data_2LCI # _entry.id 2LCI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LCI pdb_00002lci 10.2210/pdb2lci/pdb RCSB RCSB102228 ? ? BMRB 17613 ? ? WWPDB D_1000102228 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17613 BMRB unspecified . OR36 TargetDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LCI _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-04-29 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, G.' 1 'Koga, N.' 2 'Koga, R.' 3 'Xiao, R.' 4 'Janjua, H.' 5 'Ciccosanti, C.' 6 'Lee, H.' 7 'Acton, T.B.' 8 'Everett, J.' 9 'Baker, D.' 10 'Montelione, G.T.' 11 'Northeast Structural Genomics Consortium (NESG)' 12 # _citation.id primary _citation.title 'Northeast Structural Genomics Consortium Target OR36' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, G.' 1 ? primary 'Koga, N.' 2 ? primary 'Koga, R.' 3 ? primary 'Xiao, R.' 4 ? primary 'Lee, H.T.' 5 ? primary 'Janjua, H.' 6 ? primary 'Ciccosanti, C.' 7 ? primary 'Acton, T.B.' 8 ? primary 'Everett, J.' 9 ? primary 'Baker, D.' 10 ? primary 'Montelione, G.T.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Protein OR36' _entity.formula_weight 16031.430 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKILILINTNNDELIKKIKKEVENQGYQVRDVNDSDELKKEMKKLAEEKNFEKILIISNDKQLLKEMLELISKLGYKVFL LLQDQDENELEEFKRKIESQGYEVRKVTDDEEALKIVREFMQKAGSLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MKILILINTNNDELIKKIKKEVENQGYQVRDVNDSDELKKEMKKLAEEKNFEKILIISNDKQLLKEMLELISKLGYKVFL LLQDQDENELEEFKRKIESQGYEVRKVTDDEEALKIVREFMQKAGSLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier OR36 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 ILE n 1 4 LEU n 1 5 ILE n 1 6 LEU n 1 7 ILE n 1 8 ASN n 1 9 THR n 1 10 ASN n 1 11 ASN n 1 12 ASP n 1 13 GLU n 1 14 LEU n 1 15 ILE n 1 16 LYS n 1 17 LYS n 1 18 ILE n 1 19 LYS n 1 20 LYS n 1 21 GLU n 1 22 VAL n 1 23 GLU n 1 24 ASN n 1 25 GLN n 1 26 GLY n 1 27 TYR n 1 28 GLN n 1 29 VAL n 1 30 ARG n 1 31 ASP n 1 32 VAL n 1 33 ASN n 1 34 ASP n 1 35 SER n 1 36 ASP n 1 37 GLU n 1 38 LEU n 1 39 LYS n 1 40 LYS n 1 41 GLU n 1 42 MET n 1 43 LYS n 1 44 LYS n 1 45 LEU n 1 46 ALA n 1 47 GLU n 1 48 GLU n 1 49 LYS n 1 50 ASN n 1 51 PHE n 1 52 GLU n 1 53 LYS n 1 54 ILE n 1 55 LEU n 1 56 ILE n 1 57 ILE n 1 58 SER n 1 59 ASN n 1 60 ASP n 1 61 LYS n 1 62 GLN n 1 63 LEU n 1 64 LEU n 1 65 LYS n 1 66 GLU n 1 67 MET n 1 68 LEU n 1 69 GLU n 1 70 LEU n 1 71 ILE n 1 72 SER n 1 73 LYS n 1 74 LEU n 1 75 GLY n 1 76 TYR n 1 77 LYS n 1 78 VAL n 1 79 PHE n 1 80 LEU n 1 81 LEU n 1 82 LEU n 1 83 GLN n 1 84 ASP n 1 85 GLN n 1 86 ASP n 1 87 GLU n 1 88 ASN n 1 89 GLU n 1 90 LEU n 1 91 GLU n 1 92 GLU n 1 93 PHE n 1 94 LYS n 1 95 ARG n 1 96 LYS n 1 97 ILE n 1 98 GLU n 1 99 SER n 1 100 GLN n 1 101 GLY n 1 102 TYR n 1 103 GLU n 1 104 VAL n 1 105 ARG n 1 106 LYS n 1 107 VAL n 1 108 THR n 1 109 ASP n 1 110 ASP n 1 111 GLU n 1 112 GLU n 1 113 ALA n 1 114 LEU n 1 115 LYS n 1 116 ILE n 1 117 VAL n 1 118 ARG n 1 119 GLU n 1 120 PHE n 1 121 MET n 1 122 GLN n 1 123 LYS n 1 124 ALA n 1 125 GLY n 1 126 SER n 1 127 LEU n 1 128 GLU n 1 129 HIS n 1 130 HIS n 1 131 HIS n 1 132 HIS n 1 133 HIS n 1 134 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'artificial gene' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET29b+ _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2LCI _struct_ref.pdbx_db_accession 2LCI _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LCI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 134 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2LCI _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 134 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 134 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D 1H-13C arom NOESY' 1 7 1 '3D simutaneous 13C-aromatic,13C-aliphatic,15N edited 1H-1H NOESY' 1 8 3 '2D 1H-15N HSQC' 1 9 2 '2D HetNOE' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.71 mM [U-100% 13C; U-100% 15N] OR36, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.95 mM [U-10% 13C; U-100% 15N] OR36, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '0.95 mM [U-10% 13C; U-100% 15N] OR36, 90% H2O/10% D2O' 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Varian INOVA 2 'Varian INOVA' 600 Varian INOVA 3 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2LCI _pdbx_nmr_refine.method 'distance geometry, molecular dynamics, torsion angle dynamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LCI _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LCI _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'geometry optimization' CNS ? 3 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA 3.0 4 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 6 'Huang, Tejero, Powers and Montelione' 'data analysis' AutoStructure 2.1 7 'Huang, Tejero, Powers and Montelione' refinement AutoStructure 2.1 8 'Zimmerman, Moseley, Kulikowski and Montelione' 'data analysis' AutoAssign 2.1 9 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.1 10 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 11 'Bartels et al.' 'data analysis' XEASY ? 12 'Bartels et al.' 'peak picking' XEASY ? 13 'Bartels et al.' 'chemical shift assignment' XEASY ? 14 'Bruker Biospin' collection TopSpin ? 15 Varian collection VnmrJ ? 16 Goddard 'data analysis' Sparky ? 17 'Shen, Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS+ ? 18 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LCI _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LCI _struct.title ;Solution NMR Structure of DE NOVO DESIGNED PROTEIN, P-LOOP NTPASE FOLD, Northeast Structural Genomics Consortium Target OR36 (CASD Target) ; _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag Y _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LCI _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' _struct_keywords.text 'Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, NESG, PSI-Biology, Protein Structure Initiative, DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 11 ? VAL A 22 ? ASN A 11 VAL A 22 1 ? 12 HELX_P HELX_P2 2 ASP A 34 ? GLU A 48 ? ASP A 34 GLU A 48 1 ? 15 HELX_P HELX_P3 3 ASP A 60 ? GLY A 75 ? ASP A 60 GLY A 75 1 ? 16 HELX_P HELX_P4 4 ASP A 86 ? SER A 99 ? ASP A 86 SER A 99 1 ? 14 HELX_P HELX_P5 5 ASP A 109 ? HIS A 129 ? ASP A 109 HIS A 129 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 28 ? VAL A 32 ? GLN A 28 VAL A 32 A 2 ILE A 54 ? SER A 58 ? ILE A 54 SER A 58 A 3 LEU A 4 ? ASN A 8 ? LEU A 4 ASN A 8 A 4 VAL A 78 ? GLN A 83 ? VAL A 78 GLN A 83 A 5 GLU A 103 ? VAL A 107 ? GLU A 103 VAL A 107 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLN A 28 ? N GLN A 28 O LEU A 55 ? O LEU A 55 A 2 3 O ILE A 56 ? O ILE A 56 N ILE A 7 ? N ILE A 7 A 3 4 N ASN A 8 ? N ASN A 8 O LEU A 81 ? O LEU A 81 A 4 5 N LEU A 82 ? N LEU A 82 O ARG A 105 ? O ARG A 105 # _atom_sites.entry_id 2LCI _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 MET 67 67 67 MET MET A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 MET 121 121 121 MET MET A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 HIS 129 129 129 HIS HIS A . n A 1 130 HIS 130 130 130 HIS HIS A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 HIS 132 132 132 HIS HIS A . n A 1 133 HIS 133 133 133 HIS HIS A . n A 1 134 HIS 134 134 134 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-06-29 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2012-02-22 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Structure summary' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id OR36-1 0.71 ? mM '[U-100% 13C; U-100% 15N]' 1 OR36-2 0.95 ? mM '[U-10% 13C; U-100% 15N]' 2 OR36-3 0.95 ? mM '[U-10% 13C; U-100% 15N]' 3 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 8 _pdbx_validate_close_contact.auth_atom_id_1 HZ3 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 LYS _pdbx_validate_close_contact.auth_seq_id_1 2 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HA _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 LEU _pdbx_validate_close_contact.auth_seq_id_2 45 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.31 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 2 ? ? 178.11 125.36 2 1 GLU A 103 ? ? -69.56 94.82 3 1 HIS A 130 ? ? -59.50 98.18 4 2 LYS A 53 ? ? -66.95 93.98 5 3 LYS A 2 ? ? 76.57 115.91 6 3 PHE A 51 ? ? -90.73 30.83 7 3 GLU A 103 ? ? -67.17 97.07 8 3 HIS A 131 ? ? -92.07 -72.09 9 4 HIS A 132 ? ? 55.60 99.12 10 5 PHE A 51 ? ? -88.61 31.33 11 6 HIS A 131 ? ? 62.35 -87.60 12 7 ASN A 50 ? ? -115.58 79.55 13 10 GLU A 48 ? ? 78.08 -41.74 14 10 LYS A 49 ? ? -66.71 71.52 15 10 ASN A 50 ? ? 171.28 72.63 16 10 HIS A 130 ? ? -69.72 80.60 17 10 HIS A 131 ? ? 152.00 80.49 18 11 PHE A 51 ? ? -69.54 7.28 19 11 HIS A 130 ? ? -69.29 81.71 20 11 HIS A 133 ? ? -55.31 91.16 21 12 GLU A 48 ? ? -89.21 30.78 22 12 LYS A 49 ? ? -67.02 94.33 23 12 HIS A 129 ? ? -76.81 28.01 24 12 HIS A 130 ? ? 73.38 41.93 25 13 PHE A 51 ? ? -92.27 30.31 26 13 HIS A 131 ? ? -91.57 57.08 27 13 HIS A 133 ? ? 67.51 86.87 28 14 LYS A 49 ? ? -65.46 96.51 29 14 ASN A 50 ? ? 67.30 119.39 30 14 LEU A 74 ? ? -75.74 -74.65 31 14 HIS A 130 ? ? -66.65 89.66 32 15 LYS A 49 ? ? 72.11 -67.47 33 15 LEU A 74 ? ? -94.06 -60.67 34 15 HIS A 130 ? ? 167.84 -40.07 35 16 THR A 108 ? ? -141.72 43.92 36 17 LYS A 49 ? ? -67.35 96.19 37 18 HIS A 130 ? ? -66.38 84.08 38 18 HIS A 131 ? ? -174.82 113.03 39 18 HIS A 132 ? ? -65.93 99.18 40 19 HIS A 130 ? ? -66.16 87.02 41 20 HIS A 130 ? ? -67.11 87.16 #