data_2LKB # _entry.id 2LKB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LKB pdb_00002lkb 10.2210/pdb2lkb/pdb RCSB RCSB102486 ? ? BMRB 17988 ? 10.13018/BMR17988 WWPDB D_1000102486 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-11-02 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' 6 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' database_2 7 3 'Structure model' pdbx_entry_details 8 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LKB _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2011-10-09 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 17988 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhu, S.' 1 'Peigneur, S.' 2 'Gao, B.' 3 'Lu, X.' 4 'Cao, C.' 5 'Tytgat, J.' 6 # _citation.id primary _citation.title 'Evolutionary diversification of Mesobuthus {alpha}-scorpion toxins affecting sodium channels' _citation.journal_abbrev 'Mol.Cell Proteomics' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year 2011 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1535-9484 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21969612 _citation.pdbx_database_id_DOI 10.1074/mcp.M111.012054 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhu, S.' 1 ? primary 'Peigneur, S.' 2 ? primary 'Gao, B.' 3 ? primary 'Lu, X.' 4 ? primary 'Cao, C.' 5 ? primary 'Tytgat, J.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'Neurotoxin MeuNaTx-5' _entity.formula_weight 7187.229 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ARDAYIAKPHNCVYECFDAFSSYCNGVCTKNGAKSGYCQILGTYGNGCWCIALPDNVPIRIPGKCH _entity_poly.pdbx_seq_one_letter_code_can ARDAYIAKPHNCVYECFDAFSSYCNGVCTKNGAKSGYCQILGTYGNGCWCIALPDNVPIRIPGKCH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ARG n 1 3 ASP n 1 4 ALA n 1 5 TYR n 1 6 ILE n 1 7 ALA n 1 8 LYS n 1 9 PRO n 1 10 HIS n 1 11 ASN n 1 12 CYS n 1 13 VAL n 1 14 TYR n 1 15 GLU n 1 16 CYS n 1 17 PHE n 1 18 ASP n 1 19 ALA n 1 20 PHE n 1 21 SER n 1 22 SER n 1 23 TYR n 1 24 CYS n 1 25 ASN n 1 26 GLY n 1 27 VAL n 1 28 CYS n 1 29 THR n 1 30 LYS n 1 31 ASN n 1 32 GLY n 1 33 ALA n 1 34 LYS n 1 35 SER n 1 36 GLY n 1 37 TYR n 1 38 CYS n 1 39 GLN n 1 40 ILE n 1 41 LEU n 1 42 GLY n 1 43 THR n 1 44 TYR n 1 45 GLY n 1 46 ASN n 1 47 GLY n 1 48 CYS n 1 49 TRP n 1 50 CYS n 1 51 ILE n 1 52 ALA n 1 53 LEU n 1 54 PRO n 1 55 ASP n 1 56 ASN n 1 57 VAL n 1 58 PRO n 1 59 ILE n 1 60 ARG n 1 61 ILE n 1 62 PRO n 1 63 GLY n 1 64 LYS n 1 65 CYS n 1 66 HIS n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'Lesser Asian scorpion' _entity_src_nat.pdbx_organism_scientific 'Mesobuthus eupeus' _entity_src_nat.pdbx_ncbi_taxonomy_id 34648 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 TRP 49 49 49 TRP TRP A . n A 1 50 CYS 50 50 50 CYS CYS A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 HIS 66 66 66 HIS HIS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LKB _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LKB _struct.title 'Evolutionary diversification of Mesobuthus alpha-scorpion toxins affecting sodium channels' _struct.pdbx_model_details 'minimized average structure, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 2LKB _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'Mesobuthus alpha-Scorpion, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SCXN5_BUTEU _struct_ref.pdbx_db_accession P86405 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ARDAYIAKPHNCVYECFDAFSSYCNGVCTKNGAKSGYCQILGTYGNGCWCIALPDNVPIRIPGKCH _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LKB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 66 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P86405 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 66 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 66 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 18 ? SER A 21 ? ASP A 18 SER A 21 5 ? 4 HELX_P HELX_P2 2 SER A 22 ? LYS A 30 ? SER A 22 LYS A 30 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 65 SG ? ? A CYS 12 A CYS 65 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf2 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 16 A CYS 38 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf3 disulf ? ? A CYS 24 SG ? ? ? 1_555 A CYS 48 SG ? ? A CYS 24 A CYS 48 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf4 disulf ? ? A CYS 28 SG ? ? ? 1_555 A CYS 50 SG ? ? A CYS 28 A CYS 50 1_555 ? ? ? ? ? ? ? 2.021 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 12 ? CYS A 65 ? CYS A 12 ? 1_555 CYS A 65 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 16 ? CYS A 38 ? CYS A 16 ? 1_555 CYS A 38 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 24 ? CYS A 48 ? CYS A 24 ? 1_555 CYS A 48 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 28 ? CYS A 50 ? CYS A 28 ? 1_555 CYS A 50 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 35 ? ILE A 40 ? SER A 35 ILE A 40 A 2 ASN A 46 ? ILE A 51 ? ASN A 46 ILE A 51 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 37 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 37 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TRP _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 49 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TRP _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 49 # _pdbx_entry_details.entry_id 2LKB _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HH21 A ARG 2 ? ? HE1 A TRP 49 ? ? 1.24 2 5 HH A TYR 14 ? ? HH A TYR 23 ? ? 1.26 3 5 HE A ARG 2 ? ? HE1 A TRP 49 ? ? 1.32 4 12 H1 A ALA 1 ? ? H A VAL 57 ? ? 1.25 5 14 HE A ARG 2 ? ? HE1 A TRP 49 ? ? 1.24 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 4 ? ? -99.79 -65.00 2 1 PRO A 9 ? ? -34.02 -110.85 3 1 GLU A 15 ? ? -175.24 93.13 4 1 PHE A 17 ? ? -109.67 -152.55 5 1 ALA A 33 ? ? -174.02 -26.69 6 1 GLN A 39 ? ? -119.87 -139.88 7 1 THR A 43 ? ? -103.65 -70.63 8 1 ALA A 52 ? ? 162.17 168.73 9 1 PRO A 54 ? ? -49.73 -174.05 10 1 ASN A 56 ? ? 159.97 -174.80 11 1 PRO A 62 ? ? -57.40 -0.43 12 2 ALA A 4 ? ? -106.32 -83.94 13 2 HIS A 10 ? ? -151.65 -6.80 14 2 GLU A 15 ? ? 177.14 80.83 15 2 CYS A 16 ? ? -44.75 156.95 16 2 PHE A 17 ? ? -132.56 -149.13 17 2 THR A 43 ? ? -94.82 -72.88 18 2 ALA A 52 ? ? -174.29 -32.26 19 2 PRO A 54 ? ? -42.03 -78.78 20 2 ASP A 55 ? ? -177.03 39.70 21 2 VAL A 57 ? ? 47.49 70.12 22 3 ALA A 4 ? ? -105.10 -83.27 23 3 HIS A 10 ? ? -145.15 -15.31 24 3 GLU A 15 ? ? -174.29 95.38 25 3 PHE A 17 ? ? -76.30 -157.07 26 3 SER A 22 ? ? 150.51 33.24 27 3 TYR A 23 ? ? -58.43 -71.39 28 3 ALA A 33 ? ? 179.40 -26.04 29 3 THR A 43 ? ? 177.55 -40.56 30 3 ALA A 52 ? ? 179.16 -42.45 31 3 PRO A 54 ? ? -84.87 33.02 32 4 ALA A 4 ? ? -108.56 -85.46 33 4 ASN A 11 ? ? -140.62 -150.70 34 4 GLU A 15 ? ? -172.15 93.74 35 4 SER A 22 ? ? 153.12 2.55 36 4 TYR A 44 ? ? -47.70 -8.58 37 4 ALA A 52 ? ? -178.52 -43.93 38 4 VAL A 57 ? ? -37.38 100.24 39 5 ALA A 4 ? ? -99.50 -69.78 40 5 GLU A 15 ? ? -175.51 99.51 41 5 PHE A 17 ? ? -45.62 150.79 42 5 SER A 21 ? ? 170.06 78.14 43 5 SER A 22 ? ? -154.45 -66.66 44 5 GLN A 39 ? ? -120.01 -167.16 45 5 THR A 43 ? ? -154.55 -81.95 46 5 ALA A 52 ? ? -158.33 -59.21 47 5 PRO A 54 ? ? -50.13 -179.82 48 5 PRO A 62 ? ? -76.51 29.06 49 6 GLU A 15 ? ? -175.56 96.66 50 6 PHE A 17 ? ? -108.75 -149.47 51 6 ALA A 33 ? ? -171.09 -28.48 52 6 THR A 43 ? ? -97.99 -67.88 53 6 ALA A 52 ? ? 169.07 147.35 54 6 PRO A 54 ? ? -84.37 -93.61 55 7 ALA A 4 ? ? -105.77 -85.46 56 7 PRO A 9 ? ? -48.63 -76.33 57 7 GLU A 15 ? ? -174.30 98.44 58 7 SER A 22 ? ? 155.47 10.64 59 7 LYS A 34 ? ? -58.46 -71.30 60 7 THR A 43 ? ? -92.09 -74.07 61 7 ALA A 52 ? ? -175.39 -56.22 62 7 VAL A 57 ? ? 32.93 67.63 63 7 ILE A 59 ? ? 39.93 58.24 64 8 ALA A 4 ? ? -113.45 -94.25 65 8 GLU A 15 ? ? -174.76 99.39 66 8 ASP A 18 ? ? -44.22 107.76 67 8 SER A 22 ? ? 152.20 26.48 68 8 THR A 43 ? ? -101.67 -70.44 69 8 ALA A 52 ? ? -169.66 -76.55 70 8 VAL A 57 ? ? -38.15 100.42 71 8 PRO A 62 ? ? -59.79 1.22 72 9 ALA A 4 ? ? -110.50 -93.48 73 9 GLU A 15 ? ? -175.90 100.22 74 9 CYS A 16 ? ? -68.38 93.37 75 9 ASP A 18 ? ? -153.49 89.45 76 9 SER A 22 ? ? 153.57 3.83 77 9 TYR A 23 ? ? -57.08 -79.89 78 9 LYS A 34 ? ? -56.24 -71.63 79 9 GLN A 39 ? ? -140.30 -138.53 80 9 THR A 43 ? ? -100.52 -99.04 81 9 ALA A 52 ? ? -171.18 -55.24 82 10 ALA A 4 ? ? -100.28 -81.67 83 10 PRO A 9 ? ? -34.16 -109.62 84 10 GLU A 15 ? ? -167.61 95.00 85 10 ALA A 33 ? ? 161.45 -12.37 86 10 THR A 43 ? ? -94.14 -120.88 87 10 ALA A 52 ? ? -168.91 -40.57 88 10 PRO A 54 ? ? -42.55 -72.39 89 10 ASP A 55 ? ? -175.37 47.83 90 10 PRO A 62 ? ? -46.64 -5.90 91 10 CYS A 65 ? ? 51.64 -84.98 92 11 ALA A 4 ? ? -99.60 -78.31 93 11 GLU A 15 ? ? 55.90 97.59 94 11 SER A 21 ? ? 168.98 86.78 95 11 SER A 22 ? ? -170.24 -64.52 96 11 ALA A 52 ? ? -177.11 -66.70 97 11 VAL A 57 ? ? -33.85 97.84 98 11 CYS A 65 ? ? 57.12 -77.62 99 12 ALA A 4 ? ? -109.86 -92.52 100 12 HIS A 10 ? ? -147.64 -5.99 101 12 GLU A 15 ? ? -175.29 99.30 102 12 PHE A 17 ? ? -122.12 -161.14 103 12 LYS A 34 ? ? -57.91 -76.04 104 12 THR A 43 ? ? -157.44 -81.67 105 12 ALA A 52 ? ? -179.07 -146.01 106 12 LEU A 53 ? ? 176.43 -44.71 107 12 CYS A 65 ? ? 58.46 -74.98 108 13 ALA A 4 ? ? -103.08 -81.42 109 13 HIS A 10 ? ? -149.65 12.08 110 13 GLU A 15 ? ? -174.56 99.31 111 13 SER A 21 ? ? 168.97 78.62 112 13 SER A 22 ? ? -156.01 -66.94 113 13 ASP A 55 ? ? -154.99 -71.02 114 13 ASN A 56 ? ? -173.39 29.95 115 13 PRO A 62 ? ? -72.83 23.91 116 14 ALA A 4 ? ? -99.83 -79.74 117 14 GLU A 15 ? ? -151.19 89.38 118 14 CYS A 16 ? ? -59.21 109.49 119 14 ASP A 18 ? ? -43.54 106.39 120 14 SER A 22 ? ? 151.49 12.30 121 14 TYR A 23 ? ? -57.35 -71.62 122 14 ALA A 33 ? ? -172.10 -26.70 123 14 TYR A 44 ? ? -46.48 -12.59 124 14 ALA A 52 ? ? -159.59 -28.91 125 14 PRO A 54 ? ? -49.72 -0.63 126 14 ASP A 55 ? ? 89.90 49.80 127 14 PRO A 62 ? ? -58.28 5.99 128 15 ALA A 4 ? ? -99.34 -65.64 129 15 GLU A 15 ? ? -174.68 99.66 130 15 PHE A 20 ? ? 49.25 7.53 131 15 SER A 21 ? ? 173.30 -54.07 132 15 SER A 22 ? ? 160.98 45.60 133 15 ALA A 33 ? ? 174.52 -21.28 134 15 TYR A 44 ? ? -44.65 -16.19 135 15 ALA A 52 ? ? 90.89 65.47 136 15 ARG A 60 ? ? -153.95 -33.17 137 15 PRO A 62 ? ? -53.82 -6.86 138 16 ALA A 4 ? ? -99.35 -76.67 139 16 GLU A 15 ? ? -175.95 97.86 140 16 PHE A 17 ? ? -120.67 -153.75 141 16 ALA A 33 ? ? 176.77 -25.96 142 16 THR A 43 ? ? -96.07 -125.16 143 16 ALA A 52 ? ? 176.19 -22.61 144 16 PRO A 54 ? ? -38.08 158.25 145 16 ASN A 56 ? ? -147.86 -47.45 146 16 PRO A 58 ? ? -79.76 -100.25 147 16 CYS A 65 ? ? 56.43 -0.61 148 17 ALA A 4 ? ? -109.93 -83.25 149 17 GLU A 15 ? ? -177.38 91.78 150 17 CYS A 16 ? ? -54.12 97.74 151 17 SER A 22 ? ? 72.48 39.25 152 17 ALA A 52 ? ? -173.09 -130.13 153 17 CYS A 65 ? ? 54.80 -81.21 154 18 ALA A 4 ? ? -108.25 -83.55 155 18 GLU A 15 ? ? -175.32 98.34 156 18 PHE A 17 ? ? -119.30 -154.30 157 18 ALA A 33 ? ? -174.92 -26.84 158 18 GLN A 39 ? ? -111.11 -162.05 159 18 THR A 43 ? ? -97.57 -124.12 160 18 ALA A 52 ? ? -170.96 -52.05 161 18 PRO A 54 ? ? -54.03 171.03 162 18 ASP A 55 ? ? 59.88 146.50 163 18 ARG A 60 ? ? 55.24 1.53 164 19 ALA A 4 ? ? -106.81 -82.88 165 19 GLU A 15 ? ? -172.15 98.88 166 19 SER A 21 ? ? 172.93 73.54 167 19 SER A 22 ? ? -152.94 -50.47 168 19 LYS A 34 ? ? -78.62 -77.41 169 19 GLN A 39 ? ? -141.07 -136.54 170 19 THR A 43 ? ? -105.66 -63.44 171 19 ALA A 52 ? ? -170.56 -104.34 172 19 VAL A 57 ? ? -39.72 102.38 173 19 ILE A 59 ? ? 39.75 60.56 174 20 ALA A 4 ? ? -106.07 -84.45 175 20 HIS A 10 ? ? -141.80 -3.97 176 20 TYR A 14 ? ? -91.29 -61.26 177 20 GLU A 15 ? ? -173.89 98.72 178 20 CYS A 16 ? ? -50.62 103.24 179 20 ALA A 52 ? ? -179.57 -145.82 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LKB _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LKB _pdbx_nmr_representative.selection_criteria 'minimized average structure' # _pdbx_nmr_sample_details.contents '50 mM sodium phosphate-1, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample.component 'sodium phosphate-1' _pdbx_nmr_exptl_sample.concentration 50 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling ? _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.05 _pdbx_nmr_exptl_sample_conditions.pH 4.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H TOCSY' 1 2 1 '2D 1H-1H NOESY' 1 3 1 '2D DQF-COSY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LKB _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 710 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 216 _pdbx_nmr_constraints.NOE_long_range_total_count 117 _pdbx_nmr_constraints.NOE_medium_range_total_count 122 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 255 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2LKB _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_software.authors Brunger _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name 'X-PLOR NIH' _pdbx_nmr_software.ordinal 1 _pdbx_nmr_software.version ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 SER N N N N 267 SER CA C N S 268 SER C C N N 269 SER O O N N 270 SER CB C N N 271 SER OG O N N 272 SER OXT O N N 273 SER H H N N 274 SER H2 H N N 275 SER HA H N N 276 SER HB2 H N N 277 SER HB3 H N N 278 SER HG H N N 279 SER HXT H N N 280 THR N N N N 281 THR CA C N S 282 THR C C N N 283 THR O O N N 284 THR CB C N R 285 THR OG1 O N N 286 THR CG2 C N N 287 THR OXT O N N 288 THR H H N N 289 THR H2 H N N 290 THR HA H N N 291 THR HB H N N 292 THR HG1 H N N 293 THR HG21 H N N 294 THR HG22 H N N 295 THR HG23 H N N 296 THR HXT H N N 297 TRP N N N N 298 TRP CA C N S 299 TRP C C N N 300 TRP O O N N 301 TRP CB C N N 302 TRP CG C Y N 303 TRP CD1 C Y N 304 TRP CD2 C Y N 305 TRP NE1 N Y N 306 TRP CE2 C Y N 307 TRP CE3 C Y N 308 TRP CZ2 C Y N 309 TRP CZ3 C Y N 310 TRP CH2 C Y N 311 TRP OXT O N N 312 TRP H H N N 313 TRP H2 H N N 314 TRP HA H N N 315 TRP HB2 H N N 316 TRP HB3 H N N 317 TRP HD1 H N N 318 TRP HE1 H N N 319 TRP HE3 H N N 320 TRP HZ2 H N N 321 TRP HZ3 H N N 322 TRP HH2 H N N 323 TRP HXT H N N 324 TYR N N N N 325 TYR CA C N S 326 TYR C C N N 327 TYR O O N N 328 TYR CB C N N 329 TYR CG C Y N 330 TYR CD1 C Y N 331 TYR CD2 C Y N 332 TYR CE1 C Y N 333 TYR CE2 C Y N 334 TYR CZ C Y N 335 TYR OH O N N 336 TYR OXT O N N 337 TYR H H N N 338 TYR H2 H N N 339 TYR HA H N N 340 TYR HB2 H N N 341 TYR HB3 H N N 342 TYR HD1 H N N 343 TYR HD2 H N N 344 TYR HE1 H N N 345 TYR HE2 H N N 346 TYR HH H N N 347 TYR HXT H N N 348 VAL N N N N 349 VAL CA C N S 350 VAL C C N N 351 VAL O O N N 352 VAL CB C N N 353 VAL CG1 C N N 354 VAL CG2 C N N 355 VAL OXT O N N 356 VAL H H N N 357 VAL H2 H N N 358 VAL HA H N N 359 VAL HB H N N 360 VAL HG11 H N N 361 VAL HG12 H N N 362 VAL HG13 H N N 363 VAL HG21 H N N 364 VAL HG22 H N N 365 VAL HG23 H N N 366 VAL HXT H N N 367 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TRP N CA sing N N 285 TRP N H sing N N 286 TRP N H2 sing N N 287 TRP CA C sing N N 288 TRP CA CB sing N N 289 TRP CA HA sing N N 290 TRP C O doub N N 291 TRP C OXT sing N N 292 TRP CB CG sing N N 293 TRP CB HB2 sing N N 294 TRP CB HB3 sing N N 295 TRP CG CD1 doub Y N 296 TRP CG CD2 sing Y N 297 TRP CD1 NE1 sing Y N 298 TRP CD1 HD1 sing N N 299 TRP CD2 CE2 doub Y N 300 TRP CD2 CE3 sing Y N 301 TRP NE1 CE2 sing Y N 302 TRP NE1 HE1 sing N N 303 TRP CE2 CZ2 sing Y N 304 TRP CE3 CZ3 doub Y N 305 TRP CE3 HE3 sing N N 306 TRP CZ2 CH2 doub Y N 307 TRP CZ2 HZ2 sing N N 308 TRP CZ3 CH2 sing Y N 309 TRP CZ3 HZ3 sing N N 310 TRP CH2 HH2 sing N N 311 TRP OXT HXT sing N N 312 TYR N CA sing N N 313 TYR N H sing N N 314 TYR N H2 sing N N 315 TYR CA C sing N N 316 TYR CA CB sing N N 317 TYR CA HA sing N N 318 TYR C O doub N N 319 TYR C OXT sing N N 320 TYR CB CG sing N N 321 TYR CB HB2 sing N N 322 TYR CB HB3 sing N N 323 TYR CG CD1 doub Y N 324 TYR CG CD2 sing Y N 325 TYR CD1 CE1 sing Y N 326 TYR CD1 HD1 sing N N 327 TYR CD2 CE2 doub Y N 328 TYR CD2 HD2 sing N N 329 TYR CE1 CZ doub Y N 330 TYR CE1 HE1 sing N N 331 TYR CE2 CZ sing Y N 332 TYR CE2 HE2 sing N N 333 TYR CZ OH sing N N 334 TYR OH HH sing N N 335 TYR OXT HXT sing N N 336 VAL N CA sing N N 337 VAL N H sing N N 338 VAL N H2 sing N N 339 VAL CA C sing N N 340 VAL CA CB sing N N 341 VAL CA HA sing N N 342 VAL C O doub N N 343 VAL C OXT sing N N 344 VAL CB CG1 sing N N 345 VAL CB CG2 sing N N 346 VAL CB HB sing N N 347 VAL CG1 HG11 sing N N 348 VAL CG1 HG12 sing N N 349 VAL CG1 HG13 sing N N 350 VAL CG2 HG21 sing N N 351 VAL CG2 HG22 sing N N 352 VAL CG2 HG23 sing N N 353 VAL OXT HXT sing N N 354 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _atom_sites.entry_id 2LKB _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_