data_2LF8 # _entry.id 2LF8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LF8 pdb_00002lf8 10.2210/pdb2lf8/pdb RCSB RCSB102319 ? ? BMRB 17742 ? ? WWPDB D_1000102319 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17742 BMRB unspecified . 2LF7 PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LF8 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-06-28 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Coyne III, H.' 1 'Green, S.M.' 2 'Graves, B.J.' 3 'Mcintosh, L.P.' 4 # _citation.id primary _citation.title 'Autoinhibition of ETV6 (TEL) DNA Binding: Appended Helices Sterically Block the ETS Domain.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 421 _citation.page_first 67 _citation.page_last 84 _citation.year 2012 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22584210 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2012.05.010 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Coyne, H.J.' 1 ? primary 'De, S.' 2 ? primary 'Okon, M.' 3 ? primary 'Green, S.M.' 4 ? primary 'Bhachech, N.' 5 ? primary 'Graves, B.J.' 6 ? primary 'McIntosh, L.P.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Transcription factor ETV6' _entity.formula_weight 15574.679 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'ETS DNA binding domain residues 335-458' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ETS translocation variant 6, ETS-related protein Tel1, Tel' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMRLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQR LLFRFMKTPDEIMSGRTDRLEHLESQVLDEQTYQEDEPTIASPVGWPR ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMRLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQR LLFRFMKTPDEIMSGRTDRLEHLESQVLDEQTYQEDEPTIASPVGWPR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ARG n 1 6 LEU n 1 7 LEU n 1 8 TRP n 1 9 ASP n 1 10 TYR n 1 11 VAL n 1 12 TYR n 1 13 GLN n 1 14 LEU n 1 15 LEU n 1 16 SER n 1 17 ASP n 1 18 SER n 1 19 ARG n 1 20 TYR n 1 21 GLU n 1 22 ASN n 1 23 PHE n 1 24 ILE n 1 25 ARG n 1 26 TRP n 1 27 GLU n 1 28 ASP n 1 29 LYS n 1 30 GLU n 1 31 SER n 1 32 LYS n 1 33 ILE n 1 34 PHE n 1 35 ARG n 1 36 ILE n 1 37 VAL n 1 38 ASP n 1 39 PRO n 1 40 ASN n 1 41 GLY n 1 42 LEU n 1 43 ALA n 1 44 ARG n 1 45 LEU n 1 46 TRP n 1 47 GLY n 1 48 ASN n 1 49 HIS n 1 50 LYS n 1 51 ASN n 1 52 ARG n 1 53 THR n 1 54 ASN n 1 55 MET n 1 56 THR n 1 57 TYR n 1 58 GLU n 1 59 LYS n 1 60 MET n 1 61 SER n 1 62 ARG n 1 63 ALA n 1 64 LEU n 1 65 ARG n 1 66 HIS n 1 67 TYR n 1 68 TYR n 1 69 LYS n 1 70 LEU n 1 71 ASN n 1 72 ILE n 1 73 ILE n 1 74 ARG n 1 75 LYS n 1 76 GLU n 1 77 PRO n 1 78 GLY n 1 79 GLN n 1 80 ARG n 1 81 LEU n 1 82 LEU n 1 83 PHE n 1 84 ARG n 1 85 PHE n 1 86 MET n 1 87 LYS n 1 88 THR n 1 89 PRO n 1 90 ASP n 1 91 GLU n 1 92 ILE n 1 93 MET n 1 94 SER n 1 95 GLY n 1 96 ARG n 1 97 THR n 1 98 ASP n 1 99 ARG n 1 100 LEU n 1 101 GLU n 1 102 HIS n 1 103 LEU n 1 104 GLU n 1 105 SER n 1 106 GLN n 1 107 VAL n 1 108 LEU n 1 109 ASP n 1 110 GLU n 1 111 GLN n 1 112 THR n 1 113 TYR n 1 114 GLN n 1 115 GLU n 1 116 ASP n 1 117 GLU n 1 118 PRO n 1 119 THR n 1 120 ILE n 1 121 ALA n 1 122 SER n 1 123 PRO n 1 124 VAL n 1 125 GLY n 1 126 TRP n 1 127 PRO n 1 128 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Etv6, mouse ETV6, Tel, Tel1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET28b+ _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ETV6_MOUSE _struct_ref.pdbx_db_accession P97360 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;RLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFR FMKTPDEIMSGRTDRLEHLESQVLDEQTYQEDEPTIASPVGWPR ; _struct_ref.pdbx_align_begin 335 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LF8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 128 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P97360 _struct_ref_seq.db_align_beg 335 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 458 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 335 _struct_ref_seq.pdbx_auth_seq_align_end 458 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LF8 GLY A 1 ? UNP P97360 ? ? 'expression tag' 331 1 1 2LF8 SER A 2 ? UNP P97360 ? ? 'expression tag' 332 2 1 2LF8 HIS A 3 ? UNP P97360 ? ? 'expression tag' 333 3 1 2LF8 MET A 4 ? UNP P97360 ? ? 'expression tag' 334 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D 1H-13C NOESY' 1 3 1 '2D 1H-13C HSQC aromatic' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D HCCH-TOCSY' 1 7 1 '3D HN(CO)CA' 1 8 1 '3D HNCO' 1 9 1 '3D HBHA(CO)NH' 1 10 1 '3D 1H-13C NOESY' 1 11 1 dipsi3dn 1 12 1 'Cmethyl NOESY' 1 13 1 'Nmethyl NOESY' 1 14 1 hcctocsynnh 1 15 1 ccctocsynnh 1 16 1 '2D 1H-15N HSQC' 1 17 1 '2D 1H-13C HSQC aliphatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.250 _pdbx_nmr_exptl_sample_conditions.pH 5.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '50 mM sodium phosphate, 200 mM sodium chloride, 0.4 mM [U-99% 13C; U-99% 15N] protein, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 500 Varian UNITY 2 'Varian Unity' # _pdbx_nmr_refine.entry_id 2LF8 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;iteration protocol used default values except iteration6 had the violation tolerance 0.09 violation threshold 0.5 and max_contribution 15, iteration7 set the violation threshold 0.07 violation threshold 0.4 max_contributions 10. iteration 8 set the violation tolerance 0.05 violation threshold 0.3 max_contributions 5. The chemical shift tolerances were set to proton1=0.03 hetero1=0.4 proton2=0.3 and hetero2= 0.4. Violated restraints used in the calcuation were examined manually for correct identification as were restraints not used in the calculation over 3 angstroms. Long, medium, and short NOEs not used in the calcualtion were examined on refinement as were ambigous assigments with 3 or more contributions. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with acceptable covalent geometry' _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 19 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LF8 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 0.06 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.33 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LF8 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 2.3 1 'Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS+ ? 2 Goddard 'data analysis' Sparky ? 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 4 ;Linge, O'Donoghue and Nilges ; refinement ARIA ? 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LF8 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LF8 _struct.title 'Intramolecular regulation of the ETS Domain within ETV6 sequence R335 to R458' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LF8 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'auto-inhibition, TRANSCRIPTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 6 ? LEU A 15 ? LEU A 336 LEU A 345 1 ? 10 HELX_P HELX_P2 2 SER A 16 ? ASN A 22 ? SER A 346 ASN A 352 5 ? 7 HELX_P HELX_P3 3 ASP A 38 ? LYS A 50 ? ASP A 368 LYS A 380 1 ? 13 HELX_P HELX_P4 4 THR A 56 ? LEU A 70 ? THR A 386 LEU A 400 1 ? 15 HELX_P HELX_P5 5 THR A 88 ? MET A 93 ? THR A 418 MET A 423 1 ? 6 HELX_P HELX_P6 6 ARG A 96 ? GLN A 111 ? ARG A 426 GLN A 441 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 24 ? ASP A 28 ? ILE A 354 ASP A 358 A 2 ILE A 33 ? ILE A 36 ? ILE A 363 ILE A 366 A 3 LEU A 82 ? PHE A 85 ? LEU A 412 PHE A 415 A 4 ILE A 73 ? LYS A 75 ? ILE A 403 LYS A 405 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 25 ? N ARG A 355 O ARG A 35 ? O ARG A 365 A 2 3 N PHE A 34 ? N PHE A 364 O PHE A 83 ? O PHE A 413 A 3 4 O ARG A 84 ? O ARG A 414 N ARG A 74 ? N ARG A 404 # _atom_sites.entry_id 2LF8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 331 331 GLY GLY A . n A 1 2 SER 2 332 332 SER SER A . n A 1 3 HIS 3 333 333 HIS HIS A . n A 1 4 MET 4 334 334 MET MET A . n A 1 5 ARG 5 335 335 ARG ARG A . n A 1 6 LEU 6 336 336 LEU LEU A . n A 1 7 LEU 7 337 337 LEU LEU A . n A 1 8 TRP 8 338 338 TRP TRP A . n A 1 9 ASP 9 339 339 ASP ASP A . n A 1 10 TYR 10 340 340 TYR TYR A . n A 1 11 VAL 11 341 341 VAL VAL A . n A 1 12 TYR 12 342 342 TYR TYR A . n A 1 13 GLN 13 343 343 GLN GLN A . n A 1 14 LEU 14 344 344 LEU LEU A . n A 1 15 LEU 15 345 345 LEU LEU A . n A 1 16 SER 16 346 346 SER SER A . n A 1 17 ASP 17 347 347 ASP ASP A . n A 1 18 SER 18 348 348 SER SER A . n A 1 19 ARG 19 349 349 ARG ARG A . n A 1 20 TYR 20 350 350 TYR TYR A . n A 1 21 GLU 21 351 351 GLU GLU A . n A 1 22 ASN 22 352 352 ASN ASN A . n A 1 23 PHE 23 353 353 PHE PHE A . n A 1 24 ILE 24 354 354 ILE ILE A . n A 1 25 ARG 25 355 355 ARG ARG A . n A 1 26 TRP 26 356 356 TRP TRP A . n A 1 27 GLU 27 357 357 GLU GLU A . n A 1 28 ASP 28 358 358 ASP ASP A . n A 1 29 LYS 29 359 359 LYS LYS A . n A 1 30 GLU 30 360 360 GLU GLU A . n A 1 31 SER 31 361 361 SER SER A . n A 1 32 LYS 32 362 362 LYS LYS A . n A 1 33 ILE 33 363 363 ILE ILE A . n A 1 34 PHE 34 364 364 PHE PHE A . n A 1 35 ARG 35 365 365 ARG ARG A . n A 1 36 ILE 36 366 366 ILE ILE A . n A 1 37 VAL 37 367 367 VAL VAL A . n A 1 38 ASP 38 368 368 ASP ASP A . n A 1 39 PRO 39 369 369 PRO PRO A . n A 1 40 ASN 40 370 370 ASN ASN A . n A 1 41 GLY 41 371 371 GLY GLY A . n A 1 42 LEU 42 372 372 LEU LEU A . n A 1 43 ALA 43 373 373 ALA ALA A . n A 1 44 ARG 44 374 374 ARG ARG A . n A 1 45 LEU 45 375 375 LEU LEU A . n A 1 46 TRP 46 376 376 TRP TRP A . n A 1 47 GLY 47 377 377 GLY GLY A . n A 1 48 ASN 48 378 378 ASN ASN A . n A 1 49 HIS 49 379 379 HIS HIS A . n A 1 50 LYS 50 380 380 LYS LYS A . n A 1 51 ASN 51 381 381 ASN ASN A . n A 1 52 ARG 52 382 382 ARG ARG A . n A 1 53 THR 53 383 383 THR THR A . n A 1 54 ASN 54 384 384 ASN ASN A . n A 1 55 MET 55 385 385 MET MET A . n A 1 56 THR 56 386 386 THR THR A . n A 1 57 TYR 57 387 387 TYR TYR A . n A 1 58 GLU 58 388 388 GLU GLU A . n A 1 59 LYS 59 389 389 LYS LYS A . n A 1 60 MET 60 390 390 MET MET A . n A 1 61 SER 61 391 391 SER SER A . n A 1 62 ARG 62 392 392 ARG ARG A . n A 1 63 ALA 63 393 393 ALA ALA A . n A 1 64 LEU 64 394 394 LEU LEU A . n A 1 65 ARG 65 395 395 ARG ARG A . n A 1 66 HIS 66 396 396 HIS HIS A . n A 1 67 TYR 67 397 397 TYR TYR A . n A 1 68 TYR 68 398 398 TYR TYR A . n A 1 69 LYS 69 399 399 LYS LYS A . n A 1 70 LEU 70 400 400 LEU LEU A . n A 1 71 ASN 71 401 401 ASN ASN A . n A 1 72 ILE 72 402 402 ILE ILE A . n A 1 73 ILE 73 403 403 ILE ILE A . n A 1 74 ARG 74 404 404 ARG ARG A . n A 1 75 LYS 75 405 405 LYS LYS A . n A 1 76 GLU 76 406 406 GLU GLU A . n A 1 77 PRO 77 407 407 PRO PRO A . n A 1 78 GLY 78 408 408 GLY GLY A . n A 1 79 GLN 79 409 409 GLN GLN A . n A 1 80 ARG 80 410 410 ARG ARG A . n A 1 81 LEU 81 411 411 LEU LEU A . n A 1 82 LEU 82 412 412 LEU LEU A . n A 1 83 PHE 83 413 413 PHE PHE A . n A 1 84 ARG 84 414 414 ARG ARG A . n A 1 85 PHE 85 415 415 PHE PHE A . n A 1 86 MET 86 416 416 MET MET A . n A 1 87 LYS 87 417 417 LYS LYS A . n A 1 88 THR 88 418 418 THR THR A . n A 1 89 PRO 89 419 419 PRO PRO A . n A 1 90 ASP 90 420 420 ASP ASP A . n A 1 91 GLU 91 421 421 GLU GLU A . n A 1 92 ILE 92 422 422 ILE ILE A . n A 1 93 MET 93 423 423 MET MET A . n A 1 94 SER 94 424 424 SER SER A . n A 1 95 GLY 95 425 425 GLY GLY A . n A 1 96 ARG 96 426 426 ARG ARG A . n A 1 97 THR 97 427 427 THR THR A . n A 1 98 ASP 98 428 428 ASP ASP A . n A 1 99 ARG 99 429 429 ARG ARG A . n A 1 100 LEU 100 430 430 LEU LEU A . n A 1 101 GLU 101 431 431 GLU GLU A . n A 1 102 HIS 102 432 432 HIS HIS A . n A 1 103 LEU 103 433 433 LEU LEU A . n A 1 104 GLU 104 434 434 GLU GLU A . n A 1 105 SER 105 435 435 SER SER A . n A 1 106 GLN 106 436 436 GLN GLN A . n A 1 107 VAL 107 437 437 VAL VAL A . n A 1 108 LEU 108 438 438 LEU LEU A . n A 1 109 ASP 109 439 439 ASP ASP A . n A 1 110 GLU 110 440 440 GLU GLU A . n A 1 111 GLN 111 441 441 GLN GLN A . n A 1 112 THR 112 442 442 THR THR A . n A 1 113 TYR 113 443 443 TYR TYR A . n A 1 114 GLN 114 444 444 GLN GLN A . n A 1 115 GLU 115 445 445 GLU GLU A . n A 1 116 ASP 116 446 446 ASP ASP A . n A 1 117 GLU 117 447 447 GLU GLU A . n A 1 118 PRO 118 448 448 PRO PRO A . n A 1 119 THR 119 449 449 THR THR A . n A 1 120 ILE 120 450 450 ILE ILE A . n A 1 121 ALA 121 451 451 ALA ALA A . n A 1 122 SER 122 452 452 SER SER A . n A 1 123 PRO 123 453 453 PRO PRO A . n A 1 124 VAL 124 454 454 VAL VAL A . n A 1 125 GLY 125 455 455 GLY GLY A . n A 1 126 TRP 126 456 456 TRP TRP A . n A 1 127 PRO 127 457 457 PRO PRO A . n A 1 128 ARG 128 458 458 ARG ARG A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-05-23 2 'Structure model' 1 1 2012-07-25 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sodium phosphate-1' 50 ? mM ? 1 'sodium chloride-2' 200 ? mM ? 1 protein-3 0.4 ? mM '[U-99% 13C; U-99% 15N]' 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LF8 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2992 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 1448 _pdbx_nmr_constraints.NOE_long_range_total_count 631 _pdbx_nmr_constraints.NOE_medium_range_total_count 388 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 525 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 95 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 95 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H1 A GLY 331 ? ? OE1 A GLU 431 ? ? 1.57 2 2 HB2 A ARG 410 ? ? H A LEU 411 ? ? 1.33 3 3 H A THR 386 ? ? HD2 A LYS 389 ? ? 1.28 4 3 HZ2 A LYS 380 ? ? OE1 A GLU 434 ? ? 1.53 5 4 O A LEU 433 ? ? H A VAL 437 ? ? 1.59 6 5 O A TYR 350 ? ? H A ILE 354 ? ? 1.58 7 7 HG23 A ILE 450 ? ? H A SER 452 ? ? 1.35 8 9 HZ3 A TRP 376 ? ? HE1 A MET 385 ? ? 1.22 9 9 HZ1 A LYS 380 ? ? OE1 A GLU 434 ? ? 1.54 10 10 HE A ARG 382 ? ? HB2 A MET 385 ? ? 1.22 11 10 HH12 A ARG 392 ? ? OD1 A ASP 446 ? ? 1.60 12 11 HB2 A ASN 384 ? ? HB2 A GLN 444 ? ? 1.25 13 11 HD2 A TYR 397 ? ? HD13 A ILE 403 ? ? 1.28 14 11 HZ3 A LYS 380 ? ? OE1 A GLU 434 ? ? 1.58 15 12 O A TYR 387 ? ? H A SER 391 ? ? 1.59 16 13 H A LEU 336 ? ? OD2 A ASP 339 ? ? 1.59 17 14 HD3 A ARG 410 ? ? H A LEU 411 ? ? 1.26 18 14 HB2 A ASN 384 ? ? HB2 A GLN 444 ? ? 1.27 19 15 HD13 A ILE 450 ? ? HB A VAL 454 ? ? 1.33 20 17 HB2 A ASP 358 ? ? HB A ILE 363 ? ? 1.31 21 17 HD2 A TYR 397 ? ? HD12 A ILE 403 ? ? 1.31 22 17 HA A THR 442 ? ? HH21 A ARG 458 ? ? 1.33 23 17 HZ3 A LYS 380 ? ? OE1 A GLU 434 ? ? 1.58 24 18 HD2 A TYR 397 ? ? HD12 A ILE 403 ? ? 1.31 25 18 HZ1 A LYS 380 ? ? OE1 A GLU 434 ? ? 1.57 26 18 H A LEU 336 ? ? OD2 A ASP 339 ? ? 1.58 27 19 HZ1 A LYS 380 ? ? OE1 A GLU 434 ? ? 1.59 28 19 O A LEU 433 ? ? H A VAL 437 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 332 ? ? 69.73 -71.32 2 1 THR A 383 ? ? -85.53 -87.50 3 1 ARG A 410 ? ? -83.41 -87.15 4 1 MET A 423 ? ? -68.65 11.23 5 1 TYR A 443 ? ? -78.49 41.26 6 1 PRO A 448 ? ? -60.49 91.16 7 1 PRO A 453 ? ? -54.05 94.98 8 1 VAL A 454 ? ? -128.68 -74.67 9 2 ARG A 335 ? ? -159.81 42.63 10 2 THR A 383 ? ? -99.18 -82.83 11 2 ARG A 410 ? ? -74.65 -115.87 12 2 LEU A 411 ? ? -86.20 30.66 13 2 THR A 442 ? ? -82.45 -141.21 14 2 TYR A 443 ? ? -71.92 28.99 15 2 PRO A 448 ? ? -66.29 65.91 16 2 SER A 452 ? ? 71.01 161.84 17 2 PRO A 453 ? ? -56.67 93.34 18 3 ARG A 335 ? ? -147.31 50.67 19 3 ARG A 410 ? ? -75.94 -99.61 20 3 GLN A 441 ? ? -92.86 -159.85 21 3 THR A 442 ? ? -60.90 -177.96 22 3 PRO A 448 ? ? -53.97 107.61 23 3 PRO A 453 ? ? -54.42 88.51 24 4 ARG A 335 ? ? -166.31 55.56 25 4 THR A 383 ? ? -105.78 -68.19 26 4 ARG A 410 ? ? -55.44 -100.51 27 4 GLN A 441 ? ? -108.95 -161.08 28 4 THR A 442 ? ? -57.22 179.22 29 4 TYR A 443 ? ? -79.72 41.13 30 4 PRO A 448 ? ? -55.85 101.27 31 4 VAL A 454 ? ? -67.57 94.13 32 5 ARG A 335 ? ? -162.82 53.35 33 5 THR A 383 ? ? -93.13 -90.67 34 5 ASN A 384 ? ? -86.62 45.16 35 5 ARG A 410 ? ? -63.59 -86.09 36 5 GLU A 445 ? ? -47.94 105.35 37 5 PRO A 448 ? ? -60.45 71.02 38 5 THR A 449 ? ? 52.64 178.61 39 5 PRO A 453 ? ? -59.40 74.69 40 6 MET A 334 ? ? -61.45 -83.12 41 6 THR A 383 ? ? -113.50 -82.27 42 6 ARG A 410 ? ? -67.80 -105.28 43 6 LEU A 411 ? ? -89.59 30.69 44 6 MET A 423 ? ? -69.94 2.55 45 6 THR A 442 ? ? -70.17 -94.94 46 6 PRO A 448 ? ? -57.45 84.31 47 6 PRO A 453 ? ? -49.93 105.80 48 6 VAL A 454 ? ? -131.28 -69.96 49 7 HIS A 333 ? ? 64.57 177.19 50 7 LEU A 336 ? ? 68.29 -179.31 51 7 ARG A 410 ? ? -78.44 -103.99 52 7 LEU A 411 ? ? -96.28 30.18 53 7 ARG A 426 ? ? -68.52 1.68 54 7 THR A 442 ? ? -63.23 -164.73 55 7 TYR A 443 ? ? -78.29 44.73 56 7 GLU A 445 ? ? -65.76 97.38 57 7 ASP A 446 ? ? -156.98 -52.81 58 7 THR A 449 ? ? -160.15 -164.84 59 7 ILE A 450 ? ? -21.01 -83.17 60 7 ALA A 451 ? ? 54.58 19.61 61 7 SER A 452 ? ? -169.11 87.43 62 7 PRO A 453 ? ? -31.40 103.18 63 8 LEU A 336 ? ? 75.95 173.36 64 8 THR A 383 ? ? -100.21 -93.32 65 8 ARG A 410 ? ? -79.06 -96.96 66 8 THR A 442 ? ? -49.91 162.25 67 8 TYR A 443 ? ? -75.88 38.13 68 8 SER A 452 ? ? 176.11 179.77 69 8 PRO A 453 ? ? -58.19 82.66 70 8 PRO A 457 ? ? -62.60 95.50 71 9 SER A 332 ? ? -58.01 -73.24 72 9 MET A 334 ? ? -117.66 -169.20 73 9 ARG A 335 ? ? -144.86 35.37 74 9 ASN A 384 ? ? -110.05 61.47 75 9 ARG A 410 ? ? -46.37 -80.36 76 9 TYR A 443 ? ? -70.44 24.98 77 9 GLN A 444 ? ? 61.08 88.78 78 9 ALA A 451 ? ? 55.29 -88.72 79 9 VAL A 454 ? ? -132.69 -66.09 80 10 LEU A 336 ? ? 80.59 175.34 81 10 THR A 383 ? ? -71.13 -87.95 82 10 ARG A 410 ? ? -82.28 -99.77 83 10 LEU A 411 ? ? -94.71 30.64 84 10 THR A 442 ? ? -58.94 -80.65 85 10 TYR A 443 ? ? -97.68 37.59 86 10 PRO A 448 ? ? -52.83 93.43 87 10 SER A 452 ? ? 177.95 153.71 88 10 PRO A 453 ? ? -38.07 112.37 89 10 VAL A 454 ? ? -51.21 106.52 90 11 HIS A 333 ? ? 67.76 134.74 91 11 ARG A 410 ? ? -78.67 -117.29 92 11 LEU A 411 ? ? -81.46 30.64 93 11 GLN A 444 ? ? -62.18 76.59 94 11 PRO A 448 ? ? -58.65 90.95 95 11 ILE A 450 ? ? -136.90 -50.60 96 11 ALA A 451 ? ? 61.21 -75.03 97 11 PRO A 453 ? ? -47.89 94.25 98 12 MET A 334 ? ? 52.77 86.29 99 12 LEU A 336 ? ? 75.49 150.88 100 12 THR A 383 ? ? -95.54 -78.18 101 12 ARG A 410 ? ? -71.50 -80.98 102 12 ARG A 426 ? ? -97.86 32.74 103 12 THR A 442 ? ? -49.76 -80.02 104 12 GLU A 445 ? ? -43.51 101.36 105 12 PRO A 448 ? ? -57.14 89.86 106 12 PRO A 453 ? ? -54.92 93.49 107 13 ARG A 335 ? ? -170.99 32.10 108 13 THR A 383 ? ? -106.61 -83.52 109 13 ASN A 384 ? ? -86.56 41.92 110 13 ARG A 410 ? ? -79.05 -104.17 111 13 ARG A 426 ? ? -102.56 47.90 112 13 PRO A 448 ? ? -56.29 91.70 113 13 PRO A 453 ? ? -65.38 73.30 114 13 VAL A 454 ? ? -136.98 -84.51 115 14 SER A 332 ? ? -121.11 -64.22 116 14 LEU A 336 ? ? 76.13 167.72 117 14 ASN A 384 ? ? -79.59 49.96 118 14 ARG A 410 ? ? -65.24 -90.81 119 14 SER A 424 ? ? -79.94 20.11 120 14 TYR A 443 ? ? 52.91 -161.52 121 14 PRO A 448 ? ? -52.59 92.31 122 14 PRO A 453 ? ? -59.16 77.71 123 14 VAL A 454 ? ? -104.95 -74.07 124 14 PRO A 457 ? ? -56.05 101.99 125 15 ARG A 410 ? ? -72.03 -96.32 126 15 GLN A 441 ? ? -72.71 -168.16 127 15 THR A 442 ? ? -71.87 -165.65 128 15 TYR A 443 ? ? -69.90 30.55 129 15 GLU A 445 ? ? -44.47 100.25 130 15 ALA A 451 ? ? 60.78 -77.12 131 15 PRO A 453 ? ? -47.99 98.46 132 15 TRP A 456 ? ? 35.26 88.70 133 16 ARG A 335 ? ? -162.57 55.38 134 16 ARG A 410 ? ? -77.78 -97.38 135 16 ASP A 446 ? ? -141.27 -16.26 136 16 PRO A 448 ? ? -64.93 78.36 137 16 ILE A 450 ? ? -124.35 -94.46 138 16 ALA A 451 ? ? 53.52 10.36 139 16 SER A 452 ? ? 169.92 172.06 140 16 PRO A 453 ? ? -68.00 58.21 141 17 SER A 332 ? ? 65.05 178.26 142 17 THR A 383 ? ? -106.91 -79.18 143 17 ARG A 410 ? ? -76.94 -108.59 144 17 LEU A 411 ? ? -91.39 30.60 145 17 GLU A 440 ? ? -45.94 -19.22 146 17 GLN A 441 ? ? -63.49 -165.00 147 17 TYR A 443 ? ? 176.02 160.75 148 17 GLN A 444 ? ? -64.69 78.25 149 17 PRO A 448 ? ? -28.58 131.83 150 17 ILE A 450 ? ? -65.17 88.60 151 18 ARG A 335 ? ? -172.58 33.49 152 18 ARG A 410 ? ? -75.74 -94.89 153 18 THR A 449 ? ? 55.11 -136.30 154 18 ILE A 450 ? ? 73.79 115.20 155 18 ALA A 451 ? ? -146.04 19.55 156 18 PRO A 453 ? ? -68.19 40.48 157 19 SER A 332 ? ? -114.68 -83.07 158 19 MET A 334 ? ? 62.18 95.49 159 19 THR A 383 ? ? -93.47 -72.29 160 19 ASN A 384 ? ? -76.42 48.84 161 19 ARG A 410 ? ? -60.42 -96.98 162 19 MET A 423 ? ? -69.68 11.05 163 19 THR A 442 ? ? -70.17 -94.30 164 19 PRO A 448 ? ? -46.54 -178.07 165 19 PRO A 453 ? ? -66.00 67.46 166 19 PRO A 457 ? ? -93.55 34.65 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 19 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 349 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.085 _pdbx_validate_planes.type 'SIDE CHAIN' #