data_2LKY # _entry.id 2LKY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LKY pdb_00002lky 10.2210/pdb2lky/pdb RCSB RCSB102508 ? ? BMRB 18016 ? ? WWPDB D_1000102508 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 18016 BMRB unspecified . MysmA.17112.b TargetDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LKY _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-10-22 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Buchko, G.W.' 1 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' 2 # _citation.id primary _citation.title 'Structural diversity in the Mycobacteria DUF3349 superfamily.' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 29 _citation.page_first 670 _citation.page_last 685 _citation.year 2020 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 1469-896X _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 31658388 _citation.pdbx_database_id_DOI 10.1002/pro.3758 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Buchko, G.W.' 1 0000-0002-3639-1061 primary 'Abendroth, J.' 2 ? primary 'Robinson, J.I.' 3 ? primary 'Phan, I.Q.' 4 ? primary 'Myler, P.J.' 5 ? primary 'Edwards, T.E.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein' _entity.formula_weight 12433.957 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPGSMVNAFLAKIAAWLNAGYPEGVPGPDRVPLLALLTRRLTNDEIKAIAEDLEKRAHFDHIDIGVLITQMTDEMPREED IERVRRHLALQGWPLDDPRDGEEPDGESGGPR ; _entity_poly.pdbx_seq_one_letter_code_can ;GPGSMVNAFLAKIAAWLNAGYPEGVPGPDRVPLLALLTRRLTNDEIKAIAEDLEKRAHFDHIDIGVLITQMTDEMPREED IERVRRHLALQGWPLDDPRDGEEPDGESGGPR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier MysmA.17112.b # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 SER n 1 5 MET n 1 6 VAL n 1 7 ASN n 1 8 ALA n 1 9 PHE n 1 10 LEU n 1 11 ALA n 1 12 LYS n 1 13 ILE n 1 14 ALA n 1 15 ALA n 1 16 TRP n 1 17 LEU n 1 18 ASN n 1 19 ALA n 1 20 GLY n 1 21 TYR n 1 22 PRO n 1 23 GLU n 1 24 GLY n 1 25 VAL n 1 26 PRO n 1 27 GLY n 1 28 PRO n 1 29 ASP n 1 30 ARG n 1 31 VAL n 1 32 PRO n 1 33 LEU n 1 34 LEU n 1 35 ALA n 1 36 LEU n 1 37 LEU n 1 38 THR n 1 39 ARG n 1 40 ARG n 1 41 LEU n 1 42 THR n 1 43 ASN n 1 44 ASP n 1 45 GLU n 1 46 ILE n 1 47 LYS n 1 48 ALA n 1 49 ILE n 1 50 ALA n 1 51 GLU n 1 52 ASP n 1 53 LEU n 1 54 GLU n 1 55 LYS n 1 56 ARG n 1 57 ALA n 1 58 HIS n 1 59 PHE n 1 60 ASP n 1 61 HIS n 1 62 ILE n 1 63 ASP n 1 64 ILE n 1 65 GLY n 1 66 VAL n 1 67 LEU n 1 68 ILE n 1 69 THR n 1 70 GLN n 1 71 MET n 1 72 THR n 1 73 ASP n 1 74 GLU n 1 75 MET n 1 76 PRO n 1 77 ARG n 1 78 GLU n 1 79 GLU n 1 80 ASP n 1 81 ILE n 1 82 GLU n 1 83 ARG n 1 84 VAL n 1 85 ARG n 1 86 ARG n 1 87 HIS n 1 88 LEU n 1 89 ALA n 1 90 LEU n 1 91 GLN n 1 92 GLY n 1 93 TRP n 1 94 PRO n 1 95 LEU n 1 96 ASP n 1 97 ASP n 1 98 PRO n 1 99 ARG n 1 100 ASP n 1 101 GLY n 1 102 GLU n 1 103 GLU n 1 104 PRO n 1 105 ASP n 1 106 GLY n 1 107 GLU n 1 108 SER n 1 109 GLY n 1 110 GLY n 1 111 PRO n 1 112 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MSMEG_1063 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 700084' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium smegmatis str. MC2 155' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 246196 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector AVA0421 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0QRC1_MYCS2 _struct_ref.pdbx_db_accession A0QRC1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NAFLAKIAAWLNAGYPEGVPGPDRVPLLALLTRRLTNDEIKAIAEDLEKRAHFDHIDIGVLITQMTDEMPREEDIERVRR HLALQGWPLDDPRDGEEPDGESGGPR ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LKY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 7 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 112 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0QRC1 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 107 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 7 _struct_ref_seq.pdbx_auth_seq_align_end 112 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LKY GLY A 1 ? UNP A0QRC1 ? ? 'expression tag' 1 1 1 2LKY PRO A 2 ? UNP A0QRC1 ? ? 'expression tag' 2 2 1 2LKY GLY A 3 ? UNP A0QRC1 ? ? 'expression tag' 3 3 1 2LKY SER A 4 ? UNP A0QRC1 ? ? 'expression tag' 4 4 1 2LKY MET A 5 ? UNP A0QRC1 ? ? 'SEE REMARK 999' 5 5 1 2LKY VAL A 6 ? UNP A0QRC1 ? ? 'SEE REMARK 999' 6 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D 1H-13C NOESY aliphatic' 1 4 1 '3D 1H-13C NOESY aromatic' 1 5 1 '3D 1H-15N NOESY' 1 6 1 '3D HNCACB' 1 7 1 '3D HN(COCA)CB' 1 8 1 '3D HNCO' 1 9 1 '3D C(CO)NH' 1 10 1 '2D HBCBCGCDCDHD' 1 11 1 '2D HBCBCGCDCEHE' 2 12 2 'DEUTERIUM EXCHANGE' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.12 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.0 mM [U-99% 13C; U-99% 15N] protein, 100 mM sodium chloride, 1 mM DTT, 20 mM TRIS, 93% H2O/7% D2O' 1 '93% H2O/7% D2O' '1.0 mM [U-99% 13C; U-99% 15N] protein, 100 mM sodium chloride, 1 mM DTT, 20 mM TRIS, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Varian INOVA 1 'Varian INOVA' 600 Varian INOVA 2 'Varian INOVA' 500 Varian INOVA 3 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2LKY _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ;STRUCTURE DETERMINATION WAS PERFORMED ITERATIVELY USING CYANA (AUTOMATED NOESY ASSIGNMENTS). A TOTAL OF 20 STRUCTURES OUT OF 100 WITH LOWEST TARGET FUNCTION FROM THE FINAL CYANA CALCULATION WERE TAKEN AND REFINED BY RESTRAINED MOLECULAR DYNAMICS/ENERGY MINIMIZATION IN EXPLICIT WATER (CNSSOLVE) AFTER ADDING 1% TO THE UPPER BOUNDARY LIMIT OF THE UPPER DISTANCE RESTRAINTS AND THE VDW LIMIT TO THE LOWER RESTRAINT. PARAM19 WAS USED FOR THE WATER REFINEMENT CALCULATIONS. STRUCTURES WITH 3 OR MORE CLOSE CONTACTS FOLLOWING WATER REFINEMENT, AS DETERMINED BY PSVS, WERE REMOVED FROM THE ENSEMBLE. IN THE END, 17 OUT OF THE 20 CYANA STRUCTURES REFINED EXPLICITLY WITH WATER WERE INCLUDED IN THE FINAL DEPOSITION. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 17 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LKY _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LKY _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 1 'Accelrys Software Inc.' processing Felix 2007 2 Goddard 'data analysis' Sparky 3.115 3 Goddard 'peak picking' Sparky 3.115 4 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNSSOLVE 2.6 5 'Bhattacharya and Montelione' 'data analysis' PSVS 1.3 6 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 7 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LKY _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LKY _struct.title ;Solution structure of MSMEG_1053, the second DUF3349 annotated protein in the genome of Mycobacterium smegmatis, Seattle Structural Genomics Center for Infectious Disease target MysmA.17112.b ; _struct.pdbx_model_details 'closest to the average, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LKY _struct_keywords.pdbx_keywords 'Structural Genomics, Unknown Function' _struct_keywords.text ;infectious disease, tuberculosis, DUF proteins, SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, Unknown Function ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 7 ? TYR A 21 ? ASN A 7 TYR A 21 1 ? 15 HELX_P HELX_P2 2 PRO A 26 ? THR A 38 ? PRO A 26 THR A 38 1 ? 13 HELX_P HELX_P3 3 THR A 42 ? ALA A 57 ? THR A 42 ALA A 57 1 ? 16 HELX_P HELX_P4 4 ILE A 64 ? THR A 72 ? ILE A 64 THR A 72 1 ? 9 HELX_P HELX_P5 5 ARG A 77 ? LEU A 90 ? ARG A 77 LEU A 90 1 ? 14 HELX_P HELX_P6 6 TRP A 93 ? ASP A 97 ? TRP A 93 ASP A 97 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2LKY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 MET 75 75 75 MET MET A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 TRP 93 93 93 TRP TRP A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 ARG 112 112 112 ARG ARG A . n # _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center SSGCID _pdbx_SG_project.project_name ? # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-11-16 2 'Structure model' 1 1 2020-02-26 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' struct_ref_seq_dif 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 2 'Structure model' '_pdbx_nmr_software.name' 14 2 'Structure model' '_struct_ref_seq_dif.details' 15 3 'Structure model' '_database_2.pdbx_DOI' 16 3 'Structure model' '_database_2.pdbx_database_accession' 17 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_entry_details.entry_id 2LKY _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details 'THE AUTHORS STATE THAT THE PROTEIN WAS OBTAINED VIA PCR CLONING, AND M5 AND V6 ARE PART OF THE PROTEIN SEQUENCE.' _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 1.0 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium chloride-2' 100 ? mM ? 1 DTT-3 1 ? mM ? 1 TRIS-4 20 ? mM ? 1 entity-5 1.0 ? mM '[U-99% 13C; U-99% 15N]' 2 'sodium chloride-6' 100 ? mM ? 2 DTT-7 1 ? mM ? 2 TRIS-8 20 ? mM ? 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LKY _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1726 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 1272 _pdbx_nmr_constraints.NOE_long_range_total_count 344 _pdbx_nmr_constraints.NOE_medium_range_total_count 413 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 515 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 71 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 71 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 5 ? ? -61.34 -75.24 2 1 ALA A 57 ? ? -174.86 139.19 3 1 ASP A 63 ? ? -31.69 140.24 4 1 PRO A 76 ? ? -69.83 -91.71 5 2 ALA A 57 ? ? -164.01 -90.20 6 2 HIS A 58 ? ? 169.81 101.53 7 2 ASP A 63 ? ? -32.50 121.53 8 2 PRO A 76 ? ? -67.08 -99.57 9 2 PRO A 98 ? ? -61.18 -174.72 10 3 SER A 4 ? ? -113.15 -87.20 11 3 MET A 5 ? ? 172.47 146.63 12 3 ASP A 63 ? ? -34.98 113.74 13 3 PRO A 76 ? ? -68.79 -93.89 14 3 PRO A 98 ? ? -55.45 -175.07 15 3 ASP A 105 ? ? -82.24 42.85 16 4 ALA A 57 ? ? -166.18 108.81 17 4 ASP A 63 ? ? 60.14 138.36 18 4 PRO A 76 ? ? -73.65 -87.80 19 4 SER A 108 ? ? -114.08 54.05 20 5 ASN A 7 ? ? -49.18 165.16 21 5 ALA A 57 ? ? -171.59 124.85 22 5 ASP A 63 ? ? -37.76 124.05 23 5 PRO A 76 ? ? -71.30 -89.98 24 6 PRO A 2 ? ? -63.85 80.97 25 6 ASP A 63 ? ? -31.67 133.88 26 6 PRO A 76 ? ? -69.17 -96.81 27 6 PRO A 111 ? ? -80.00 43.45 28 7 ASN A 7 ? ? -55.74 171.90 29 7 ASP A 63 ? ? -37.34 129.55 30 7 PRO A 76 ? ? -75.32 -99.06 31 7 GLU A 102 ? ? -49.34 98.29 32 8 PRO A 2 ? ? -72.89 -165.13 33 8 MET A 5 ? ? -141.63 -157.74 34 8 ASN A 7 ? ? -41.27 154.56 35 8 ALA A 57 ? ? -163.96 108.62 36 8 PRO A 76 ? ? -62.96 -84.96 37 8 ASP A 105 ? ? -173.96 140.55 38 8 GLU A 107 ? ? -140.45 10.70 39 8 SER A 108 ? ? -156.89 32.87 40 8 PRO A 111 ? ? -41.94 105.95 41 9 ASN A 7 ? ? -48.50 151.02 42 9 ASP A 60 ? ? 71.75 -57.56 43 9 PRO A 76 ? ? -62.37 -88.62 44 9 ASP A 100 ? ? -45.30 106.41 45 9 PRO A 104 ? ? -72.38 31.73 46 10 PRO A 2 ? ? -55.33 97.74 47 10 ALA A 57 ? ? -177.90 -179.38 48 10 PRO A 76 ? ? -70.50 -99.42 49 10 GLU A 103 ? ? -167.11 -54.92 50 10 PRO A 104 ? ? -83.06 -85.09 51 11 PRO A 2 ? ? -57.61 107.77 52 11 VAL A 6 ? ? -55.26 170.02 53 11 ASN A 7 ? ? -47.08 151.12 54 11 ASP A 63 ? ? -37.88 110.90 55 11 PRO A 76 ? ? -73.11 -103.09 56 12 PHE A 59 ? ? -150.02 32.38 57 12 ASP A 63 ? ? -36.36 123.35 58 12 PRO A 76 ? ? -68.78 -87.05 59 12 GLU A 102 ? ? 64.61 126.68 60 12 ASP A 105 ? ? -149.42 22.02 61 12 SER A 108 ? ? -155.59 9.17 62 12 PRO A 111 ? ? -49.97 153.24 63 13 PRO A 2 ? ? -79.73 -161.45 64 13 LEU A 41 ? ? -177.75 139.25 65 13 ASP A 63 ? ? -37.42 135.19 66 13 PRO A 76 ? ? -57.28 -83.97 67 13 TRP A 93 ? ? -155.36 80.66 68 14 SER A 4 ? ? 59.66 79.09 69 14 PRO A 76 ? ? -62.64 -87.90 70 14 GLU A 102 ? ? -53.36 107.34 71 14 SER A 108 ? ? -108.72 76.53 72 15 LEU A 41 ? ? -171.64 133.62 73 15 ALA A 57 ? ? -165.90 118.47 74 15 ASP A 60 ? ? -75.33 41.34 75 15 ASP A 63 ? ? -34.72 109.27 76 15 PRO A 76 ? ? -66.85 -91.44 77 16 VAL A 6 ? ? -65.05 -173.77 78 16 ALA A 57 ? ? -172.32 91.31 79 16 PRO A 76 ? ? -67.30 -88.09 80 16 PRO A 104 ? ? -75.21 -161.12 81 17 PRO A 2 ? ? -68.65 -76.96 82 17 SER A 4 ? ? -150.07 -87.01 83 17 ASN A 7 ? ? -50.00 162.01 84 17 ALA A 57 ? ? -169.16 105.42 85 17 ASP A 60 ? ? 73.43 -38.31 86 17 PRO A 76 ? ? -64.07 -88.20 87 17 TRP A 93 ? ? -150.88 78.08 88 17 GLU A 107 ? ? 76.43 -64.42 #