1 A VAL -5 ? A VAL 15 236 12 Y 1 A PRO -4 ? A PRO 16 237 12 Y 1 A ARG -3 ? A ARG 17 238 12 Y 1 A GLY -2 ? A GLY 18 239 12 Y 1 A SER -1 ? A SER 19 240 12 Y 1 A HIS 0 ? A HIS 20 241 13 Y 1 A MET -19 ? A MET 1 242 13 Y 1 A GLY -18 ? A GLY 2 243 13 Y 1 A SER -17 ? A SER 3 244 13 Y 1 A SER -16 ? A SER 4 245 13 Y 1 A HIS -15 ? A HIS 5 246 13 Y 1 A HIS -14 ? A HIS 6 247 13 Y 1 A HIS -13 ? A HIS 7 248 13 Y 1 A HIS -12 ? A HIS 8 249 13 Y 1 A HIS -11 ? A HIS 9 250 13 Y 1 A HIS -10 ? A HIS 10 251 13 Y 1 A SER -9 ? A SER 11 252 13 Y 1 A SER -8 ? A SER 12 253 13 Y 1 A GLY -7 ? A GLY 13 254 13 Y 1 A LEU -6 ? A LEU 14 255 13 Y 1 A VAL -5 ? A VAL 15 256 13 Y 1 A PRO -4 ? A PRO 16 257 13 Y 1 A ARG -3 ? A ARG 17 258 13 Y 1 A GLY -2 ? A GLY 18 259 13 Y 1 A SER -1 ? A SER 19 260 13 Y 1 A HIS 0 ? A HIS 20 261 14 Y 1 A MET -19 ? A MET 1 262 14 Y 1 A GLY -18 ? A GLY 2 263 14 Y 1 A SER -17 ? A SER 3 264 14 Y 1 A SER -16 ? A SER 4 265 14 Y 1 A HIS -15 ? A HIS 5 266 14 Y 1 A HIS -14 ? A HIS 6 267 14 Y 1 A HIS -13 ? A HIS 7 268 14 Y 1 A HIS -12 ? A HIS 8 269 14 Y 1 A HIS -11 ? A HIS 9 270 14 Y 1 A HIS -10 ? A HIS 10 271 14 Y 1 A SER -9 ? A SER 11 272 14 Y 1 A SER -8 ? A SER 12 273 14 Y 1 A GLY -7 ? A GLY 13 274 14 Y 1 A LEU -6 ? A LEU 14 275 14 Y 1 A VAL -5 ? A VAL 15 276 14 Y 1 A PRO -4 ? A PRO 16 277 14 Y 1 A ARG -3 ? A ARG 17 278 14 Y 1 A GLY -2 ? A GLY 18 279 14 Y 1 A SER -1 ? A SER 19 280 14 Y 1 A HIS 0 ? A HIS 20 281 15 Y 1 A MET -19 ? A MET 1 282 15 Y 1 A GLY -18 ? A GLY 2 283 15 Y 1 A SER -17 ? A SER 3 284 15 Y 1 A SER -16 ? A SER 4 285 15 Y 1 A HIS -15 ? A HIS 5 286 15 Y 1 A HIS -14 ? A HIS 6 287 15 Y 1 A HIS -13 ? A HIS 7 288 15 Y 1 A HIS -12 ? A HIS 8 289 15 Y 1 A HIS -11 ? A HIS 9 290 15 Y 1 A HIS -10 ? A HIS 10 291 15 Y 1 A SER -9 ? A SER 11 292 15 Y 1 A SER -8 ? A SER 12 293 15 Y 1 A GLY -7 ? A GLY 13 294 15 Y 1 A LEU -6 ? A LEU 14 295 15 Y 1 A VAL -5 ? A VAL 15 296 15 Y 1 A PRO -4 ? A PRO 16 297 15 Y 1 A ARG -3 ? A ARG 17 298 15 Y 1 A GLY -2 ? A GLY 18 299 15 Y 1 A SER -1 ? A SER 19 300 15 Y 1 A HIS 0 ? A HIS 20 301 16 Y 1 A MET -19 ? A MET 1 302 16 Y 1 A GLY -18 ? A GLY 2 303 16 Y 1 A SER -17 ? A SER 3 304 16 Y 1 A SER -16 ? A SER 4 305 16 Y 1 A HIS -15 ? A HIS 5 306 16 Y 1 A HIS -14 ? A HIS 6 307 16 Y 1 A HIS -13 ? A HIS 7 308 16 Y 1 A HIS -12 ? A HIS 8 309 16 Y 1 A HIS -11 ? A HIS 9 310 16 Y 1 A HIS -10 ? A HIS 10 311 16 Y 1 A SER -9 ? A SER 11 312 16 Y 1 A SER -8 ? A SER 12 313 16 Y 1 A GLY -7 ? A GLY 13 314 16 Y 1 A LEU -6 ? A LEU 14 315 16 Y 1 A VAL -5 ? A VAL 15 316 16 Y 1 A PRO -4 ? A PRO 16 317 16 Y 1 A ARG -3 ? A ARG 17 318 16 Y 1 A GLY -2 ? A GLY 18 319 16 Y 1 A SER -1 ? A SER 19 320 16 Y 1 A HIS 0 ? A HIS 20 321 17 Y 1 A MET -19 ? A MET 1 322 17 Y 1 A GLY -18 ? A GLY 2 323 17 Y 1 A SER -17 ? A SER 3 324 17 Y 1 A SER -16 ? A SER 4 325 17 Y 1 A HIS -15 ? A HIS 5 326 17 Y 1 A HIS -14 ? A HIS 6 327 17 Y 1 A HIS -13 ? A HIS 7 328 17 Y 1 A HIS -12 ? A HIS 8 329 17 Y 1 A HIS -11 ? A HIS 9 330 17 Y 1 A HIS -10 ? A HIS 10 331 17 Y 1 A SER -9 ? A SER 11 332 17 Y 1 A SER -8 ? A SER 12 333 17 Y 1 A GLY -7 ? A GLY 13 334 17 Y 1 A LEU -6 ? A LEU 14 335 17 Y 1 A VAL -5 ? A VAL 15 336 17 Y 1 A PRO -4 ? A PRO 16 337 17 Y 1 A ARG -3 ? A ARG 17 338 17 Y 1 A GLY -2 ? A GLY 18 339 17 Y 1 A SER -1 ? A SER 19 340 17 Y 1 A HIS 0 ? A HIS 20 341 18 Y 1 A MET -19 ? A MET 1 342 18 Y 1 A GLY -18 ? A GLY 2 343 18 Y 1 A SER -17 ? A SER 3 344 18 Y 1 A SER -16 ? A SER 4 345 18 Y 1 A HIS -15 ? A HIS 5 346 18 Y 1 A HIS -14 ? A HIS 6 347 18 Y 1 A HIS -13 ? A HIS 7 348 18 Y 1 A HIS -12 ? A HIS 8 349 18 Y 1 A HIS -11 ? A HIS 9 350 18 Y 1 A HIS -10 ? A HIS 10 351 18 Y 1 A SER -9 ? A SER 11 352 18 Y 1 A SER -8 ? A SER 12 353 18 Y 1 A GLY -7 ? A GLY 13 354 18 Y 1 A LEU -6 ? A LEU 14 355 18 Y 1 A VAL -5 ? A VAL 15 356 18 Y 1 A PRO -4 ? A PRO 16 357 18 Y 1 A ARG -3 ? A ARG 17 358 18 Y 1 A GLY -2 ? A GLY 18 359 18 Y 1 A SER -1 ? A SER 19 360 18 Y 1 A HIS 0 ? A HIS 20 361 19 Y 1 A MET -19 ? A MET 1 362 19 Y 1 A GLY -18 ? A GLY 2 363 19 Y 1 A SER -17 ? A SER 3 364 19 Y 1 A SER -16 ? A SER 4 365 19 Y 1 A HIS -15 ? A HIS 5 366 19 Y 1 A HIS -14 ? A HIS 6 367 19 Y 1 A HIS -13 ? A HIS 7 368 19 Y 1 A HIS -12 ? A HIS 8 369 19 Y 1 A HIS -11 ? A HIS 9 370 19 Y 1 A HIS -10 ? A HIS 10 371 19 Y 1 A SER -9 ? A SER 11 372 19 Y 1 A SER -8 ? A SER 12 373 19 Y 1 A GLY -7 ? A GLY 13 374 19 Y 1 A LEU -6 ? A LEU 14 375 19 Y 1 A VAL -5 ? A VAL 15 376 19 Y 1 A PRO -4 ? A PRO 16 377 19 Y 1 A ARG -3 ? A ARG 17 378 19 Y 1 A GLY -2 ? A GLY 18 379 19 Y 1 A SER -1 ? A SER 19 380 19 Y 1 A HIS 0 ? A HIS 20 381 20 Y 1 A MET -19 ? A MET 1 382 20 Y 1 A GLY -18 ? A GLY 2 383 20 Y 1 A SER -17 ? A SER 3 384 20 Y 1 A SER -16 ? A SER 4 385 20 Y 1 A HIS -15 ? A HIS 5 386 20 Y 1 A HIS -14 ? A HIS 6 387 20 Y 1 A HIS -13 ? A HIS 7 388 20 Y 1 A HIS -12 ? A HIS 8 389 20 Y 1 A HIS -11 ? A HIS 9 390 20 Y 1 A HIS -10 ? A HIS 10 391 20 Y 1 A SER -9 ? A SER 11 392 20 Y 1 A SER -8 ? A SER 12 393 20 Y 1 A GLY -7 ? A GLY 13 394 20 Y 1 A LEU -6 ? A LEU 14 395 20 Y 1 A VAL -5 ? A VAL 15 396 20 Y 1 A PRO -4 ? A PRO 16 397 20 Y 1 A ARG -3 ? A ARG 17 398 20 Y 1 A GLY -2 ? A GLY 18 399 20 Y 1 A SER -1 ? A SER 19 400 20 Y 1 A HIS 0 ? A HIS 20 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #