data_2LO7 # _entry.id 2LO7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2LO7 RCSB RCSB102625 BMRB 17876 WWPDB D_1000102625 # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2012-03-14 _pdbx_database_PDB_obs_spr.pdb_id 2LO7 _pdbx_database_PDB_obs_spr.replace_pdb_id 2LKA _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17987 BMRB unspecified . 17876 BMRB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LO7 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-01-17 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'del Rio-Portilla, F.' 1 'Saucedo, A.L.' 2 'Flores-Solis, D.' 3 # _citation.id primary _citation.title 'New Tricks of an Old Pattern: STRUCTURAL VERSATILITY OF SCORPION TOXINS WITH COMMON CYSTEINE SPACING.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 287 _citation.page_first 12321 _citation.page_last 12330 _citation.year 2012 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22238341 _citation.pdbx_database_id_DOI 10.1074/jbc.M111.329607 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Saucedo, A.L.' 1 primary 'Flores-Solis, D.' 2 primary 'Rodriguez de la Vega, R.C.' 3 primary 'Ramirez-Cordero, B.' 4 primary 'Hernandez-Lopez, R.' 5 primary 'Cano-Sanchez, P.' 6 primary 'Navarro, R.N.' 7 primary 'Garcia-Valdes, J.' 8 primary 'Coronas-Valderrama, F.' 9 primary 'de Roodt, A.' 10 primary 'Brieba, L.G.' 11 primary 'Possani, L.D.' 12 primary 'Del Rio-Portilla, F.' 13 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Toxin Ts16' _entity.formula_weight 3460.130 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name Tityustoxin-16 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSGCMKEYCAGQCRGKVSQDYCLKHCKCIPR _entity_poly.pdbx_seq_one_letter_code_can GSGCMKEYCAGQCRGKVSQDYCLKHCKCIPR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLY n 1 4 CYS n 1 5 MET n 1 6 LYS n 1 7 GLU n 1 8 TYR n 1 9 CYS n 1 10 ALA n 1 11 GLY n 1 12 GLN n 1 13 CYS n 1 14 ARG n 1 15 GLY n 1 16 LYS n 1 17 VAL n 1 18 SER n 1 19 GLN n 1 20 ASP n 1 21 TYR n 1 22 CYS n 1 23 LEU n 1 24 LYS n 1 25 HIS n 1 26 CYS n 1 27 LYS n 1 28 CYS n 1 29 ILE n 1 30 PRO n 1 31 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Brazilian scorpion' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain Ts16 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Tityus serrulatus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6887 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pet32b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TTX16_TITSE _struct_ref.pdbx_db_accession P86271 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GCMKEYCAGQCRGKVSQDYCLKHCKCIPR _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LO7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 31 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P86271 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 29 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 31 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LO7 GLY A 1 ? UNP P86271 ? ? 'EXPRESSION TAG' 1 1 1 2LO7 SER A 2 ? UNP P86271 ? ? 'EXPRESSION TAG' 2 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 DQFCOSY 1 2 1 TOCSY 1 3 1 NOESY 1 4 1 NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 3.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '3.2 mM Ts16, 95% H2O, 5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Varian INOVA 1 'Varian Inova' 700 Varian VNMRS 2 'Varian VNMRS' # _pdbx_nmr_refine.entry_id 2LO7 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'Amber force field' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria '20 structures for lowest energy and no violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LO7 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LO7 _pdbx_nmr_representative.selection_criteria 'no violations' # _pdbx_nmr_software.authors 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, and Kollm' _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name AMBER _pdbx_nmr_software.version ? _pdbx_nmr_software.ordinal 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LO7 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LO7 _struct.title 'Ts16 NMR solution structure' _struct.pdbx_descriptor 'Toxin Ts16' _struct.pdbx_model_details 'CS alfa alfa motif, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LO7 _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'CS ALPHA ALPHA MOTIF, ALPHA SCORPION TOXIN, VOLTAGE GATED POTASSIUM CHANNEL, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 MET A 5 ? CYS A 13 ? MET A 5 CYS A 13 1 ? 9 HELX_P HELX_P2 2 GLY A 15 ? CYS A 26 ? GLY A 15 CYS A 26 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 26 SG ? ? A CYS 4 A CYS 26 1_555 ? ? ? ? ? ? ? 2.038 ? disulf2 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 9 A CYS 22 1_555 ? ? ? ? ? ? ? 2.041 ? disulf3 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 13 A CYS 28 1_555 ? ? ? ? ? ? ? 2.038 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 SER 2 A . ? SER 2 A GLY 3 A ? GLY 3 A 2 -1.07 2 PRO 30 A . ? PRO 30 A ARG 31 A ? ARG 31 A 5 4.15 3 GLY 1 A . ? GLY 1 A SER 2 A ? SER 2 A 9 5.42 # _atom_sites.entry_id 2LO7 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 ARG 31 31 31 ARG ARG A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-03-14 2 'Structure model' 1 1 2012-05-09 3 'Structure model' 1 2 2014-01-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' Other # _pdbx_nmr_exptl_sample.component Ts16-1 _pdbx_nmr_exptl_sample.concentration 3.2 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling ? _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 14 ? ? CZ A ARG 14 ? ? NH1 A ARG 14 ? ? 123.58 120.30 3.28 0.50 N 2 2 NE A ARG 14 ? ? CZ A ARG 14 ? ? NH1 A ARG 14 ? ? 124.38 120.30 4.08 0.50 N 3 2 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 123.42 120.30 3.12 0.50 N 4 3 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 124.10 120.30 3.80 0.50 N 5 4 NE A ARG 14 ? ? CZ A ARG 14 ? ? NH1 A ARG 14 ? ? 123.67 120.30 3.37 0.50 N 6 4 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 123.42 120.30 3.12 0.50 N 7 5 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 123.39 120.30 3.09 0.50 N 8 6 NE A ARG 14 ? ? CZ A ARG 14 ? ? NH1 A ARG 14 ? ? 124.06 120.30 3.76 0.50 N 9 6 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 123.69 120.30 3.39 0.50 N 10 7 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 124.74 120.30 4.44 0.50 N 11 8 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 124.50 120.30 4.20 0.50 N 12 9 NE A ARG 14 ? ? CZ A ARG 14 ? ? NH1 A ARG 14 ? ? 124.09 120.30 3.79 0.50 N 13 14 NE A ARG 14 ? ? CZ A ARG 14 ? ? NH1 A ARG 14 ? ? 123.98 120.30 3.68 0.50 N 14 15 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 124.03 120.30 3.73 0.50 N 15 16 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 123.55 120.30 3.25 0.50 N 16 17 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 123.88 120.30 3.58 0.50 N 17 19 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 124.47 120.30 4.17 0.50 N 18 20 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 123.93 120.30 3.63 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 2 CYS A 4 ? ? -142.76 -101.68 2 3 CYS A 4 ? ? -127.86 -83.15 3 4 CYS A 4 ? ? -122.04 -77.36 4 4 CYS A 26 ? ? 54.76 16.28 5 4 PRO A 30 ? ? -69.15 30.32 6 5 CYS A 26 ? ? 59.48 13.37 7 6 CYS A 4 ? ? -132.11 -73.15 8 7 SER A 2 ? ? -78.59 47.58 9 7 CYS A 4 ? ? -144.65 -93.35 10 7 GLN A 12 ? ? -122.95 -57.65 11 8 CYS A 4 ? ? -108.91 -90.26 12 8 HIS A 25 ? ? -143.25 -4.56 13 9 SER A 2 ? ? -146.75 10.15 14 9 HIS A 25 ? ? -141.66 -5.36 15 9 CYS A 26 ? ? 64.51 -2.71 16 10 CYS A 4 ? ? -94.45 -88.73 17 10 CYS A 26 ? ? 59.38 9.42 18 11 CYS A 4 ? ? -66.33 -76.32 19 11 LYS A 16 ? ? 59.39 -30.05 20 11 HIS A 25 ? ? -142.92 -1.34 21 11 CYS A 26 ? ? 58.21 13.27 22 12 MET A 5 ? ? -170.92 138.70 23 14 CYS A 4 ? ? -91.23 -92.70 24 14 CYS A 26 ? ? 59.40 6.43 25 15 CYS A 4 ? ? -124.31 -69.90 26 15 CYS A 26 ? ? 56.48 11.92 27 16 SER A 2 ? ? -77.96 29.37 28 16 CYS A 4 ? ? -135.52 -83.35 29 16 HIS A 25 ? ? -144.45 -1.94 30 17 CYS A 4 ? ? -110.35 -83.28 31 17 CYS A 26 ? ? 54.94 11.25 32 18 CYS A 4 ? ? -72.95 -78.11 33 19 SER A 2 ? ? 54.96 111.75 34 19 CYS A 4 ? ? -126.98 -80.65 35 19 CYS A 26 ? ? 58.05 18.79 36 20 CYS A 4 ? ? -109.52 -96.26 37 20 CYS A 26 ? ? 55.39 15.46 38 20 PRO A 30 ? ? -58.53 106.51 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 GLY A 3 ? ? CYS A 4 ? ? -45.30 2 1 CYS A 4 ? ? MET A 5 ? ? 145.72 3 5 GLY A 3 ? ? CYS A 4 ? ? -40.82 4 5 CYS A 4 ? ? MET A 5 ? ? 139.41 5 7 ILE A 29 ? ? PRO A 30 ? ? -147.36 6 13 GLY A 3 ? ? CYS A 4 ? ? -47.78 7 13 CYS A 4 ? ? MET A 5 ? ? 134.32 8 13 ARG A 14 ? ? GLY A 15 ? ? -146.97 9 15 CYS A 4 ? ? MET A 5 ? ? 147.48 10 15 ARG A 14 ? ? GLY A 15 ? ? -146.44 11 17 ARG A 14 ? ? GLY A 15 ? ? -147.77 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 19 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 14 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.092 _pdbx_validate_planes.type 'SIDE CHAIN' #