data_2L70 # _entry.id 2L70 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2L70 pdb_00002l70 10.2210/pdb2l70/pdb RCSB RCSB102036 ? ? WWPDB D_1000102036 ? ? BMRB 17330 ? 10.13018/BMR17330 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-10-19 2 'Structure model' 1 1 2020-02-26 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other 4 3 'Structure model' 'Database references' 5 3 'Structure model' Other 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_database_status 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_database_status.status_code_cs' 2 2 'Structure model' '_pdbx_nmr_spectrometer.model' 3 3 'Structure model' '_database_2.pdbx_DOI' 4 3 'Structure model' '_database_2.pdbx_database_accession' 5 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 6 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L70 _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2010-12-01 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 1T5Q PDB 'Solution structure of GIP(1-30) amide in TFE/Water' unspecified 2B4N PDB 'Solution structure of GIP' unspecified 2OBU PDB 'Solution structure of GIP in TFE/Water' unspecified 2L71 PDB 'Solution structure of GIP in Bicellular media' unspecified 17330 BMRB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Venneti, K.C.' 1 'Alana, I.' 2 ;O'Harte, F.P.M. ; 3 'Malthouse, P.J.G.' 4 'Hewage, C.M.' 5 # _citation.id primary _citation.title 'Conformational, receptor interaction and alanine scan studies of glucose-dependent insulinotropic polypeptide' _citation.journal_abbrev Biochim.Biophys.Acta _citation.journal_volume 1814 _citation.page_first 882 _citation.page_last 888 _citation.year 2011 _citation.journal_id_ASTM BBACAQ _citation.country NE _citation.journal_id_ISSN 0006-3002 _citation.journal_id_CSD 0113 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21539943 _citation.pdbx_database_id_DOI 10.1016/j.bbapap.2011.04.002 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Venneti, K.C.' 1 ? primary 'Malthouse, J.P.G.' 2 ? primary ;O'Harte, F.P.M. ; 3 ? primary 'Hewage, C.M.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Gastric inhibitory polypeptide' _entity.formula_weight 4990.586 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'GIP, Glucose-dependent insulinotropic polypeptide' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ _entity_poly.pdbx_seq_one_letter_code_can YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 TYR n 1 2 ALA n 1 3 GLU n 1 4 GLY n 1 5 THR n 1 6 PHE n 1 7 ILE n 1 8 SER n 1 9 ASP n 1 10 TYR n 1 11 SER n 1 12 ILE n 1 13 ALA n 1 14 MET n 1 15 ASP n 1 16 LYS n 1 17 ILE n 1 18 HIS n 1 19 GLN n 1 20 GLN n 1 21 ASP n 1 22 PHE n 1 23 VAL n 1 24 ASN n 1 25 TRP n 1 26 LEU n 1 27 LEU n 1 28 ALA n 1 29 GLN n 1 30 LYS n 1 31 GLY n 1 32 LYS n 1 33 LYS n 1 34 ASN n 1 35 ASP n 1 36 TRP n 1 37 LYS n 1 38 HIS n 1 39 ASN n 1 40 ILE n 1 41 THR n 1 42 GLN n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details 'synthesized on a peptide synthesizer using standard solid-phase Fmoc procedure' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 TYR 1 1 1 TYR TYR A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 MET 14 14 14 MET MET A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 TRP 25 25 25 TRP TRP A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLN 42 42 42 GLN GLN A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L70 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L70 _struct.title 'NMR solution structure of GIP in micellular media' _struct.pdbx_model_details 'fewest violations, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L70 _struct_keywords.pdbx_keywords HORMONE _struct_keywords.text 'GIP, Docking, Ala-scan, Type 2 diabetes, Hormone' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GIP_HUMAN _struct_ref.pdbx_db_accession P09681 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ _struct_ref.pdbx_align_begin 52 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L70 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 42 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P09681 _struct_ref_seq.db_align_beg 52 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 93 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 42 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLY _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 4 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 34 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLY _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 4 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 34 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 31 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 102.35 107.30 -4.95 0.80 N 2 1 CE2 A TRP 36 ? ? CD2 A TRP 36 ? ? CG A TRP 36 ? ? 102.44 107.30 -4.86 0.80 N 3 3 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 102.38 107.30 -4.92 0.80 N 4 4 CE2 A TRP 36 ? ? CD2 A TRP 36 ? ? CG A TRP 36 ? ? 102.44 107.30 -4.86 0.80 N 5 5 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 102.30 107.30 -5.00 0.80 N 6 5 CE2 A TRP 36 ? ? CD2 A TRP 36 ? ? CG A TRP 36 ? ? 102.38 107.30 -4.92 0.80 N 7 6 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 102.38 107.30 -4.92 0.80 N 8 7 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 102.40 107.30 -4.90 0.80 N 9 7 CE2 A TRP 36 ? ? CD2 A TRP 36 ? ? CG A TRP 36 ? ? 102.30 107.30 -5.00 0.80 N 10 8 CE2 A TRP 36 ? ? CD2 A TRP 36 ? ? CG A TRP 36 ? ? 102.40 107.30 -4.90 0.80 N 11 9 CE2 A TRP 36 ? ? CD2 A TRP 36 ? ? CG A TRP 36 ? ? 102.40 107.30 -4.90 0.80 N 12 10 CE2 A TRP 36 ? ? CD2 A TRP 36 ? ? CG A TRP 36 ? ? 102.26 107.30 -5.04 0.80 N 13 11 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 102.29 107.30 -5.01 0.80 N 14 11 CE2 A TRP 36 ? ? CD2 A TRP 36 ? ? CG A TRP 36 ? ? 102.47 107.30 -4.83 0.80 N 15 12 CE2 A TRP 36 ? ? CD2 A TRP 36 ? ? CG A TRP 36 ? ? 102.46 107.30 -4.84 0.80 N 16 13 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 102.50 107.30 -4.80 0.80 N 17 14 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 102.42 107.30 -4.88 0.80 N 18 14 CE2 A TRP 36 ? ? CD2 A TRP 36 ? ? CG A TRP 36 ? ? 102.48 107.30 -4.82 0.80 N 19 15 CE2 A TRP 36 ? ? CD2 A TRP 36 ? ? CG A TRP 36 ? ? 102.38 107.30 -4.92 0.80 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 2 ? ? 65.86 156.88 2 1 ASN A 34 ? ? -103.40 46.19 3 1 TRP A 36 ? ? -153.11 60.41 4 1 HIS A 38 ? ? -174.72 140.28 5 1 ASN A 39 ? ? -159.05 56.78 6 1 ILE A 40 ? ? 54.15 81.53 7 1 THR A 41 ? ? 65.34 74.10 8 2 ASN A 34 ? ? -98.75 58.03 9 2 TRP A 36 ? ? -152.48 55.75 10 2 LYS A 37 ? ? -114.84 63.20 11 2 HIS A 38 ? ? 58.49 83.05 12 2 ILE A 40 ? ? 60.13 87.84 13 3 ALA A 2 ? ? 62.26 170.43 14 3 LYS A 33 ? ? 65.18 68.24 15 3 ASN A 34 ? ? 137.05 -64.95 16 3 ILE A 40 ? ? 55.22 71.85 17 4 ASP A 35 ? ? -111.80 65.58 18 4 TRP A 36 ? ? 53.89 70.14 19 4 HIS A 38 ? ? -160.78 101.29 20 4 ILE A 40 ? ? 70.51 115.95 21 5 ALA A 2 ? ? 56.74 -89.60 22 5 ASN A 34 ? ? -86.49 49.38 23 5 TRP A 36 ? ? -147.20 58.30 24 5 HIS A 38 ? ? 160.41 65.19 25 5 ASN A 39 ? ? -160.98 84.91 26 5 ILE A 40 ? ? 60.60 77.05 27 5 THR A 41 ? ? 63.28 72.68 28 6 ALA A 2 ? ? 45.63 -101.54 29 6 THR A 5 ? ? -144.26 -63.75 30 6 ASN A 34 ? ? 38.46 46.37 31 6 TRP A 36 ? ? -144.03 39.28 32 6 THR A 41 ? ? -159.80 39.75 33 7 THR A 5 ? ? -140.01 -64.23 34 7 LYS A 33 ? ? 75.93 62.08 35 7 HIS A 38 ? ? 166.65 117.55 36 7 ILE A 40 ? ? 58.45 83.86 37 8 ALA A 2 ? ? 41.66 -105.35 38 8 THR A 5 ? ? -135.16 -64.49 39 8 ASN A 34 ? ? -161.97 -59.58 40 8 ASP A 35 ? ? -28.17 -45.64 41 8 LYS A 37 ? ? -153.72 69.58 42 8 HIS A 38 ? ? 61.98 70.25 43 9 GLU A 3 ? ? -94.98 -126.55 44 9 THR A 5 ? ? -134.52 -70.93 45 9 ASN A 34 ? ? -169.67 -55.35 46 9 TRP A 36 ? ? -150.76 60.97 47 9 THR A 41 ? ? -155.49 48.35 48 10 THR A 5 ? ? -142.95 -65.81 49 10 TRP A 36 ? ? -152.79 65.20 50 10 HIS A 38 ? ? 115.56 67.88 51 10 ILE A 40 ? ? 58.25 70.88 52 11 ALA A 2 ? ? 66.68 163.32 53 11 THR A 5 ? ? -148.04 -65.87 54 11 TRP A 36 ? ? -166.84 63.48 55 11 ASN A 39 ? ? -172.69 66.99 56 11 ILE A 40 ? ? 59.89 77.22 57 12 ALA A 2 ? ? 56.31 -79.44 58 12 ASN A 34 ? ? -96.69 53.29 59 12 TRP A 36 ? ? -156.69 71.01 60 12 ASN A 39 ? ? -156.08 67.50 61 12 ILE A 40 ? ? 63.56 85.82 62 13 ALA A 2 ? ? 56.16 -176.31 63 13 LYS A 32 ? ? -76.73 -70.21 64 13 LYS A 33 ? ? 81.35 -44.03 65 13 ASN A 34 ? ? -161.87 -47.66 66 13 TRP A 36 ? ? -149.03 59.81 67 13 LYS A 37 ? ? -113.38 50.07 68 13 HIS A 38 ? ? -176.54 143.78 69 13 ASN A 39 ? ? -148.99 53.68 70 13 ILE A 40 ? ? 56.06 72.46 71 13 THR A 41 ? ? 100.75 -52.35 72 14 THR A 5 ? ? -152.95 -66.63 73 14 GLN A 29 ? ? -69.74 87.76 74 14 LYS A 30 ? ? 162.10 -39.10 75 14 ASN A 34 ? ? -116.84 50.42 76 14 TRP A 36 ? ? -145.09 49.84 77 14 HIS A 38 ? ? -172.98 72.59 78 14 ILE A 40 ? ? 55.47 75.76 79 14 THR A 41 ? ? 62.38 67.18 80 15 ASN A 34 ? ? -159.50 -58.20 81 15 TRP A 36 ? ? -153.04 60.52 82 15 ASN A 39 ? ? -106.04 50.59 83 15 THR A 41 ? ? -155.77 63.94 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L70 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L70 _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.contents '150mM DHPC; 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample.component DHPC-1 _pdbx_nmr_exptl_sample.concentration 150 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling ? _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 3.9 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H TOCSY' 1 2 1 '2D 1H-1H NOESY' 1 3 1 '2D DQF-COSY' # _pdbx_nmr_refine.entry_id 2L70 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.0 1 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2.0 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 GLN N N N N 47 GLN CA C N S 48 GLN C C N N 49 GLN O O N N 50 GLN CB C N N 51 GLN CG C N N 52 GLN CD C N N 53 GLN OE1 O N N 54 GLN NE2 N N N 55 GLN OXT O N N 56 GLN H H N N 57 GLN H2 H N N 58 GLN HA H N N 59 GLN HB2 H N N 60 GLN HB3 H N N 61 GLN HG2 H N N 62 GLN HG3 H N N 63 GLN HE21 H N N 64 GLN HE22 H N N 65 GLN HXT H N N 66 GLU N N N N 67 GLU CA C N S 68 GLU C C N N 69 GLU O O N N 70 GLU CB C N N 71 GLU CG C N N 72 GLU CD C N N 73 GLU OE1 O N N 74 GLU OE2 O N N 75 GLU OXT O N N 76 GLU H H N N 77 GLU H2 H N N 78 GLU HA H N N 79 GLU HB2 H N N 80 GLU HB3 H N N 81 GLU HG2 H N N 82 GLU HG3 H N N 83 GLU HE2 H N N 84 GLU HXT H N N 85 GLY N N N N 86 GLY CA C N N 87 GLY C C N N 88 GLY O O N N 89 GLY OXT O N N 90 GLY H H N N 91 GLY H2 H N N 92 GLY HA2 H N N 93 GLY HA3 H N N 94 GLY HXT H N N 95 HIS N N N N 96 HIS CA C N S 97 HIS C C N N 98 HIS O O N N 99 HIS CB C N N 100 HIS CG C Y N 101 HIS ND1 N Y N 102 HIS CD2 C Y N 103 HIS CE1 C Y N 104 HIS NE2 N Y N 105 HIS OXT O N N 106 HIS H H N N 107 HIS H2 H N N 108 HIS HA H N N 109 HIS HB2 H N N 110 HIS HB3 H N N 111 HIS HD1 H N N 112 HIS HD2 H N N 113 HIS HE1 H N N 114 HIS HE2 H N N 115 HIS HXT H N N 116 ILE N N N N 117 ILE CA C N S 118 ILE C C N N 119 ILE O O N N 120 ILE CB C N S 121 ILE CG1 C N N 122 ILE CG2 C N N 123 ILE CD1 C N N 124 ILE OXT O N N 125 ILE H H N N 126 ILE H2 H N N 127 ILE HA H N N 128 ILE HB H N N 129 ILE HG12 H N N 130 ILE HG13 H N N 131 ILE HG21 H N N 132 ILE HG22 H N N 133 ILE HG23 H N N 134 ILE HD11 H N N 135 ILE HD12 H N N 136 ILE HD13 H N N 137 ILE HXT H N N 138 LEU N N N N 139 LEU CA C N S 140 LEU C C N N 141 LEU O O N N 142 LEU CB C N N 143 LEU CG C N N 144 LEU CD1 C N N 145 LEU CD2 C N N 146 LEU OXT O N N 147 LEU H H N N 148 LEU H2 H N N 149 LEU HA H N N 150 LEU HB2 H N N 151 LEU HB3 H N N 152 LEU HG H N N 153 LEU HD11 H N N 154 LEU HD12 H N N 155 LEU HD13 H N N 156 LEU HD21 H N N 157 LEU HD22 H N N 158 LEU HD23 H N N 159 LEU HXT H N N 160 LYS N N N N 161 LYS CA C N S 162 LYS C C N N 163 LYS O O N N 164 LYS CB C N N 165 LYS CG C N N 166 LYS CD C N N 167 LYS CE C N N 168 LYS NZ N N N 169 LYS OXT O N N 170 LYS H H N N 171 LYS H2 H N N 172 LYS HA H N N 173 LYS HB2 H N N 174 LYS HB3 H N N 175 LYS HG2 H N N 176 LYS HG3 H N N 177 LYS HD2 H N N 178 LYS HD3 H N N 179 LYS HE2 H N N 180 LYS HE3 H N N 181 LYS HZ1 H N N 182 LYS HZ2 H N N 183 LYS HZ3 H N N 184 LYS HXT H N N 185 MET N N N N 186 MET CA C N S 187 MET C C N N 188 MET O O N N 189 MET CB C N N 190 MET CG C N N 191 MET SD S N N 192 MET CE C N N 193 MET OXT O N N 194 MET H H N N 195 MET H2 H N N 196 MET HA H N N 197 MET HB2 H N N 198 MET HB3 H N N 199 MET HG2 H N N 200 MET HG3 H N N 201 MET HE1 H N N 202 MET HE2 H N N 203 MET HE3 H N N 204 MET HXT H N N 205 PHE N N N N 206 PHE CA C N S 207 PHE C C N N 208 PHE O O N N 209 PHE CB C N N 210 PHE CG C Y N 211 PHE CD1 C Y N 212 PHE CD2 C Y N 213 PHE CE1 C Y N 214 PHE CE2 C Y N 215 PHE CZ C Y N 216 PHE OXT O N N 217 PHE H H N N 218 PHE H2 H N N 219 PHE HA H N N 220 PHE HB2 H N N 221 PHE HB3 H N N 222 PHE HD1 H N N 223 PHE HD2 H N N 224 PHE HE1 H N N 225 PHE HE2 H N N 226 PHE HZ H N N 227 PHE HXT H N N 228 SER N N N N 229 SER CA C N S 230 SER C C N N 231 SER O O N N 232 SER CB C N N 233 SER OG O N N 234 SER OXT O N N 235 SER H H N N 236 SER H2 H N N 237 SER HA H N N 238 SER HB2 H N N 239 SER HB3 H N N 240 SER HG H N N 241 SER HXT H N N 242 THR N N N N 243 THR CA C N S 244 THR C C N N 245 THR O O N N 246 THR CB C N R 247 THR OG1 O N N 248 THR CG2 C N N 249 THR OXT O N N 250 THR H H N N 251 THR H2 H N N 252 THR HA H N N 253 THR HB H N N 254 THR HG1 H N N 255 THR HG21 H N N 256 THR HG22 H N N 257 THR HG23 H N N 258 THR HXT H N N 259 TRP N N N N 260 TRP CA C N S 261 TRP C C N N 262 TRP O O N N 263 TRP CB C N N 264 TRP CG C Y N 265 TRP CD1 C Y N 266 TRP CD2 C Y N 267 TRP NE1 N Y N 268 TRP CE2 C Y N 269 TRP CE3 C Y N 270 TRP CZ2 C Y N 271 TRP CZ3 C Y N 272 TRP CH2 C Y N 273 TRP OXT O N N 274 TRP H H N N 275 TRP H2 H N N 276 TRP HA H N N 277 TRP HB2 H N N 278 TRP HB3 H N N 279 TRP HD1 H N N 280 TRP HE1 H N N 281 TRP HE3 H N N 282 TRP HZ2 H N N 283 TRP HZ3 H N N 284 TRP HH2 H N N 285 TRP HXT H N N 286 TYR N N N N 287 TYR CA C N S 288 TYR C C N N 289 TYR O O N N 290 TYR CB C N N 291 TYR CG C Y N 292 TYR CD1 C Y N 293 TYR CD2 C Y N 294 TYR CE1 C Y N 295 TYR CE2 C Y N 296 TYR CZ C Y N 297 TYR OH O N N 298 TYR OXT O N N 299 TYR H H N N 300 TYR H2 H N N 301 TYR HA H N N 302 TYR HB2 H N N 303 TYR HB3 H N N 304 TYR HD1 H N N 305 TYR HD2 H N N 306 TYR HE1 H N N 307 TYR HE2 H N N 308 TYR HH H N N 309 TYR HXT H N N 310 VAL N N N N 311 VAL CA C N S 312 VAL C C N N 313 VAL O O N N 314 VAL CB C N N 315 VAL CG1 C N N 316 VAL CG2 C N N 317 VAL OXT O N N 318 VAL H H N N 319 VAL H2 H N N 320 VAL HA H N N 321 VAL HB H N N 322 VAL HG11 H N N 323 VAL HG12 H N N 324 VAL HG13 H N N 325 VAL HG21 H N N 326 VAL HG22 H N N 327 VAL HG23 H N N 328 VAL HXT H N N 329 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLN N CA sing N N 44 GLN N H sing N N 45 GLN N H2 sing N N 46 GLN CA C sing N N 47 GLN CA CB sing N N 48 GLN CA HA sing N N 49 GLN C O doub N N 50 GLN C OXT sing N N 51 GLN CB CG sing N N 52 GLN CB HB2 sing N N 53 GLN CB HB3 sing N N 54 GLN CG CD sing N N 55 GLN CG HG2 sing N N 56 GLN CG HG3 sing N N 57 GLN CD OE1 doub N N 58 GLN CD NE2 sing N N 59 GLN NE2 HE21 sing N N 60 GLN NE2 HE22 sing N N 61 GLN OXT HXT sing N N 62 GLU N CA sing N N 63 GLU N H sing N N 64 GLU N H2 sing N N 65 GLU CA C sing N N 66 GLU CA CB sing N N 67 GLU CA HA sing N N 68 GLU C O doub N N 69 GLU C OXT sing N N 70 GLU CB CG sing N N 71 GLU CB HB2 sing N N 72 GLU CB HB3 sing N N 73 GLU CG CD sing N N 74 GLU CG HG2 sing N N 75 GLU CG HG3 sing N N 76 GLU CD OE1 doub N N 77 GLU CD OE2 sing N N 78 GLU OE2 HE2 sing N N 79 GLU OXT HXT sing N N 80 GLY N CA sing N N 81 GLY N H sing N N 82 GLY N H2 sing N N 83 GLY CA C sing N N 84 GLY CA HA2 sing N N 85 GLY CA HA3 sing N N 86 GLY C O doub N N 87 GLY C OXT sing N N 88 GLY OXT HXT sing N N 89 HIS N CA sing N N 90 HIS N H sing N N 91 HIS N H2 sing N N 92 HIS CA C sing N N 93 HIS CA CB sing N N 94 HIS CA HA sing N N 95 HIS C O doub N N 96 HIS C OXT sing N N 97 HIS CB CG sing N N 98 HIS CB HB2 sing N N 99 HIS CB HB3 sing N N 100 HIS CG ND1 sing Y N 101 HIS CG CD2 doub Y N 102 HIS ND1 CE1 doub Y N 103 HIS ND1 HD1 sing N N 104 HIS CD2 NE2 sing Y N 105 HIS CD2 HD2 sing N N 106 HIS CE1 NE2 sing Y N 107 HIS CE1 HE1 sing N N 108 HIS NE2 HE2 sing N N 109 HIS OXT HXT sing N N 110 ILE N CA sing N N 111 ILE N H sing N N 112 ILE N H2 sing N N 113 ILE CA C sing N N 114 ILE CA CB sing N N 115 ILE CA HA sing N N 116 ILE C O doub N N 117 ILE C OXT sing N N 118 ILE CB CG1 sing N N 119 ILE CB CG2 sing N N 120 ILE CB HB sing N N 121 ILE CG1 CD1 sing N N 122 ILE CG1 HG12 sing N N 123 ILE CG1 HG13 sing N N 124 ILE CG2 HG21 sing N N 125 ILE CG2 HG22 sing N N 126 ILE CG2 HG23 sing N N 127 ILE CD1 HD11 sing N N 128 ILE CD1 HD12 sing N N 129 ILE CD1 HD13 sing N N 130 ILE OXT HXT sing N N 131 LEU N CA sing N N 132 LEU N H sing N N 133 LEU N H2 sing N N 134 LEU CA C sing N N 135 LEU CA CB sing N N 136 LEU CA HA sing N N 137 LEU C O doub N N 138 LEU C OXT sing N N 139 LEU CB CG sing N N 140 LEU CB HB2 sing N N 141 LEU CB HB3 sing N N 142 LEU CG CD1 sing N N 143 LEU CG CD2 sing N N 144 LEU CG HG sing N N 145 LEU CD1 HD11 sing N N 146 LEU CD1 HD12 sing N N 147 LEU CD1 HD13 sing N N 148 LEU CD2 HD21 sing N N 149 LEU CD2 HD22 sing N N 150 LEU CD2 HD23 sing N N 151 LEU OXT HXT sing N N 152 LYS N CA sing N N 153 LYS N H sing N N 154 LYS N H2 sing N N 155 LYS CA C sing N N 156 LYS CA CB sing N N 157 LYS CA HA sing N N 158 LYS C O doub N N 159 LYS C OXT sing N N 160 LYS CB CG sing N N 161 LYS CB HB2 sing N N 162 LYS CB HB3 sing N N 163 LYS CG CD sing N N 164 LYS CG HG2 sing N N 165 LYS CG HG3 sing N N 166 LYS CD CE sing N N 167 LYS CD HD2 sing N N 168 LYS CD HD3 sing N N 169 LYS CE NZ sing N N 170 LYS CE HE2 sing N N 171 LYS CE HE3 sing N N 172 LYS NZ HZ1 sing N N 173 LYS NZ HZ2 sing N N 174 LYS NZ HZ3 sing N N 175 LYS OXT HXT sing N N 176 MET N CA sing N N 177 MET N H sing N N 178 MET N H2 sing N N 179 MET CA C sing N N 180 MET CA CB sing N N 181 MET CA HA sing N N 182 MET C O doub N N 183 MET C OXT sing N N 184 MET CB CG sing N N 185 MET CB HB2 sing N N 186 MET CB HB3 sing N N 187 MET CG SD sing N N 188 MET CG HG2 sing N N 189 MET CG HG3 sing N N 190 MET SD CE sing N N 191 MET CE HE1 sing N N 192 MET CE HE2 sing N N 193 MET CE HE3 sing N N 194 MET OXT HXT sing N N 195 PHE N CA sing N N 196 PHE N H sing N N 197 PHE N H2 sing N N 198 PHE CA C sing N N 199 PHE CA CB sing N N 200 PHE CA HA sing N N 201 PHE C O doub N N 202 PHE C OXT sing N N 203 PHE CB CG sing N N 204 PHE CB HB2 sing N N 205 PHE CB HB3 sing N N 206 PHE CG CD1 doub Y N 207 PHE CG CD2 sing Y N 208 PHE CD1 CE1 sing Y N 209 PHE CD1 HD1 sing N N 210 PHE CD2 CE2 doub Y N 211 PHE CD2 HD2 sing N N 212 PHE CE1 CZ doub Y N 213 PHE CE1 HE1 sing N N 214 PHE CE2 CZ sing Y N 215 PHE CE2 HE2 sing N N 216 PHE CZ HZ sing N N 217 PHE OXT HXT sing N N 218 SER N CA sing N N 219 SER N H sing N N 220 SER N H2 sing N N 221 SER CA C sing N N 222 SER CA CB sing N N 223 SER CA HA sing N N 224 SER C O doub N N 225 SER C OXT sing N N 226 SER CB OG sing N N 227 SER CB HB2 sing N N 228 SER CB HB3 sing N N 229 SER OG HG sing N N 230 SER OXT HXT sing N N 231 THR N CA sing N N 232 THR N H sing N N 233 THR N H2 sing N N 234 THR CA C sing N N 235 THR CA CB sing N N 236 THR CA HA sing N N 237 THR C O doub N N 238 THR C OXT sing N N 239 THR CB OG1 sing N N 240 THR CB CG2 sing N N 241 THR CB HB sing N N 242 THR OG1 HG1 sing N N 243 THR CG2 HG21 sing N N 244 THR CG2 HG22 sing N N 245 THR CG2 HG23 sing N N 246 THR OXT HXT sing N N 247 TRP N CA sing N N 248 TRP N H sing N N 249 TRP N H2 sing N N 250 TRP CA C sing N N 251 TRP CA CB sing N N 252 TRP CA HA sing N N 253 TRP C O doub N N 254 TRP C OXT sing N N 255 TRP CB CG sing N N 256 TRP CB HB2 sing N N 257 TRP CB HB3 sing N N 258 TRP CG CD1 doub Y N 259 TRP CG CD2 sing Y N 260 TRP CD1 NE1 sing Y N 261 TRP CD1 HD1 sing N N 262 TRP CD2 CE2 doub Y N 263 TRP CD2 CE3 sing Y N 264 TRP NE1 CE2 sing Y N 265 TRP NE1 HE1 sing N N 266 TRP CE2 CZ2 sing Y N 267 TRP CE3 CZ3 doub Y N 268 TRP CE3 HE3 sing N N 269 TRP CZ2 CH2 doub Y N 270 TRP CZ2 HZ2 sing N N 271 TRP CZ3 CH2 sing Y N 272 TRP CZ3 HZ3 sing N N 273 TRP CH2 HH2 sing N N 274 TRP OXT HXT sing N N 275 TYR N CA sing N N 276 TYR N H sing N N 277 TYR N H2 sing N N 278 TYR CA C sing N N 279 TYR CA CB sing N N 280 TYR CA HA sing N N 281 TYR C O doub N N 282 TYR C OXT sing N N 283 TYR CB CG sing N N 284 TYR CB HB2 sing N N 285 TYR CB HB3 sing N N 286 TYR CG CD1 doub Y N 287 TYR CG CD2 sing Y N 288 TYR CD1 CE1 sing Y N 289 TYR CD1 HD1 sing N N 290 TYR CD2 CE2 doub Y N 291 TYR CD2 HD2 sing N N 292 TYR CE1 CZ doub Y N 293 TYR CE1 HE1 sing N N 294 TYR CE2 CZ sing Y N 295 TYR CE2 HE2 sing N N 296 TYR CZ OH sing N N 297 TYR OH HH sing N N 298 TYR OXT HXT sing N N 299 VAL N CA sing N N 300 VAL N H sing N N 301 VAL N H2 sing N N 302 VAL CA C sing N N 303 VAL CA CB sing N N 304 VAL CA HA sing N N 305 VAL C O doub N N 306 VAL C OXT sing N N 307 VAL CB CG1 sing N N 308 VAL CB CG2 sing N N 309 VAL CB HB sing N N 310 VAL CG1 HG11 sing N N 311 VAL CG1 HG12 sing N N 312 VAL CG1 HG13 sing N N 313 VAL CG2 HG21 sing N N 314 VAL CG2 HG22 sing N N 315 VAL CG2 HG23 sing N N 316 VAL OXT HXT sing N N 317 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 800 Bruker DRX 2 'Bruker DRX' 900 Bruker DRX 3 'Bruker DRX' # _atom_sites.entry_id 2L70 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_