data_2LC6 # _entry.id 2LC6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LC6 pdb_00002lc6 10.2210/pdb2lc6/pdb RCSB RCSB102216 ? ? BMRB 17599 ? 10.13018/BMR17599 WWPDB D_1000102216 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-11-30 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' 6 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_ref_seq_dif 6 3 'Structure model' chem_comp_atom 7 3 'Structure model' chem_comp_bond 8 3 'Structure model' database_2 9 3 'Structure model' pdbx_entry_details 10 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 2 'Structure model' '_struct_ref_seq_dif.details' 7 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LC6 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-04-25 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17599 BMRB unspecified . 2LC7 PDB unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Volkman, B.F.' 1 'Whitney, D.S.' 2 'Peterson, F.C.' 3 # _citation.id primary _citation.title 'A Conformational Switch in the CRIB-PDZ Module of Par-6.' _citation.journal_abbrev Structure _citation.journal_volume 19 _citation.page_first 1711 _citation.page_last 1722 _citation.year 2011 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22078569 _citation.pdbx_database_id_DOI 10.1016/j.str.2011.07.018 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Whitney, D.S.' 1 ? primary 'Peterson, F.C.' 2 ? primary 'Volkman, B.F.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Par-6 _entity.formula_weight 13724.749 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'Q144C, L164C' _entity.pdbx_fragment 'sequence database residues 130-255' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PAR-6, LD29223p' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSKTKAPSISIPHDFRCVSAIIDVDIVPETHRRVRLCKHGSDKPLGFYIRDGTSVRVTASGLEKQPGIFISRLVPGGLAE STGLLAVNDEVIEVNGIEVAGKTLDQVTDMMVANSSNLIITVKPANQR ; _entity_poly.pdbx_seq_one_letter_code_can ;GSKTKAPSISIPHDFRCVSAIIDVDIVPETHRRVRLCKHGSDKPLGFYIRDGTSVRVTASGLEKQPGIFISRLVPGGLAE STGLLAVNDEVIEVNGIEVAGKTLDQVTDMMVANSSNLIITVKPANQR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 LYS n 1 4 THR n 1 5 LYS n 1 6 ALA n 1 7 PRO n 1 8 SER n 1 9 ILE n 1 10 SER n 1 11 ILE n 1 12 PRO n 1 13 HIS n 1 14 ASP n 1 15 PHE n 1 16 ARG n 1 17 CYS n 1 18 VAL n 1 19 SER n 1 20 ALA n 1 21 ILE n 1 22 ILE n 1 23 ASP n 1 24 VAL n 1 25 ASP n 1 26 ILE n 1 27 VAL n 1 28 PRO n 1 29 GLU n 1 30 THR n 1 31 HIS n 1 32 ARG n 1 33 ARG n 1 34 VAL n 1 35 ARG n 1 36 LEU n 1 37 CYS n 1 38 LYS n 1 39 HIS n 1 40 GLY n 1 41 SER n 1 42 ASP n 1 43 LYS n 1 44 PRO n 1 45 LEU n 1 46 GLY n 1 47 PHE n 1 48 TYR n 1 49 ILE n 1 50 ARG n 1 51 ASP n 1 52 GLY n 1 53 THR n 1 54 SER n 1 55 VAL n 1 56 ARG n 1 57 VAL n 1 58 THR n 1 59 ALA n 1 60 SER n 1 61 GLY n 1 62 LEU n 1 63 GLU n 1 64 LYS n 1 65 GLN n 1 66 PRO n 1 67 GLY n 1 68 ILE n 1 69 PHE n 1 70 ILE n 1 71 SER n 1 72 ARG n 1 73 LEU n 1 74 VAL n 1 75 PRO n 1 76 GLY n 1 77 GLY n 1 78 LEU n 1 79 ALA n 1 80 GLU n 1 81 SER n 1 82 THR n 1 83 GLY n 1 84 LEU n 1 85 LEU n 1 86 ALA n 1 87 VAL n 1 88 ASN n 1 89 ASP n 1 90 GLU n 1 91 VAL n 1 92 ILE n 1 93 GLU n 1 94 VAL n 1 95 ASN n 1 96 GLY n 1 97 ILE n 1 98 GLU n 1 99 VAL n 1 100 ALA n 1 101 GLY n 1 102 LYS n 1 103 THR n 1 104 LEU n 1 105 ASP n 1 106 GLN n 1 107 VAL n 1 108 THR n 1 109 ASP n 1 110 MET n 1 111 MET n 1 112 VAL n 1 113 ALA n 1 114 ASN n 1 115 SER n 1 116 SER n 1 117 ASN n 1 118 LEU n 1 119 ILE n 1 120 ILE n 1 121 THR n 1 122 VAL n 1 123 LYS n 1 124 PRO n 1 125 ALA n 1 126 ASN n 1 127 GLN n 1 128 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Fruit fly' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CG5884, Dmel_CG5884, par-6' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Drosophila melanogaster' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7227 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pBH4 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 128 128 GLY GLY A . n A 1 2 SER 2 129 129 SER SER A . n A 1 3 LYS 3 130 130 LYS LYS A . n A 1 4 THR 4 131 131 THR THR A . n A 1 5 LYS 5 132 132 LYS LYS A . n A 1 6 ALA 6 133 133 ALA ALA A . n A 1 7 PRO 7 134 134 PRO PRO A . n A 1 8 SER 8 135 135 SER SER A . n A 1 9 ILE 9 136 136 ILE ILE A . n A 1 10 SER 10 137 137 SER SER A . n A 1 11 ILE 11 138 138 ILE ILE A . n A 1 12 PRO 12 139 139 PRO PRO A . n A 1 13 HIS 13 140 140 HIS HIS A . n A 1 14 ASP 14 141 141 ASP ASP A . n A 1 15 PHE 15 142 142 PHE PHE A . n A 1 16 ARG 16 143 143 ARG ARG A . n A 1 17 CYS 17 144 144 CYS CYS A . n A 1 18 VAL 18 145 145 VAL VAL A . n A 1 19 SER 19 146 146 SER SER A . n A 1 20 ALA 20 147 147 ALA ALA A . n A 1 21 ILE 21 148 148 ILE ILE A . n A 1 22 ILE 22 149 149 ILE ILE A . n A 1 23 ASP 23 150 150 ASP ASP A . n A 1 24 VAL 24 151 151 VAL VAL A . n A 1 25 ASP 25 152 152 ASP ASP A . n A 1 26 ILE 26 153 153 ILE ILE A . n A 1 27 VAL 27 154 154 VAL VAL A . n A 1 28 PRO 28 155 155 PRO PRO A . n A 1 29 GLU 29 156 156 GLU GLU A . n A 1 30 THR 30 157 157 THR THR A . n A 1 31 HIS 31 158 158 HIS HIS A . n A 1 32 ARG 32 159 159 ARG ARG A . n A 1 33 ARG 33 160 160 ARG ARG A . n A 1 34 VAL 34 161 161 VAL VAL A . n A 1 35 ARG 35 162 162 ARG ARG A . n A 1 36 LEU 36 163 163 LEU LEU A . n A 1 37 CYS 37 164 164 CYS CYS A . n A 1 38 LYS 38 165 165 LYS LYS A . n A 1 39 HIS 39 166 166 HIS HIS A . n A 1 40 GLY 40 167 167 GLY GLY A . n A 1 41 SER 41 168 168 SER SER A . n A 1 42 ASP 42 169 169 ASP ASP A . n A 1 43 LYS 43 170 170 LYS LYS A . n A 1 44 PRO 44 171 171 PRO PRO A . n A 1 45 LEU 45 172 172 LEU LEU A . n A 1 46 GLY 46 173 173 GLY GLY A . n A 1 47 PHE 47 174 174 PHE PHE A . n A 1 48 TYR 48 175 175 TYR TYR A . n A 1 49 ILE 49 176 176 ILE ILE A . n A 1 50 ARG 50 177 177 ARG ARG A . n A 1 51 ASP 51 178 178 ASP ASP A . n A 1 52 GLY 52 179 179 GLY GLY A . n A 1 53 THR 53 180 180 THR THR A . n A 1 54 SER 54 181 181 SER SER A . n A 1 55 VAL 55 182 182 VAL VAL A . n A 1 56 ARG 56 183 183 ARG ARG A . n A 1 57 VAL 57 184 184 VAL VAL A . n A 1 58 THR 58 185 185 THR THR A . n A 1 59 ALA 59 186 186 ALA ALA A . n A 1 60 SER 60 187 187 SER SER A . n A 1 61 GLY 61 188 188 GLY GLY A . n A 1 62 LEU 62 189 189 LEU LEU A . n A 1 63 GLU 63 190 190 GLU GLU A . n A 1 64 LYS 64 191 191 LYS LYS A . n A 1 65 GLN 65 192 192 GLN GLN A . n A 1 66 PRO 66 193 193 PRO PRO A . n A 1 67 GLY 67 194 194 GLY GLY A . n A 1 68 ILE 68 195 195 ILE ILE A . n A 1 69 PHE 69 196 196 PHE PHE A . n A 1 70 ILE 70 197 197 ILE ILE A . n A 1 71 SER 71 198 198 SER SER A . n A 1 72 ARG 72 199 199 ARG ARG A . n A 1 73 LEU 73 200 200 LEU LEU A . n A 1 74 VAL 74 201 201 VAL VAL A . n A 1 75 PRO 75 202 202 PRO PRO A . n A 1 76 GLY 76 203 203 GLY GLY A . n A 1 77 GLY 77 204 204 GLY GLY A . n A 1 78 LEU 78 205 205 LEU LEU A . n A 1 79 ALA 79 206 206 ALA ALA A . n A 1 80 GLU 80 207 207 GLU GLU A . n A 1 81 SER 81 208 208 SER SER A . n A 1 82 THR 82 209 209 THR THR A . n A 1 83 GLY 83 210 210 GLY GLY A . n A 1 84 LEU 84 211 211 LEU LEU A . n A 1 85 LEU 85 212 212 LEU LEU A . n A 1 86 ALA 86 213 213 ALA ALA A . n A 1 87 VAL 87 214 214 VAL VAL A . n A 1 88 ASN 88 215 215 ASN ASN A . n A 1 89 ASP 89 216 216 ASP ASP A . n A 1 90 GLU 90 217 217 GLU GLU A . n A 1 91 VAL 91 218 218 VAL VAL A . n A 1 92 ILE 92 219 219 ILE ILE A . n A 1 93 GLU 93 220 220 GLU GLU A . n A 1 94 VAL 94 221 221 VAL VAL A . n A 1 95 ASN 95 222 222 ASN ASN A . n A 1 96 GLY 96 223 223 GLY GLY A . n A 1 97 ILE 97 224 224 ILE ILE A . n A 1 98 GLU 98 225 225 GLU GLU A . n A 1 99 VAL 99 226 226 VAL VAL A . n A 1 100 ALA 100 227 227 ALA ALA A . n A 1 101 GLY 101 228 228 GLY GLY A . n A 1 102 LYS 102 229 229 LYS LYS A . n A 1 103 THR 103 230 230 THR THR A . n A 1 104 LEU 104 231 231 LEU LEU A . n A 1 105 ASP 105 232 232 ASP ASP A . n A 1 106 GLN 106 233 233 GLN GLN A . n A 1 107 VAL 107 234 234 VAL VAL A . n A 1 108 THR 108 235 235 THR THR A . n A 1 109 ASP 109 236 236 ASP ASP A . n A 1 110 MET 110 237 237 MET MET A . n A 1 111 MET 111 238 238 MET MET A . n A 1 112 VAL 112 239 239 VAL VAL A . n A 1 113 ALA 113 240 240 ALA ALA A . n A 1 114 ASN 114 241 241 ASN ASN A . n A 1 115 SER 115 242 242 SER SER A . n A 1 116 SER 116 243 243 SER SER A . n A 1 117 ASN 117 244 244 ASN ASN A . n A 1 118 LEU 118 245 245 LEU LEU A . n A 1 119 ILE 119 246 246 ILE ILE A . n A 1 120 ILE 120 247 247 ILE ILE A . n A 1 121 THR 121 248 248 THR THR A . n A 1 122 VAL 122 249 249 VAL VAL A . n A 1 123 LYS 123 250 250 LYS LYS A . n A 1 124 PRO 124 251 251 PRO PRO A . n A 1 125 ALA 125 252 252 ALA ALA A . n A 1 126 ASN 126 253 253 ASN ASN A . n A 1 127 GLN 127 254 254 GLN GLN A . n A 1 128 ARG 128 255 255 ARG ARG A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LC6 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LC6 _struct.title 'Solution structure of Par-6 Q144C/L164C' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LC6 _struct_keywords.pdbx_keywords 'CELL ADHESION' _struct_keywords.text 'PDZ domain, CRIB, Cdc42, CELL ADHESION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O97111_DROME _struct_ref.pdbx_db_accession O97111 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KTKAPSISIPHDFRQVSAIIDVDIVPETHRRVRLLKHGSDKPLGFYIRDGTSVRVTASGLEKQPGIFISRLVPGGLAEST GLLAVNDEVIEVNGIEVAGKTLDQVTDMMVANSSNLIITVKPANQR ; _struct_ref.pdbx_align_begin 130 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LC6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 128 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O97111 _struct_ref_seq.db_align_beg 130 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 255 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 130 _struct_ref_seq.pdbx_auth_seq_align_end 255 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LC6 GLY A 1 ? UNP O97111 ? ? 'expression tag' 128 1 1 2LC6 SER A 2 ? UNP O97111 ? ? 'expression tag' 129 2 1 2LC6 CYS A 17 ? UNP O97111 GLN 144 'engineered mutation' 144 3 1 2LC6 CYS A 37 ? UNP O97111 LEU 164 'engineered mutation' 164 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 77 ? GLY A 83 ? GLY A 204 GLY A 210 1 ? 7 HELX_P HELX_P2 2 THR A 103 ? ASN A 114 ? THR A 230 ASN A 241 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 17 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 37 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 144 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 164 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.043 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 17 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 37 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 144 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 164 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 32 ? CYS A 37 ? ARG A 159 CYS A 164 A 2 ASN A 117 ? LYS A 123 ? ASN A 244 LYS A 250 A 3 GLU A 90 ? VAL A 94 ? GLU A 217 VAL A 221 A 4 LEU A 62 ? LEU A 73 ? LEU A 189 LEU A 200 A 5 PHE A 47 ? VAL A 57 ? PHE A 174 VAL A 184 B 1 ARG A 32 ? CYS A 37 ? ARG A 159 CYS A 164 B 2 ASN A 117 ? LYS A 123 ? ASN A 244 LYS A 250 B 3 GLU A 90 ? VAL A 94 ? GLU A 217 VAL A 221 B 4 ILE A 97 ? GLU A 98 ? ILE A 224 GLU A 225 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 32 ? N ARG A 159 O VAL A 122 ? O VAL A 249 A 2 3 O THR A 121 ? O THR A 248 N ILE A 92 ? N ILE A 219 A 3 4 O VAL A 91 ? O VAL A 218 N ILE A 68 ? N ILE A 195 A 4 5 O PHE A 69 ? O PHE A 196 N ARG A 50 ? N ARG A 177 B 1 2 N ARG A 32 ? N ARG A 159 O VAL A 122 ? O VAL A 249 B 2 3 O THR A 121 ? O THR A 248 N ILE A 92 ? N ILE A 219 B 3 4 N VAL A 94 ? N VAL A 221 O ILE A 97 ? O ILE A 224 # _pdbx_entry_details.entry_id 2LC6 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ2 A LYS 165 ? ? OD1 A ASP 169 ? ? 1.59 2 7 HZ3 A LYS 165 ? ? OD1 A ASP 169 ? ? 1.60 3 11 HZ1 A LYS 132 ? ? OD1 A ASP 150 ? ? 1.60 4 16 HG A SER 181 ? ? OE1 A GLU 217 ? ? 1.60 5 17 HZ3 A LYS 165 ? ? OD2 A ASP 169 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 222 ? ? 73.18 -28.71 2 1 GLN A 254 ? ? 66.88 67.99 3 2 PRO A 134 ? ? -75.62 38.69 4 2 PRO A 139 ? ? -85.91 -159.93 5 2 ASP A 150 ? ? 53.69 17.93 6 2 SER A 168 ? ? 66.28 160.89 7 2 ASN A 253 ? ? 59.93 88.56 8 3 LYS A 130 ? ? -90.02 -60.21 9 3 PRO A 134 ? ? -49.68 108.98 10 3 SER A 135 ? ? -151.07 -45.94 11 3 ILE A 136 ? ? 67.06 98.63 12 3 LYS A 170 ? ? 59.92 167.52 13 3 ASN A 222 ? ? 71.69 -54.28 14 3 VAL A 226 ? ? 61.89 -20.32 15 4 LYS A 130 ? ? -120.68 -60.21 16 4 THR A 131 ? ? 51.45 72.21 17 4 ILE A 136 ? ? 72.60 114.45 18 4 HIS A 140 ? ? -146.07 23.10 19 4 ASP A 169 ? ? -53.49 -73.70 20 4 LYS A 170 ? ? 59.95 161.46 21 4 ASN A 222 ? ? 76.37 -27.18 22 4 ASN A 253 ? ? 62.51 66.72 23 4 GLN A 254 ? ? 69.38 -37.83 24 5 LYS A 130 ? ? 44.48 82.02 25 5 SER A 168 ? ? 67.17 -68.81 26 5 VAL A 226 ? ? 61.56 -20.26 27 5 ASN A 253 ? ? 70.29 75.80 28 6 LYS A 130 ? ? 67.78 95.95 29 6 SER A 135 ? ? 55.98 86.38 30 6 PHE A 142 ? ? -128.09 -70.74 31 6 SER A 168 ? ? 174.41 -175.28 32 6 VAL A 226 ? ? 64.02 -14.93 33 7 PRO A 139 ? ? -67.69 76.61 34 7 HIS A 140 ? ? -162.14 24.23 35 7 ASN A 222 ? ? 71.19 -71.03 36 7 VAL A 226 ? ? 55.46 0.95 37 7 ASN A 253 ? ? 49.21 81.35 38 8 ASN A 253 ? ? 58.70 96.09 39 9 VAL A 226 ? ? 59.13 -11.04 40 9 GLN A 254 ? ? 70.38 89.48 41 10 THR A 131 ? ? -162.02 -62.97 42 10 LYS A 132 ? ? 56.79 86.33 43 10 SER A 135 ? ? 68.95 108.77 44 10 HIS A 140 ? ? -100.90 73.95 45 10 ASN A 222 ? ? 71.35 -71.47 46 10 ASN A 253 ? ? 66.63 -177.06 47 11 LYS A 130 ? ? -175.78 92.97 48 11 SER A 135 ? ? 57.35 75.35 49 11 ASN A 253 ? ? 65.41 97.80 50 12 SER A 137 ? ? 58.86 81.57 51 12 HIS A 140 ? ? -138.99 -58.43 52 12 ASP A 141 ? ? 69.80 158.69 53 12 PHE A 142 ? ? -142.52 -50.03 54 12 ASN A 222 ? ? 74.32 -52.72 55 12 VAL A 226 ? ? 57.00 -2.55 56 12 ASN A 253 ? ? 51.57 -84.83 57 13 LYS A 132 ? ? 68.43 112.26 58 13 PRO A 134 ? ? -44.48 104.50 59 13 PHE A 142 ? ? -179.61 -37.94 60 13 ASN A 253 ? ? 73.45 -39.56 61 14 SER A 135 ? ? 61.59 74.31 62 14 PRO A 193 ? ? -59.20 108.57 63 14 ASN A 222 ? ? 59.32 16.07 64 14 VAL A 226 ? ? 55.39 4.09 65 14 ASN A 253 ? ? 76.49 141.39 66 15 THR A 131 ? ? 73.33 -51.67 67 15 SER A 135 ? ? 66.01 84.82 68 15 PHE A 142 ? ? -137.02 -35.82 69 15 ASP A 150 ? ? 41.82 79.04 70 15 PRO A 171 ? ? -49.92 159.58 71 15 ASN A 222 ? ? 67.51 -72.85 72 15 ASN A 253 ? ? 67.99 -107.07 73 16 SER A 135 ? ? 70.20 -76.95 74 16 ILE A 136 ? ? 53.77 71.74 75 16 HIS A 140 ? ? 72.43 127.90 76 16 LYS A 170 ? ? 65.56 160.08 77 16 ASN A 253 ? ? 72.46 138.98 78 17 LYS A 132 ? ? -106.67 68.81 79 17 SER A 137 ? ? 70.41 -164.28 80 17 PHE A 142 ? ? -143.87 -51.92 81 17 SER A 168 ? ? 179.85 107.00 82 18 LYS A 130 ? ? 58.72 82.42 83 18 SER A 168 ? ? 62.37 175.55 84 18 ASP A 169 ? ? 64.53 -0.21 85 18 ASN A 222 ? ? 72.97 -70.61 86 18 GLN A 254 ? ? -44.43 101.61 87 19 THR A 131 ? ? 71.90 -33.50 88 19 PRO A 134 ? ? -59.05 103.38 89 19 ASP A 141 ? ? -179.01 89.78 90 19 ASN A 222 ? ? 76.86 -53.10 91 19 GLN A 254 ? ? 59.54 88.47 92 20 ASP A 141 ? ? 59.59 -159.78 93 20 ASN A 222 ? ? 68.61 -77.07 94 20 ASN A 253 ? ? 60.45 78.13 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 3 ARG A 160 ? ? 0.082 'SIDE CHAIN' 2 10 ARG A 160 ? ? 0.090 'SIDE CHAIN' 3 20 ARG A 160 ? ? 0.087 'SIDE CHAIN' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LC6 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LC6 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '1 mM [U-100% 13C; U-100% 15N] Par-6, 20 mM sodium phosphate, 50 mM sodium chloride, 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Par-6-1 1 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium phosphate-2' 20 ? mM ? 1 'sodium chloride-3' 50 ? mM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 53 _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 3 1 '3D_13C-separated_NOESY (AROMATIC)' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LC6 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1604 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 407 _pdbx_nmr_constraints.NOE_long_range_total_count 558 _pdbx_nmr_constraints.NOE_medium_range_total_count 251 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 388 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 82 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 83 # _pdbx_nmr_refine.entry_id 2LC6 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ;AUTOMATED METHODS WERE USED FOR BACKBONE CHEMICAL SHIFT ASSIGNMENT AND ITERATIVE NOE REFINEMENT. FINAL STRUCTURES WERE OBTAINED BY MOLECULAR DYNAMICS IN EXPLICIT SOLVENTSTRUCTURES ARE BASED ON A TOTAL OF 1604 NOE CONSTRAINTS ( 407 INTRA, 388 SEQUENTIAL, 251 MEDIUM, AND 558 LONG RANGE) AND 165 PHI AND PSI DIHEDRAL ANGLE CONSTRAINTS., STRUCTURES ARE BASED ON A TOTAL OF 1604 NOE CONSTRAINTS ( 407 INTRA, 388 SEQUENTIAL, 251 MEDIUM, AND 558 LONG RANGE) AND 165 PHI AND PSI DIHEDRAL ANGLE CONSTRAINTS. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal SCHWIETERS,C.D.,KUSZEWSKI,J.J.,TJANDRA,N.,CLORE,G.M. refinement Xplor-NIH 2.9.3 1 Bruker collection TopSpin 2.1 2 'Delagio,F. et al.' processing NMRPipe 2007 3 'Eccles, C., Guntert, P., Billeter, M., Wuthrich, K.' 'data analysis' XEASY 1.3 4 'C. Bartels' 'data analysis' GARANT 2.1 5 'Guntert, P.' 'structural calculation' CYANA 2.1 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model 'AVANCE II' _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance II' # _atom_sites.entry_id 2LC6 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #