data_2LRA # _entry.id 2LRA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LRA pdb_00002lra 10.2210/pdb2lra/pdb RCSB RCSB102734 ? ? BMRB 18355 ? 10.13018/BMR18355 WWPDB D_1000102734 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-05-22 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' Other 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' struct_ref_seq_dif 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_struct_ref_seq_dif.details' 5 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LRA _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2012-03-28 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 18355 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tripathi, S.' 1 'Pulavarti, S.' 2 'Yadav, R.' 3 'Jain, A.' 4 'Pathak, P.' 5 'Meher, A.' 6 'Arora, A.' 7 # _citation.id primary _citation.title 'NMR Structure of Signal Sequence Deleted (SSD) Rv0603 Protein from Mycobacterium tuberculosis without N-terminal His-tag' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tripathi, S.' 1 ? primary 'Pulavarti, S.' 2 ? primary 'Yadav, R.' 3 ? primary 'Jain, A.' 4 ? primary 'Pathak, P.' 5 ? primary 'Meher, A.' 6 ? primary 'Arora, A.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'POSSIBLE EXPORTED PROTEIN' _entity.formula_weight 8235.750 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP RESIDUES 28-103' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name Rv0603-SSD # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAMAFDGEDEVTGPDADRARAAAVQAVPGGTAGEVETETGEGAAAYGVLVTRPDGTRVEVHLDRDFRVLDTEPADGDGGL E ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMAFDGEDEVTGPDADRARAAAVQAVPGGTAGEVETETGEGAAAYGVLVTRPDGTRVEVHLDRDFRVLDTEPADGDGGL E ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 ALA n 1 5 PHE n 1 6 ASP n 1 7 GLY n 1 8 GLU n 1 9 ASP n 1 10 GLU n 1 11 VAL n 1 12 THR n 1 13 GLY n 1 14 PRO n 1 15 ASP n 1 16 ALA n 1 17 ASP n 1 18 ARG n 1 19 ALA n 1 20 ARG n 1 21 ALA n 1 22 ALA n 1 23 ALA n 1 24 VAL n 1 25 GLN n 1 26 ALA n 1 27 VAL n 1 28 PRO n 1 29 GLY n 1 30 GLY n 1 31 THR n 1 32 ALA n 1 33 GLY n 1 34 GLU n 1 35 VAL n 1 36 GLU n 1 37 THR n 1 38 GLU n 1 39 THR n 1 40 GLY n 1 41 GLU n 1 42 GLY n 1 43 ALA n 1 44 ALA n 1 45 ALA n 1 46 TYR n 1 47 GLY n 1 48 VAL n 1 49 LEU n 1 50 VAL n 1 51 THR n 1 52 ARG n 1 53 PRO n 1 54 ASP n 1 55 GLY n 1 56 THR n 1 57 ARG n 1 58 VAL n 1 59 GLU n 1 60 VAL n 1 61 HIS n 1 62 LEU n 1 63 ASP n 1 64 ARG n 1 65 ASP n 1 66 PHE n 1 67 ARG n 1 68 VAL n 1 69 LEU n 1 70 ASP n 1 71 THR n 1 72 GLU n 1 73 PRO n 1 74 ALA n 1 75 ASP n 1 76 GLY n 1 77 ASP n 1 78 GLY n 1 79 GLY n 1 80 LEU n 1 81 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Rv0603 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1773 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain K12 _entity_src_gen.pdbx_host_org_variant 'BL21(DE3)' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET-NH6 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLU 81 81 81 GLU GLU A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LRA _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LRA _struct.title 'NMR Structure of Signal Sequence Deleted (SSD) Rv0603 Protein from Mycobacterium tuberculosis without N-terminal His-tag' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LRA _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' _struct_keywords.text 'SSD, IMMUNE SYSTEM' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O07775_MYCTU _struct_ref.pdbx_db_accession O07775 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AFDGEDEVTGPDADRARAAAVQAVPGGTAGEVETETGEGAAAYGVLVTRPDGTRVEVHLDRDFRVLDTEPADGDGG _struct_ref.pdbx_align_begin 28 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LRA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 79 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O07775 _struct_ref_seq.db_align_beg 28 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 103 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 79 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LRA GLY A 1 ? UNP O07775 ? ? 'expression tag' 1 1 1 2LRA ALA A 2 ? UNP O07775 ? ? 'expression tag' 2 2 1 2LRA MET A 3 ? UNP O07775 ? ? 'expression tag' 3 3 1 2LRA LEU A 80 ? UNP O07775 ? ? 'expression tag' 80 4 1 2LRA GLU A 81 ? UNP O07775 ? ? 'expression tag' 81 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 14 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 25 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 14 _struct_conf.end_auth_comp_id GLN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 25 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 31 ? ALA A 32 ? THR A 31 ALA A 32 A 2 TYR A 46 ? ARG A 52 ? TYR A 46 ARG A 52 A 3 GLU A 36 ? THR A 37 ? GLU A 36 THR A 37 B 1 THR A 31 ? ALA A 32 ? THR A 31 ALA A 32 B 2 TYR A 46 ? ARG A 52 ? TYR A 46 ARG A 52 B 3 THR A 56 ? LEU A 62 ? THR A 56 LEU A 62 B 4 VAL A 68 ? PRO A 73 ? VAL A 68 PRO A 73 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 31 ? N THR A 31 O THR A 51 ? O THR A 51 A 2 3 O GLY A 47 ? O GLY A 47 N GLU A 36 ? N GLU A 36 B 1 2 N THR A 31 ? N THR A 31 O THR A 51 ? O THR A 51 B 2 3 N VAL A 48 ? N VAL A 48 O VAL A 60 ? O VAL A 60 B 3 4 N HIS A 61 ? N HIS A 61 O LEU A 69 ? O LEU A 69 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HG22 A VAL 11 ? ? HB2 A ASP 17 ? ? 1.26 2 2 HB3 A ASP 63 ? ? HD11 A LEU 69 ? ? 1.35 3 3 HE A ARG 57 ? ? OE1 A GLU 59 ? ? 1.60 4 5 HB A THR 31 ? ? HB A THR 51 ? ? 1.30 5 10 HA A ALA 16 ? ? HG21 A VAL 35 ? ? 1.24 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 6 ? ? -131.96 -74.50 2 1 GLU A 38 ? ? -79.79 -166.61 3 2 ASP A 6 ? ? 63.91 101.77 4 2 GLU A 10 ? ? -65.56 97.36 5 2 PRO A 14 ? ? -54.67 -70.15 6 2 PRO A 53 ? ? -57.93 -9.56 7 3 PHE A 5 ? ? -113.12 57.50 8 3 LEU A 69 ? ? -101.19 -64.25 9 4 PHE A 5 ? ? -117.55 58.14 10 4 ALA A 45 ? ? -149.11 -36.93 11 4 PRO A 53 ? ? -68.88 17.95 12 4 LEU A 69 ? ? -96.18 -62.58 13 5 ASP A 6 ? ? -147.83 -142.75 14 5 VAL A 11 ? ? -60.14 96.18 15 5 ALA A 43 ? ? -175.13 -38.76 16 5 ALA A 45 ? ? -139.78 -36.40 17 5 ASP A 70 ? ? -170.35 -179.34 18 6 ASP A 6 ? ? 175.60 95.05 19 6 PRO A 53 ? ? -68.20 1.78 20 7 ASP A 6 ? ? 67.62 110.98 21 7 LEU A 69 ? ? -90.93 -60.01 22 8 PHE A 5 ? ? -113.91 54.69 23 8 ASP A 6 ? ? 174.23 101.01 24 8 PRO A 14 ? ? -73.29 -142.20 25 9 ASP A 6 ? ? -127.11 -58.07 26 9 PRO A 14 ? ? -76.14 -76.73 27 10 ASP A 6 ? ? -150.29 -77.97 28 10 PRO A 28 ? ? -69.21 96.02 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LRA _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LRA _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;20 mM sodium phosphate-1, 50 mM sodium chloride-2, 0.1 % sodium azide-3, 1 mM AEBSF protease inhibitor-4, 1 mM [U-99% 15N] Rv0603-SSD-5, 93% H2O/7% D2O ; 1 '93% H2O/7% D2O' ;20 mM sodium phosphate-6, 50 mM sodium chloride-7, 0.1 % sodium azide-8, 1 mM AEBSF protease inhibitor-9, 1 mM [U-99% 13C; U-99% 15N] Rv0603-SSD-10, 93% H2O/7% D2O ; 2 '93% H2O/7% D2O' ;20 mM sodium phosphate-11, 50 mM sodium chloride-12, 0.1 % sodium azide-13, 1 mM AEBSF protease inhibitor-14, 1 mM [U-99% 13C; U-99% 15N] Rv0603-SSD-15, 100% D2O ; 3 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sodium phosphate-1' 20 ? mM ? 1 'sodium chloride-2' 50 ? mM ? 1 'sodium azide-3' 0.1 ? % ? 1 'AEBSF protease inhibitor-4' 1 ? mM ? 1 Rv0603-SSD-5 1 ? mM '[U-99% 15N]' 1 'sodium phosphate-6' 20 ? mM ? 2 'sodium chloride-7' 50 ? mM ? 2 'sodium azide-8' 0.1 ? % ? 2 'AEBSF protease inhibitor-9' 1 ? mM ? 2 Rv0603-SSD-10 1 ? mM '[U-99% 13C; U-99% 15N]' 2 'sodium phosphate-11' 20 ? mM ? 3 'sodium chloride-12' 50 ? mM ? 3 'sodium azide-13' 0.1 ? % ? 3 'AEBSF protease inhibitor-14' 1 ? mM ? 3 Rv0603-SSD-15 1 ? mM '[U-99% 13C; U-99% 15N]' 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '3D HNCACB' 1 3 2 '3D CBCA(CO)NH' 1 4 2 '3D HNCO' 1 5 2 '3D HN(CO)CA' 1 6 2 '3D H(CCO)NH' 1 7 2 '3D C(CO)NH' 1 8 2 '3D HCCH-TOCSY' 1 9 3 '2D 1H-13C HSQC aliphatic' 1 10 3 '2D 1H-13C HSQC aromatic' 1 11 2 '2D CB(CGCD)HD' 1 12 2 '2D CB(CGCE)HE' 1 13 2 '2D 1H-1H NOESY aromatic' 1 14 1 '3D 1H-15N NOESY' 1 15 3 '3D 1H-13C NOESY aliphatic' 1 16 3 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LRA _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1235 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 319 _pdbx_nmr_constraints.NOE_long_range_total_count 391 _pdbx_nmr_constraints.NOE_medium_range_total_count 190 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 335 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 4 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 63 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 61 # _pdbx_nmr_refine.entry_id 2LRA _pdbx_nmr_refine.method 'water refinement' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Guntert, Mumenthaler and Wuthrich' 'structure solution' Cyana3.0 1 ? 'Bhattacharya and Montelione' 'validation of structure quality' PSVS 2 1.4 ? refinement CNS 3 solve_1.21 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLN N N N N 57 GLN CA C N S 58 GLN C C N N 59 GLN O O N N 60 GLN CB C N N 61 GLN CG C N N 62 GLN CD C N N 63 GLN OE1 O N N 64 GLN NE2 N N N 65 GLN OXT O N N 66 GLN H H N N 67 GLN H2 H N N 68 GLN HA H N N 69 GLN HB2 H N N 70 GLN HB3 H N N 71 GLN HG2 H N N 72 GLN HG3 H N N 73 GLN HE21 H N N 74 GLN HE22 H N N 75 GLN HXT H N N 76 GLU N N N N 77 GLU CA C N S 78 GLU C C N N 79 GLU O O N N 80 GLU CB C N N 81 GLU CG C N N 82 GLU CD C N N 83 GLU OE1 O N N 84 GLU OE2 O N N 85 GLU OXT O N N 86 GLU H H N N 87 GLU H2 H N N 88 GLU HA H N N 89 GLU HB2 H N N 90 GLU HB3 H N N 91 GLU HG2 H N N 92 GLU HG3 H N N 93 GLU HE2 H N N 94 GLU HXT H N N 95 GLY N N N N 96 GLY CA C N N 97 GLY C C N N 98 GLY O O N N 99 GLY OXT O N N 100 GLY H H N N 101 GLY H2 H N N 102 GLY HA2 H N N 103 GLY HA3 H N N 104 GLY HXT H N N 105 HIS N N N N 106 HIS CA C N S 107 HIS C C N N 108 HIS O O N N 109 HIS CB C N N 110 HIS CG C Y N 111 HIS ND1 N Y N 112 HIS CD2 C Y N 113 HIS CE1 C Y N 114 HIS NE2 N Y N 115 HIS OXT O N N 116 HIS H H N N 117 HIS H2 H N N 118 HIS HA H N N 119 HIS HB2 H N N 120 HIS HB3 H N N 121 HIS HD1 H N N 122 HIS HD2 H N N 123 HIS HE1 H N N 124 HIS HE2 H N N 125 HIS HXT H N N 126 LEU N N N N 127 LEU CA C N S 128 LEU C C N N 129 LEU O O N N 130 LEU CB C N N 131 LEU CG C N N 132 LEU CD1 C N N 133 LEU CD2 C N N 134 LEU OXT O N N 135 LEU H H N N 136 LEU H2 H N N 137 LEU HA H N N 138 LEU HB2 H N N 139 LEU HB3 H N N 140 LEU HG H N N 141 LEU HD11 H N N 142 LEU HD12 H N N 143 LEU HD13 H N N 144 LEU HD21 H N N 145 LEU HD22 H N N 146 LEU HD23 H N N 147 LEU HXT H N N 148 MET N N N N 149 MET CA C N S 150 MET C C N N 151 MET O O N N 152 MET CB C N N 153 MET CG C N N 154 MET SD S N N 155 MET CE C N N 156 MET OXT O N N 157 MET H H N N 158 MET H2 H N N 159 MET HA H N N 160 MET HB2 H N N 161 MET HB3 H N N 162 MET HG2 H N N 163 MET HG3 H N N 164 MET HE1 H N N 165 MET HE2 H N N 166 MET HE3 H N N 167 MET HXT H N N 168 PHE N N N N 169 PHE CA C N S 170 PHE C C N N 171 PHE O O N N 172 PHE CB C N N 173 PHE CG C Y N 174 PHE CD1 C Y N 175 PHE CD2 C Y N 176 PHE CE1 C Y N 177 PHE CE2 C Y N 178 PHE CZ C Y N 179 PHE OXT O N N 180 PHE H H N N 181 PHE H2 H N N 182 PHE HA H N N 183 PHE HB2 H N N 184 PHE HB3 H N N 185 PHE HD1 H N N 186 PHE HD2 H N N 187 PHE HE1 H N N 188 PHE HE2 H N N 189 PHE HZ H N N 190 PHE HXT H N N 191 PRO N N N N 192 PRO CA C N S 193 PRO C C N N 194 PRO O O N N 195 PRO CB C N N 196 PRO CG C N N 197 PRO CD C N N 198 PRO OXT O N N 199 PRO H H N N 200 PRO HA H N N 201 PRO HB2 H N N 202 PRO HB3 H N N 203 PRO HG2 H N N 204 PRO HG3 H N N 205 PRO HD2 H N N 206 PRO HD3 H N N 207 PRO HXT H N N 208 THR N N N N 209 THR CA C N S 210 THR C C N N 211 THR O O N N 212 THR CB C N R 213 THR OG1 O N N 214 THR CG2 C N N 215 THR OXT O N N 216 THR H H N N 217 THR H2 H N N 218 THR HA H N N 219 THR HB H N N 220 THR HG1 H N N 221 THR HG21 H N N 222 THR HG22 H N N 223 THR HG23 H N N 224 THR HXT H N N 225 TYR N N N N 226 TYR CA C N S 227 TYR C C N N 228 TYR O O N N 229 TYR CB C N N 230 TYR CG C Y N 231 TYR CD1 C Y N 232 TYR CD2 C Y N 233 TYR CE1 C Y N 234 TYR CE2 C Y N 235 TYR CZ C Y N 236 TYR OH O N N 237 TYR OXT O N N 238 TYR H H N N 239 TYR H2 H N N 240 TYR HA H N N 241 TYR HB2 H N N 242 TYR HB3 H N N 243 TYR HD1 H N N 244 TYR HD2 H N N 245 TYR HE1 H N N 246 TYR HE2 H N N 247 TYR HH H N N 248 TYR HXT H N N 249 VAL N N N N 250 VAL CA C N S 251 VAL C C N N 252 VAL O O N N 253 VAL CB C N N 254 VAL CG1 C N N 255 VAL CG2 C N N 256 VAL OXT O N N 257 VAL H H N N 258 VAL H2 H N N 259 VAL HA H N N 260 VAL HB H N N 261 VAL HG11 H N N 262 VAL HG12 H N N 263 VAL HG13 H N N 264 VAL HG21 H N N 265 VAL HG22 H N N 266 VAL HG23 H N N 267 VAL HXT H N N 268 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLN N CA sing N N 54 GLN N H sing N N 55 GLN N H2 sing N N 56 GLN CA C sing N N 57 GLN CA CB sing N N 58 GLN CA HA sing N N 59 GLN C O doub N N 60 GLN C OXT sing N N 61 GLN CB CG sing N N 62 GLN CB HB2 sing N N 63 GLN CB HB3 sing N N 64 GLN CG CD sing N N 65 GLN CG HG2 sing N N 66 GLN CG HG3 sing N N 67 GLN CD OE1 doub N N 68 GLN CD NE2 sing N N 69 GLN NE2 HE21 sing N N 70 GLN NE2 HE22 sing N N 71 GLN OXT HXT sing N N 72 GLU N CA sing N N 73 GLU N H sing N N 74 GLU N H2 sing N N 75 GLU CA C sing N N 76 GLU CA CB sing N N 77 GLU CA HA sing N N 78 GLU C O doub N N 79 GLU C OXT sing N N 80 GLU CB CG sing N N 81 GLU CB HB2 sing N N 82 GLU CB HB3 sing N N 83 GLU CG CD sing N N 84 GLU CG HG2 sing N N 85 GLU CG HG3 sing N N 86 GLU CD OE1 doub N N 87 GLU CD OE2 sing N N 88 GLU OE2 HE2 sing N N 89 GLU OXT HXT sing N N 90 GLY N CA sing N N 91 GLY N H sing N N 92 GLY N H2 sing N N 93 GLY CA C sing N N 94 GLY CA HA2 sing N N 95 GLY CA HA3 sing N N 96 GLY C O doub N N 97 GLY C OXT sing N N 98 GLY OXT HXT sing N N 99 HIS N CA sing N N 100 HIS N H sing N N 101 HIS N H2 sing N N 102 HIS CA C sing N N 103 HIS CA CB sing N N 104 HIS CA HA sing N N 105 HIS C O doub N N 106 HIS C OXT sing N N 107 HIS CB CG sing N N 108 HIS CB HB2 sing N N 109 HIS CB HB3 sing N N 110 HIS CG ND1 sing Y N 111 HIS CG CD2 doub Y N 112 HIS ND1 CE1 doub Y N 113 HIS ND1 HD1 sing N N 114 HIS CD2 NE2 sing Y N 115 HIS CD2 HD2 sing N N 116 HIS CE1 NE2 sing Y N 117 HIS CE1 HE1 sing N N 118 HIS NE2 HE2 sing N N 119 HIS OXT HXT sing N N 120 LEU N CA sing N N 121 LEU N H sing N N 122 LEU N H2 sing N N 123 LEU CA C sing N N 124 LEU CA CB sing N N 125 LEU CA HA sing N N 126 LEU C O doub N N 127 LEU C OXT sing N N 128 LEU CB CG sing N N 129 LEU CB HB2 sing N N 130 LEU CB HB3 sing N N 131 LEU CG CD1 sing N N 132 LEU CG CD2 sing N N 133 LEU CG HG sing N N 134 LEU CD1 HD11 sing N N 135 LEU CD1 HD12 sing N N 136 LEU CD1 HD13 sing N N 137 LEU CD2 HD21 sing N N 138 LEU CD2 HD22 sing N N 139 LEU CD2 HD23 sing N N 140 LEU OXT HXT sing N N 141 MET N CA sing N N 142 MET N H sing N N 143 MET N H2 sing N N 144 MET CA C sing N N 145 MET CA CB sing N N 146 MET CA HA sing N N 147 MET C O doub N N 148 MET C OXT sing N N 149 MET CB CG sing N N 150 MET CB HB2 sing N N 151 MET CB HB3 sing N N 152 MET CG SD sing N N 153 MET CG HG2 sing N N 154 MET CG HG3 sing N N 155 MET SD CE sing N N 156 MET CE HE1 sing N N 157 MET CE HE2 sing N N 158 MET CE HE3 sing N N 159 MET OXT HXT sing N N 160 PHE N CA sing N N 161 PHE N H sing N N 162 PHE N H2 sing N N 163 PHE CA C sing N N 164 PHE CA CB sing N N 165 PHE CA HA sing N N 166 PHE C O doub N N 167 PHE C OXT sing N N 168 PHE CB CG sing N N 169 PHE CB HB2 sing N N 170 PHE CB HB3 sing N N 171 PHE CG CD1 doub Y N 172 PHE CG CD2 sing Y N 173 PHE CD1 CE1 sing Y N 174 PHE CD1 HD1 sing N N 175 PHE CD2 CE2 doub Y N 176 PHE CD2 HD2 sing N N 177 PHE CE1 CZ doub Y N 178 PHE CE1 HE1 sing N N 179 PHE CE2 CZ sing Y N 180 PHE CE2 HE2 sing N N 181 PHE CZ HZ sing N N 182 PHE OXT HXT sing N N 183 PRO N CA sing N N 184 PRO N CD sing N N 185 PRO N H sing N N 186 PRO CA C sing N N 187 PRO CA CB sing N N 188 PRO CA HA sing N N 189 PRO C O doub N N 190 PRO C OXT sing N N 191 PRO CB CG sing N N 192 PRO CB HB2 sing N N 193 PRO CB HB3 sing N N 194 PRO CG CD sing N N 195 PRO CG HG2 sing N N 196 PRO CG HG3 sing N N 197 PRO CD HD2 sing N N 198 PRO CD HD3 sing N N 199 PRO OXT HXT sing N N 200 THR N CA sing N N 201 THR N H sing N N 202 THR N H2 sing N N 203 THR CA C sing N N 204 THR CA CB sing N N 205 THR CA HA sing N N 206 THR C O doub N N 207 THR C OXT sing N N 208 THR CB OG1 sing N N 209 THR CB CG2 sing N N 210 THR CB HB sing N N 211 THR OG1 HG1 sing N N 212 THR CG2 HG21 sing N N 213 THR CG2 HG22 sing N N 214 THR CG2 HG23 sing N N 215 THR OXT HXT sing N N 216 TYR N CA sing N N 217 TYR N H sing N N 218 TYR N H2 sing N N 219 TYR CA C sing N N 220 TYR CA CB sing N N 221 TYR CA HA sing N N 222 TYR C O doub N N 223 TYR C OXT sing N N 224 TYR CB CG sing N N 225 TYR CB HB2 sing N N 226 TYR CB HB3 sing N N 227 TYR CG CD1 doub Y N 228 TYR CG CD2 sing Y N 229 TYR CD1 CE1 sing Y N 230 TYR CD1 HD1 sing N N 231 TYR CD2 CE2 doub Y N 232 TYR CD2 HD2 sing N N 233 TYR CE1 CZ doub Y N 234 TYR CE1 HE1 sing N N 235 TYR CE2 CZ sing Y N 236 TYR CE2 HE2 sing N N 237 TYR CZ OH sing N N 238 TYR OH HH sing N N 239 TYR OXT HXT sing N N 240 VAL N CA sing N N 241 VAL N H sing N N 242 VAL N H2 sing N N 243 VAL CA C sing N N 244 VAL CA CB sing N N 245 VAL CA HA sing N N 246 VAL C O doub N N 247 VAL C OXT sing N N 248 VAL CB CG1 sing N N 249 VAL CB CG2 sing N N 250 VAL CB HB sing N N 251 VAL CG1 HG11 sing N N 252 VAL CG1 HG12 sing N N 253 VAL CG1 HG13 sing N N 254 VAL CG2 HG21 sing N N 255 VAL CG2 HG22 sing N N 256 VAL CG2 HG23 sing N N 257 VAL OXT HXT sing N N 258 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _atom_sites.entry_id 2LRA _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_