data_2LI3 # _entry.id 2LI3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2LI3 RCSB RCSB102411 BMRB 17876 WWPDB D_1000102411 # _pdbx_database_related.db_id 17876 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LI3 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-08-19 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Saucedo-Yanez, A.' 1 'Del Rio-Portilla, F.' 2 'Hernandez-Lopez, R.' 3 # _citation.id primary _citation.title 'New Tricks of an Old Pattern: STRUCTURAL VERSATILITY OF SCORPION TOXINS WITH COMMON CYSTEINE SPACING.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 287 _citation.page_first 12321 _citation.page_last 12330 _citation.year 2012 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22238341 _citation.pdbx_database_id_DOI 10.1074/jbc.M111.329607 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Saucedo, A.L.' 1 primary 'Flores-Solis, D.' 2 primary 'Rodriguez de la Vega, R.C.' 3 primary 'Ramirez-Cordero, B.' 4 primary 'Hernandez-Lopez, R.' 5 primary 'Cano-Sanchez, P.' 6 primary 'Navarro, R.N.' 7 primary 'Garcia-Valdes, J.' 8 primary 'Coronas-Valderrama, F.' 9 primary 'de Roodt, A.' 10 primary 'Brieba, L.G.' 11 primary 'Possani, L.D.' 12 primary 'Del Rio-Portilla, F.' 13 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Potassium channel toxin kappa-KTX3.1' _entity.formula_weight 3334.920 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSGCMPEYCAGQCRGKVSQDYCLKNCRCIR _entity_poly.pdbx_seq_one_letter_code_can GSGCMPEYCAGQCRGKVSQDYCLKNCRCIR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLY n 1 4 CYS n 1 5 MET n 1 6 PRO n 1 7 GLU n 1 8 TYR n 1 9 CYS n 1 10 ALA n 1 11 GLY n 1 12 GLN n 1 13 CYS n 1 14 ARG n 1 15 GLY n 1 16 LYS n 1 17 VAL n 1 18 SER n 1 19 GLN n 1 20 ASP n 1 21 TYR n 1 22 CYS n 1 23 LEU n 1 24 LYS n 1 25 ASN n 1 26 CYS n 1 27 ARG n 1 28 CYS n 1 29 ILE n 1 30 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Argentinean scorpion' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Tityus trivittatus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 369776 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'Pet32 modified' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2LI3 _struct_ref.pdbx_db_accession 2LI3 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LI3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 30 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2LI3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 30 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 30 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 NOESY 1 2 1 '2D 1H-1H TOCSY' 1 3 1 '2D DQF-C' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 3.5 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '2.3 mM KAPPA-KTX3.1 SCORPION TOXIN, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Varian INOVA 1 'VARIAN INOVA' 500 Varian UNITY 2 'Varian UNITY' # _pdbx_nmr_refine.entry_id 2LI3 _pdbx_nmr_refine.method 'TORSION ANGLE DYNAMICS, MOLECULAR DYNAMICS' _pdbx_nmr_refine.details ;STRUCTURE DETERMINATION WAS PERFORMED USING CYANA 2.1.THE 20 STRUCTURES OF 200 WITH LOWEST TARGET FUNCTION WERE REFINED BY MOLECULAR DYNAMICS WITH EXPLICIT SOLVENT USING AMBER 9.0. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST TARGET FUNCTION' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LI3 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LI3 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'D.A.CASE, ET AL.' refinement CYANA 2.1 1 'Delaglio, Zhengrong and Bax' 'structure solution' NMRPipe ? 2 'Bartels et al.' 'structure solution' XEASY ? 3 'Keller and Wuthrich' 'structure solution' CARA1.5 ? 4 'Guntert, Mumenthaler and Wuthrich' 'structure solution' AMBER 9 5 'Koradi, Billeter and Wuthrich' 'structure solution' MOLMOL ? 6 'Guntert, Mumenthaler and Wuthrich' refinement AMBER ? 7 'D.A.CASE, ET AL.' 'structure solution' CYANA 2.1 8 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LI3 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LI3 _struct.title ;Structural and functional analysis of a novel potassium toxin argentinean scorpion Tityus trivittatus reveals a new kappa sub-family ; _struct.pdbx_descriptor 'Potassium channel toxin kappa-KTX3.1' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LI3 _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'ALPHA/ALPHA MOTIF, ALPHA SCORPION TOXIN, VOLTAGE GATED POTASSIUM CHANNEL ALPHA TOXIN, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 MET A 5 ? CYS A 13 ? MET A 5 CYS A 13 1 ? 9 HELX_P HELX_P2 2 LYS A 16 ? CYS A 26 ? LYS A 16 CYS A 26 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 26 SG ? ? A CYS 4 A CYS 26 1_555 ? ? ? ? ? ? ? 2.037 ? disulf2 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 9 A CYS 22 1_555 ? ? ? ? ? ? ? 2.028 ? disulf3 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 13 A CYS 28 1_555 ? ? ? ? ? ? ? 2.040 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 2LI3 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ARG 30 30 30 ARG ARG A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-01-11 2 'Structure model' 1 1 2012-04-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_nmr_exptl_sample.component 'KAPPA-KTX3.1 SCORPION TOXIN-1' _pdbx_nmr_exptl_sample.concentration 2.3 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling ? _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 14 ? ? CZ A ARG 14 ? ? NH1 A ARG 14 ? ? 123.57 120.30 3.27 0.50 N 2 1 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 124.00 120.30 3.70 0.50 N 3 2 NE A ARG 30 ? ? CZ A ARG 30 ? ? NH1 A ARG 30 ? ? 123.90 120.30 3.60 0.50 N 4 3 NE A ARG 14 ? ? CZ A ARG 14 ? ? NH1 A ARG 14 ? ? 123.78 120.30 3.48 0.50 N 5 3 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 124.25 120.30 3.95 0.50 N 6 4 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 123.69 120.30 3.39 0.50 N 7 4 NE A ARG 30 ? ? CZ A ARG 30 ? ? NH1 A ARG 30 ? ? 124.12 120.30 3.82 0.50 N 8 5 NE A ARG 14 ? ? CZ A ARG 14 ? ? NH1 A ARG 14 ? ? 124.36 120.30 4.06 0.50 N 9 5 NE A ARG 30 ? ? CZ A ARG 30 ? ? NH1 A ARG 30 ? ? 124.10 120.30 3.80 0.50 N 10 6 NE A ARG 14 ? ? CZ A ARG 14 ? ? NH1 A ARG 14 ? ? 123.67 120.30 3.37 0.50 N 11 6 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 123.98 120.30 3.68 0.50 N 12 7 NE A ARG 14 ? ? CZ A ARG 14 ? ? NH1 A ARG 14 ? ? 123.68 120.30 3.38 0.50 N 13 7 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 123.50 120.30 3.20 0.50 N 14 8 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 124.73 120.30 4.43 0.50 N 15 9 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 123.65 120.30 3.35 0.50 N 16 10 NE A ARG 14 ? ? CZ A ARG 14 ? ? NH1 A ARG 14 ? ? 124.90 120.30 4.60 0.50 N 17 10 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 124.22 120.30 3.92 0.50 N 18 10 NE A ARG 30 ? ? CZ A ARG 30 ? ? NH1 A ARG 30 ? ? 123.94 120.30 3.64 0.50 N 19 10 NE A ARG 30 ? ? CZ A ARG 30 ? ? NH2 A ARG 30 ? ? 117.24 120.30 -3.06 0.50 N 20 11 NE A ARG 30 ? ? CZ A ARG 30 ? ? NH1 A ARG 30 ? ? 124.83 120.30 4.53 0.50 N 21 12 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 123.36 120.30 3.06 0.50 N 22 12 NE A ARG 30 ? ? CZ A ARG 30 ? ? NH1 A ARG 30 ? ? 124.13 120.30 3.83 0.50 N 23 13 CB A TYR 21 ? ? CG A TYR 21 ? ? CD1 A TYR 21 ? ? 117.17 121.00 -3.83 0.60 N 24 13 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 125.50 120.30 5.20 0.50 N 25 13 NE A ARG 30 ? ? CZ A ARG 30 ? ? NH1 A ARG 30 ? ? 124.03 120.30 3.73 0.50 N 26 15 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 123.93 120.30 3.63 0.50 N 27 16 NE A ARG 14 ? ? CZ A ARG 14 ? ? NH1 A ARG 14 ? ? 123.39 120.30 3.09 0.50 N 28 16 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 123.68 120.30 3.38 0.50 N 29 17 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 124.05 120.30 3.75 0.50 N 30 17 NE A ARG 30 ? ? CZ A ARG 30 ? ? NH1 A ARG 30 ? ? 124.36 120.30 4.06 0.50 N 31 18 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 124.79 120.30 4.49 0.50 N 32 18 NE A ARG 30 ? ? CZ A ARG 30 ? ? NH1 A ARG 30 ? ? 123.56 120.30 3.26 0.50 N 33 19 NE A ARG 30 ? ? CZ A ARG 30 ? ? NH1 A ARG 30 ? ? 123.61 120.30 3.31 0.50 N 34 20 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 124.86 120.30 4.56 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 12 ? ? -132.66 -30.54 2 1 LYS A 16 ? ? -137.71 -32.32 3 2 LYS A 16 ? ? -140.70 -53.40 4 3 LYS A 16 ? ? -137.99 -44.77 5 3 ILE A 29 ? ? -65.34 96.24 6 4 ASN A 25 ? ? -145.17 -15.27 7 5 CYS A 4 ? ? -74.95 48.45 8 5 GLN A 12 ? ? -143.34 -39.15 9 5 LYS A 16 ? ? -132.76 -45.47 10 5 CYS A 26 ? ? 56.66 -11.75 11 6 CYS A 4 ? ? 53.49 79.37 12 6 LYS A 16 ? ? -144.05 -43.01 13 6 CYS A 26 ? ? 58.58 -22.62 14 7 LYS A 16 ? ? -136.88 -51.72 15 8 SER A 2 ? ? -149.77 -12.42 16 8 CYS A 26 ? ? 50.83 19.18 17 10 CYS A 4 ? ? -68.56 30.49 18 12 CYS A 26 ? ? 58.28 -22.24 19 12 ILE A 29 ? ? 49.52 -23.94 20 13 CYS A 4 ? ? 53.53 18.21 21 13 LYS A 16 ? ? -136.18 -37.66 22 14 CYS A 4 ? ? -151.76 44.60 23 14 LYS A 16 ? ? -134.46 -53.10 24 15 ILE A 29 ? ? -58.34 97.05 25 16 LYS A 16 ? ? -132.36 -51.55 26 16 CYS A 26 ? ? 56.66 -13.38 27 18 CYS A 26 ? ? 57.13 13.77 28 19 LYS A 16 ? ? -139.42 -43.84 29 20 ILE A 29 ? ? -66.77 93.98 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 5 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 27 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.086 _pdbx_validate_planes.type 'SIDE CHAIN' #