data_2LA2 # _entry.id 2LA2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LA2 pdb_00002la2 10.2210/pdb2la2/pdb RCSB RCSB102145 ? ? BMRB 17500 ? 10.13018/BMR17500 WWPDB D_1000102145 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-09-28 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' Other 5 3 'Structure model' 'Data collection' 6 3 'Structure model' 'Database references' 7 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_spectrometer 4 2 'Structure model' struct_conn 5 2 'Structure model' struct_ref_seq_dif 6 3 'Structure model' chem_comp_atom 7 3 'Structure model' chem_comp_bond 8 3 'Structure model' database_2 9 3 'Structure model' pdbx_entry_details 10 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_spectrometer.model' 5 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 2 'Structure model' '_struct_ref_seq_dif.details' 7 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LA2 _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2011-03-01 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_id 17500 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kim, Y.' 1 'Kim, J.' 2 # _citation.id primary _citation.title ;Structure and function of papiliocin with antimicrobial and anti-inflammatory activities isolated from the swallowtail butterfly, Papilio xuthus ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kim, J.-K.' 1 ? primary 'Lee, E.' 2 ? primary 'Shin, S.' 3 ? primary 'Jeong, K.-W.' 4 ? primary 'Lee, J.-Y.' 5 ? primary 'Bae, S.-Y.' 6 ? primary 'Kim, S.-H.' 7 ? primary 'Lee, J.' 8 ? primary 'Kim, S.R.' 9 ? primary 'Lee, D.G.' 10 ? primary 'Hwang, J.-S.' 11 ? primary 'Kim, Y.' 12 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description Cecropin _entity.formula_weight 4010.861 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'residues in UNP, 25-61' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name Papiliocin # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQAATVVK(NH2)' _entity_poly.pdbx_seq_one_letter_code_can RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQAATVVKX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ARG n 1 2 TRP n 1 3 LYS n 1 4 ILE n 1 5 PHE n 1 6 LYS n 1 7 LYS n 1 8 ILE n 1 9 GLU n 1 10 LYS n 1 11 VAL n 1 12 GLY n 1 13 ARG n 1 14 ASN n 1 15 VAL n 1 16 ARG n 1 17 ASP n 1 18 GLY n 1 19 ILE n 1 20 ILE n 1 21 LYS n 1 22 ALA n 1 23 GLY n 1 24 PRO n 1 25 ALA n 1 26 VAL n 1 27 ALA n 1 28 VAL n 1 29 VAL n 1 30 GLY n 1 31 GLN n 1 32 ALA n 1 33 ALA n 1 34 THR n 1 35 VAL n 1 36 VAL n 1 37 LYS n 1 38 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Papilio xuthus' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 66420 _pdbx_entity_src_syn.details 'synthetic peptide' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ARG 1 1 1 ARG ARG A . n A 1 2 TRP 2 2 2 TRP TRP A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 NH2 38 38 38 NH2 NH2 A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LA2 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LA2 _struct.title 'Solution structure of papiliocin isolated from the swallowtail butterfly, Papilio xuthus' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LA2 _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' _struct_keywords.text 'Antimicrobial peptide, Papiliocin, Cecropin-like peptide, Anti-inflammatory activity, ANTIMICROBIAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code D8L127_9NEOP _struct_ref.pdbx_db_accession D8L127 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQAATVVK _struct_ref.pdbx_align_begin 25 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LA2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 37 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession D8L127 _struct_ref_seq.db_align_beg 25 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 61 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 37 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2LA2 _struct_ref_seq_dif.mon_id NH2 _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 38 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code D8L127 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details amidation _struct_ref_seq_dif.pdbx_auth_seq_num 38 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TRP A 2 ? ALA A 22 ? TRP A 2 ALA A 22 1 ? 21 HELX_P HELX_P2 2 ALA A 25 ? LYS A 37 ? ALA A 25 LYS A 37 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id LYS _struct_conn.ptnr1_label_seq_id 37 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id NH2 _struct_conn.ptnr2_label_seq_id 38 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id LYS _struct_conn.ptnr1_auth_seq_id 37 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id NH2 _struct_conn.ptnr2_auth_seq_id 38 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.328 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id NH2 _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 38 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id LYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 37 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id NH2 _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 38 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id LYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 37 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id LYS _pdbx_modification_feature.ref_pcm_id 20 _pdbx_modification_feature.ref_comp_id NH2 _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Terminal amidation' # _pdbx_entry_details.entry_id 2LA2 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TRP A 2 ? ? -137.52 -53.12 2 1 ALA A 22 ? ? -97.38 -67.85 3 2 TRP A 2 ? ? -149.15 -59.77 4 2 LYS A 21 ? ? -53.66 -73.03 5 2 ALA A 22 ? ? -92.27 -75.05 6 3 TRP A 2 ? ? 62.21 98.16 7 3 PRO A 24 ? ? -69.80 90.98 8 4 TRP A 2 ? ? -130.85 -50.48 9 4 LYS A 21 ? ? -68.04 -72.06 10 5 ALA A 22 ? ? -51.80 -75.56 11 6 LYS A 21 ? ? -52.69 -71.41 12 6 ALA A 22 ? ? -92.96 -75.53 13 7 ALA A 22 ? ? -95.87 -75.38 14 8 ALA A 22 ? ? -52.09 -74.05 15 9 TRP A 2 ? ? -163.11 -52.21 16 9 LYS A 3 ? ? -51.79 -74.70 17 9 LYS A 21 ? ? -71.55 -70.61 18 9 ALA A 22 ? ? -89.25 -74.08 19 10 LYS A 21 ? ? -51.91 -71.06 20 10 ALA A 22 ? ? -99.63 -69.08 21 11 LYS A 21 ? ? -51.94 -71.12 22 11 ALA A 22 ? ? -92.22 -69.70 23 12 ALA A 22 ? ? -76.18 -71.39 24 12 PRO A 24 ? ? -69.85 94.86 25 13 TRP A 2 ? ? -176.47 -40.81 26 13 LYS A 21 ? ? -55.58 -70.23 27 13 ALA A 22 ? ? -90.06 -74.78 28 13 PRO A 24 ? ? -69.73 -174.65 29 14 LYS A 3 ? ? -51.93 -74.52 30 14 ALA A 22 ? ? -93.44 -72.61 31 14 PRO A 24 ? ? -69.80 79.64 32 15 TRP A 2 ? ? -167.55 -45.07 33 15 LYS A 21 ? ? -51.91 -71.54 34 15 ALA A 22 ? ? -99.24 -63.89 35 16 ALA A 22 ? ? -92.68 -75.60 36 16 PRO A 24 ? ? -69.79 99.79 37 17 LYS A 3 ? ? -51.82 -74.57 38 17 LYS A 21 ? ? -53.40 -74.44 39 17 ALA A 22 ? ? -99.99 -75.73 40 18 LYS A 21 ? ? -54.89 -74.22 41 18 ALA A 22 ? ? -86.80 -75.52 42 18 PRO A 24 ? ? -69.77 82.24 43 19 LYS A 21 ? ? -71.77 -72.42 44 19 ALA A 22 ? ? -80.91 -75.71 45 19 PRO A 24 ? ? -69.77 79.31 46 20 LYS A 3 ? ? -55.46 -74.08 47 20 LYS A 21 ? ? -64.38 -74.11 48 20 ALA A 22 ? ? -97.63 -75.59 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 500 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LA2 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LA2 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '1mM Papiliocin, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample.component Papiliocin _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling ? _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H NOESY' 1 2 1 '2D 1H-1H TOCSY' 1 3 1 '2D DQF-COSY' # _pdbx_nmr_refine.entry_id 2LA2 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 1 ? ? refinement CYANA 2 ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 ILE N N N N 123 ILE CA C N S 124 ILE C C N N 125 ILE O O N N 126 ILE CB C N S 127 ILE CG1 C N N 128 ILE CG2 C N N 129 ILE CD1 C N N 130 ILE OXT O N N 131 ILE H H N N 132 ILE H2 H N N 133 ILE HA H N N 134 ILE HB H N N 135 ILE HG12 H N N 136 ILE HG13 H N N 137 ILE HG21 H N N 138 ILE HG22 H N N 139 ILE HG23 H N N 140 ILE HD11 H N N 141 ILE HD12 H N N 142 ILE HD13 H N N 143 ILE HXT H N N 144 LYS N N N N 145 LYS CA C N S 146 LYS C C N N 147 LYS O O N N 148 LYS CB C N N 149 LYS CG C N N 150 LYS CD C N N 151 LYS CE C N N 152 LYS NZ N N N 153 LYS OXT O N N 154 LYS H H N N 155 LYS H2 H N N 156 LYS HA H N N 157 LYS HB2 H N N 158 LYS HB3 H N N 159 LYS HG2 H N N 160 LYS HG3 H N N 161 LYS HD2 H N N 162 LYS HD3 H N N 163 LYS HE2 H N N 164 LYS HE3 H N N 165 LYS HZ1 H N N 166 LYS HZ2 H N N 167 LYS HZ3 H N N 168 LYS HXT H N N 169 NH2 N N N N 170 NH2 HN1 H N N 171 NH2 HN2 H N N 172 PHE N N N N 173 PHE CA C N S 174 PHE C C N N 175 PHE O O N N 176 PHE CB C N N 177 PHE CG C Y N 178 PHE CD1 C Y N 179 PHE CD2 C Y N 180 PHE CE1 C Y N 181 PHE CE2 C Y N 182 PHE CZ C Y N 183 PHE OXT O N N 184 PHE H H N N 185 PHE H2 H N N 186 PHE HA H N N 187 PHE HB2 H N N 188 PHE HB3 H N N 189 PHE HD1 H N N 190 PHE HD2 H N N 191 PHE HE1 H N N 192 PHE HE2 H N N 193 PHE HZ H N N 194 PHE HXT H N N 195 PRO N N N N 196 PRO CA C N S 197 PRO C C N N 198 PRO O O N N 199 PRO CB C N N 200 PRO CG C N N 201 PRO CD C N N 202 PRO OXT O N N 203 PRO H H N N 204 PRO HA H N N 205 PRO HB2 H N N 206 PRO HB3 H N N 207 PRO HG2 H N N 208 PRO HG3 H N N 209 PRO HD2 H N N 210 PRO HD3 H N N 211 PRO HXT H N N 212 THR N N N N 213 THR CA C N S 214 THR C C N N 215 THR O O N N 216 THR CB C N R 217 THR OG1 O N N 218 THR CG2 C N N 219 THR OXT O N N 220 THR H H N N 221 THR H2 H N N 222 THR HA H N N 223 THR HB H N N 224 THR HG1 H N N 225 THR HG21 H N N 226 THR HG22 H N N 227 THR HG23 H N N 228 THR HXT H N N 229 TRP N N N N 230 TRP CA C N S 231 TRP C C N N 232 TRP O O N N 233 TRP CB C N N 234 TRP CG C Y N 235 TRP CD1 C Y N 236 TRP CD2 C Y N 237 TRP NE1 N Y N 238 TRP CE2 C Y N 239 TRP CE3 C Y N 240 TRP CZ2 C Y N 241 TRP CZ3 C Y N 242 TRP CH2 C Y N 243 TRP OXT O N N 244 TRP H H N N 245 TRP H2 H N N 246 TRP HA H N N 247 TRP HB2 H N N 248 TRP HB3 H N N 249 TRP HD1 H N N 250 TRP HE1 H N N 251 TRP HE3 H N N 252 TRP HZ2 H N N 253 TRP HZ3 H N N 254 TRP HH2 H N N 255 TRP HXT H N N 256 VAL N N N N 257 VAL CA C N S 258 VAL C C N N 259 VAL O O N N 260 VAL CB C N N 261 VAL CG1 C N N 262 VAL CG2 C N N 263 VAL OXT O N N 264 VAL H H N N 265 VAL H2 H N N 266 VAL HA H N N 267 VAL HB H N N 268 VAL HG11 H N N 269 VAL HG12 H N N 270 VAL HG13 H N N 271 VAL HG21 H N N 272 VAL HG22 H N N 273 VAL HG23 H N N 274 VAL HXT H N N 275 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LYS N CA sing N N 137 LYS N H sing N N 138 LYS N H2 sing N N 139 LYS CA C sing N N 140 LYS CA CB sing N N 141 LYS CA HA sing N N 142 LYS C O doub N N 143 LYS C OXT sing N N 144 LYS CB CG sing N N 145 LYS CB HB2 sing N N 146 LYS CB HB3 sing N N 147 LYS CG CD sing N N 148 LYS CG HG2 sing N N 149 LYS CG HG3 sing N N 150 LYS CD CE sing N N 151 LYS CD HD2 sing N N 152 LYS CD HD3 sing N N 153 LYS CE NZ sing N N 154 LYS CE HE2 sing N N 155 LYS CE HE3 sing N N 156 LYS NZ HZ1 sing N N 157 LYS NZ HZ2 sing N N 158 LYS NZ HZ3 sing N N 159 LYS OXT HXT sing N N 160 NH2 N HN1 sing N N 161 NH2 N HN2 sing N N 162 PHE N CA sing N N 163 PHE N H sing N N 164 PHE N H2 sing N N 165 PHE CA C sing N N 166 PHE CA CB sing N N 167 PHE CA HA sing N N 168 PHE C O doub N N 169 PHE C OXT sing N N 170 PHE CB CG sing N N 171 PHE CB HB2 sing N N 172 PHE CB HB3 sing N N 173 PHE CG CD1 doub Y N 174 PHE CG CD2 sing Y N 175 PHE CD1 CE1 sing Y N 176 PHE CD1 HD1 sing N N 177 PHE CD2 CE2 doub Y N 178 PHE CD2 HD2 sing N N 179 PHE CE1 CZ doub Y N 180 PHE CE1 HE1 sing N N 181 PHE CE2 CZ sing Y N 182 PHE CE2 HE2 sing N N 183 PHE CZ HZ sing N N 184 PHE OXT HXT sing N N 185 PRO N CA sing N N 186 PRO N CD sing N N 187 PRO N H sing N N 188 PRO CA C sing N N 189 PRO CA CB sing N N 190 PRO CA HA sing N N 191 PRO C O doub N N 192 PRO C OXT sing N N 193 PRO CB CG sing N N 194 PRO CB HB2 sing N N 195 PRO CB HB3 sing N N 196 PRO CG CD sing N N 197 PRO CG HG2 sing N N 198 PRO CG HG3 sing N N 199 PRO CD HD2 sing N N 200 PRO CD HD3 sing N N 201 PRO OXT HXT sing N N 202 THR N CA sing N N 203 THR N H sing N N 204 THR N H2 sing N N 205 THR CA C sing N N 206 THR CA CB sing N N 207 THR CA HA sing N N 208 THR C O doub N N 209 THR C OXT sing N N 210 THR CB OG1 sing N N 211 THR CB CG2 sing N N 212 THR CB HB sing N N 213 THR OG1 HG1 sing N N 214 THR CG2 HG21 sing N N 215 THR CG2 HG22 sing N N 216 THR CG2 HG23 sing N N 217 THR OXT HXT sing N N 218 TRP N CA sing N N 219 TRP N H sing N N 220 TRP N H2 sing N N 221 TRP CA C sing N N 222 TRP CA CB sing N N 223 TRP CA HA sing N N 224 TRP C O doub N N 225 TRP C OXT sing N N 226 TRP CB CG sing N N 227 TRP CB HB2 sing N N 228 TRP CB HB3 sing N N 229 TRP CG CD1 doub Y N 230 TRP CG CD2 sing Y N 231 TRP CD1 NE1 sing Y N 232 TRP CD1 HD1 sing N N 233 TRP CD2 CE2 doub Y N 234 TRP CD2 CE3 sing Y N 235 TRP NE1 CE2 sing Y N 236 TRP NE1 HE1 sing N N 237 TRP CE2 CZ2 sing Y N 238 TRP CE3 CZ3 doub Y N 239 TRP CE3 HE3 sing N N 240 TRP CZ2 CH2 doub Y N 241 TRP CZ2 HZ2 sing N N 242 TRP CZ3 CH2 sing Y N 243 TRP CZ3 HZ3 sing N N 244 TRP CH2 HH2 sing N N 245 TRP OXT HXT sing N N 246 VAL N CA sing N N 247 VAL N H sing N N 248 VAL N H2 sing N N 249 VAL CA C sing N N 250 VAL CA CB sing N N 251 VAL CA HA sing N N 252 VAL C O doub N N 253 VAL C OXT sing N N 254 VAL CB CG1 sing N N 255 VAL CB CG2 sing N N 256 VAL CB HB sing N N 257 VAL CG1 HG11 sing N N 258 VAL CG1 HG12 sing N N 259 VAL CG1 HG13 sing N N 260 VAL CG2 HG21 sing N N 261 VAL CG2 HG22 sing N N 262 VAL CG2 HG23 sing N N 263 VAL OXT HXT sing N N 264 # _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2LA2 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_