data_2LRT # _entry.id 2LRT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LRT pdb_00002lrt 10.2210/pdb2lrt/pdb RCSB RCSB102753 ? ? BMRB 18394 ? 10.13018/BMR18394 WWPDB D_1000102753 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-04-25 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_ref_seq_dif 6 3 'Structure model' chem_comp_atom 7 3 'Structure model' chem_comp_bond 8 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 2 'Structure model' '_struct_ref_seq_dif.details' 7 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LRT _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-04-13 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified NYSGRC-011327 TargetTrack . unspecified 18394 BMRB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Harris, R.' 1 'Bandaranayake, A.D.' 2 'Banu, R.' 3 'Bonanno, J.B.' 4 'Calarese, D.A.' 5 'Celikgil, A.' 6 'Chamala, S.' 7 'Chan, M.K.' 8 'Chaparro, R.' 9 'Evans, B.' 10 'Garforth, S.' 11 'Gizzi, A.' 12 'Hillerich, B.' 13 'Kar, A.' 14 'Lafleur, J.' 15 'Lim, S.' 16 'Love, J.' 17 'Matikainen, B.' 18 'Patel, H.' 19 'Seidel, R.D.' 20 'Smith, B.' 21 'Stead, M.' 22 'Girvin, M.E.' 23 'Almo, S.C.' 24 'New York Structural Genomics Research Consortium (NYSGRC)' 25 # _citation.id primary _citation.title 'Solution structure of the uncharacterized thioredoxin-like protein BVU_1432 from Bacteroides vulgatus' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Harris, R.' 1 ? primary 'Bandaranayake, A.D.' 2 ? primary 'Banu, R.' 3 ? primary 'Bonanno, J.B.' 4 ? primary 'Calarese, D.A.' 5 ? primary 'Celikgil, A.' 6 ? primary 'Chamala, S.' 7 ? primary 'Chan, M.K.' 8 ? primary 'Chaparro, R.' 9 ? primary 'Evans, B.' 10 ? primary 'Garforth, S.' 11 ? primary 'Gizzi, A.' 12 ? primary 'Hillerich, B.' 13 ? primary 'Kar, A.' 14 ? primary 'Lafleur, J.' 15 ? primary 'Lim, S.' 16 ? primary 'Love, J.' 17 ? primary 'Matikainen, B.' 18 ? primary 'Patel, H.' 19 ? primary 'Seidel, R.D.' 20 ? primary 'Smith, B.' 21 ? primary 'Stead, M.' 22 ? primary 'Girvin, M.E.' 23 ? primary 'Almo, S.C.' 24 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein' _entity.formula_weight 17321.475 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 242-382' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSLEIPEDKIKEASIIDIQLKDLKGNTRSLTDLKGKVVLIDFTVYNNAMSAAHNLALRELYNKYASQGFEIYQISLDGDE HFWKTSADNLPWVCVRDANGAYSSYISLYNVTNLPSVFLVNRNNELSARGENIKDLDEAIKKLLEGHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSLEIPEDKIKEASIIDIQLKDLKGNTRSLTDLKGKVVLIDFTVYNNAMSAAHNLALRELYNKYASQGFEIYQISLDGDE HFWKTSADNLPWVCVRDANGAYSSYISLYNVTNLPSVFLVNRNNELSARGENIKDLDEAIKKLLEGHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NYSGRC-011327 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 LEU n 1 4 GLU n 1 5 ILE n 1 6 PRO n 1 7 GLU n 1 8 ASP n 1 9 LYS n 1 10 ILE n 1 11 LYS n 1 12 GLU n 1 13 ALA n 1 14 SER n 1 15 ILE n 1 16 ILE n 1 17 ASP n 1 18 ILE n 1 19 GLN n 1 20 LEU n 1 21 LYS n 1 22 ASP n 1 23 LEU n 1 24 LYS n 1 25 GLY n 1 26 ASN n 1 27 THR n 1 28 ARG n 1 29 SER n 1 30 LEU n 1 31 THR n 1 32 ASP n 1 33 LEU n 1 34 LYS n 1 35 GLY n 1 36 LYS n 1 37 VAL n 1 38 VAL n 1 39 LEU n 1 40 ILE n 1 41 ASP n 1 42 PHE n 1 43 THR n 1 44 VAL n 1 45 TYR n 1 46 ASN n 1 47 ASN n 1 48 ALA n 1 49 MET n 1 50 SER n 1 51 ALA n 1 52 ALA n 1 53 HIS n 1 54 ASN n 1 55 LEU n 1 56 ALA n 1 57 LEU n 1 58 ARG n 1 59 GLU n 1 60 LEU n 1 61 TYR n 1 62 ASN n 1 63 LYS n 1 64 TYR n 1 65 ALA n 1 66 SER n 1 67 GLN n 1 68 GLY n 1 69 PHE n 1 70 GLU n 1 71 ILE n 1 72 TYR n 1 73 GLN n 1 74 ILE n 1 75 SER n 1 76 LEU n 1 77 ASP n 1 78 GLY n 1 79 ASP n 1 80 GLU n 1 81 HIS n 1 82 PHE n 1 83 TRP n 1 84 LYS n 1 85 THR n 1 86 SER n 1 87 ALA n 1 88 ASP n 1 89 ASN n 1 90 LEU n 1 91 PRO n 1 92 TRP n 1 93 VAL n 1 94 CYS n 1 95 VAL n 1 96 ARG n 1 97 ASP n 1 98 ALA n 1 99 ASN n 1 100 GLY n 1 101 ALA n 1 102 TYR n 1 103 SER n 1 104 SER n 1 105 TYR n 1 106 ILE n 1 107 SER n 1 108 LEU n 1 109 TYR n 1 110 ASN n 1 111 VAL n 1 112 THR n 1 113 ASN n 1 114 LEU n 1 115 PRO n 1 116 SER n 1 117 VAL n 1 118 PHE n 1 119 LEU n 1 120 VAL n 1 121 ASN n 1 122 ARG n 1 123 ASN n 1 124 ASN n 1 125 GLU n 1 126 LEU n 1 127 SER n 1 128 ALA n 1 129 ARG n 1 130 GLY n 1 131 GLU n 1 132 ASN n 1 133 ILE n 1 134 LYS n 1 135 ASP n 1 136 LEU n 1 137 ASP n 1 138 GLU n 1 139 ALA n 1 140 ILE n 1 141 LYS n 1 142 LYS n 1 143 LEU n 1 144 LEU n 1 145 GLU n 1 146 GLY n 1 147 HIS n 1 148 HIS n 1 149 HIS n 1 150 HIS n 1 151 HIS n 1 152 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BVU_1432 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 8482 / DSM 1447 / NCTC 11154' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacteroides vulgatus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 435590 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pET _entity_src_gen.pdbx_host_org_vector 'modified pET26' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 MET 49 49 49 MET MET A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 HIS 53 53 53 HIS HIS A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 TRP 83 83 83 TRP TRP A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 TRP 92 92 92 TRP TRP A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 CYS 94 94 94 CYS CYS A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 TYR 109 109 109 TYR TYR A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 PHE 118 118 118 PHE PHE A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 ASN 123 123 123 ASN ASN A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 HIS 147 147 147 HIS HIS A . n A 1 148 HIS 148 148 148 HIS HIS A . n A 1 149 HIS 149 149 149 HIS HIS A . n A 1 150 HIS 150 150 150 HIS HIS A . n A 1 151 HIS 151 151 151 HIS HIS A . n A 1 152 HIS 152 152 152 HIS HIS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LRT _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LRT _struct.title 'Solution structure of the uncharacterized thioredoxin-like protein BVU_1432 from Bacteroides vulgatus' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LRT _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'STRUCTURAL GENOMICS, THIOREDOXIN-LIKE, New York Structural Genomics Research Consortium, NYSGRC, PSI-Biology, OXIDOREDUCTASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A6L0A6_BACV8 _struct_ref.pdbx_db_accession A6L0A6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EIPEDKIKEASIIDIQLKDLKGNTRSLTDLKGKVVLIDFTVYNNAMSAAHNLALRELYNKYASQGFEIYQISLDGDEHFW KTSADNLPWVCVRDANGAYSSYISLYNVTNLPSVFLVNRNNELSARGENIKDLDEAIKKLL ; _struct_ref.pdbx_align_begin 242 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LRT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 144 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A6L0A6 _struct_ref_seq.db_align_beg 242 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 382 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 144 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LRT MET A 1 ? UNP A6L0A6 ? ? 'expression tag' 1 1 1 2LRT SER A 2 ? UNP A6L0A6 ? ? 'expression tag' 2 2 1 2LRT LEU A 3 ? UNP A6L0A6 ? ? 'expression tag' 3 3 1 2LRT GLU A 145 ? UNP A6L0A6 ? ? 'expression tag' 145 4 1 2LRT GLY A 146 ? UNP A6L0A6 ? ? 'expression tag' 146 5 1 2LRT HIS A 147 ? UNP A6L0A6 ? ? 'expression tag' 147 6 1 2LRT HIS A 148 ? UNP A6L0A6 ? ? 'expression tag' 148 7 1 2LRT HIS A 149 ? UNP A6L0A6 ? ? 'expression tag' 149 8 1 2LRT HIS A 150 ? UNP A6L0A6 ? ? 'expression tag' 150 9 1 2LRT HIS A 151 ? UNP A6L0A6 ? ? 'expression tag' 151 10 1 2LRT HIS A 152 ? UNP A6L0A6 ? ? 'expression tag' 152 11 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 32 ? LYS A 36 ? ASP A 32 LYS A 36 5 ? 5 HELX_P HELX_P2 2 ASN A 47 ? ALA A 65 ? ASN A 47 ALA A 65 1 ? 19 HELX_P HELX_P3 3 ASP A 79 ? ASP A 88 ? ASP A 79 ASP A 88 1 ? 10 HELX_P HELX_P4 4 ASN A 99 ? TYR A 102 ? ASN A 99 TYR A 102 5 ? 4 HELX_P HELX_P5 5 SER A 103 ? ASN A 110 ? SER A 103 ASN A 110 1 ? 8 HELX_P HELX_P6 6 ASP A 135 ? GLU A 145 ? ASP A 135 GLU A 145 1 ? 11 HELX_P HELX_P7 7 GLY A 146 ? HIS A 148 ? GLY A 146 HIS A 148 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LEU 114 A . ? LEU 114 A PRO 115 A ? PRO 115 A 1 -0.11 2 LEU 114 A . ? LEU 114 A PRO 115 A ? PRO 115 A 2 2.64 3 LEU 114 A . ? LEU 114 A PRO 115 A ? PRO 115 A 3 0.71 4 LEU 114 A . ? LEU 114 A PRO 115 A ? PRO 115 A 4 1.40 5 LEU 114 A . ? LEU 114 A PRO 115 A ? PRO 115 A 5 0.84 6 LEU 114 A . ? LEU 114 A PRO 115 A ? PRO 115 A 6 0.01 7 LEU 114 A . ? LEU 114 A PRO 115 A ? PRO 115 A 7 0.31 8 LEU 114 A . ? LEU 114 A PRO 115 A ? PRO 115 A 8 1.51 9 LEU 114 A . ? LEU 114 A PRO 115 A ? PRO 115 A 9 1.79 10 LEU 114 A . ? LEU 114 A PRO 115 A ? PRO 115 A 10 0.86 11 LEU 114 A . ? LEU 114 A PRO 115 A ? PRO 115 A 11 -0.05 12 LEU 114 A . ? LEU 114 A PRO 115 A ? PRO 115 A 12 1.28 13 LEU 114 A . ? LEU 114 A PRO 115 A ? PRO 115 A 13 -0.83 14 LEU 114 A . ? LEU 114 A PRO 115 A ? PRO 115 A 14 0.97 15 LEU 114 A . ? LEU 114 A PRO 115 A ? PRO 115 A 15 0.31 16 LEU 114 A . ? LEU 114 A PRO 115 A ? PRO 115 A 16 0.70 17 LEU 114 A . ? LEU 114 A PRO 115 A ? PRO 115 A 17 0.15 18 LEU 114 A . ? LEU 114 A PRO 115 A ? PRO 115 A 18 0.46 19 LEU 114 A . ? LEU 114 A PRO 115 A ? PRO 115 A 19 1.21 20 LEU 114 A . ? LEU 114 A PRO 115 A ? PRO 115 A 20 1.07 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? parallel B 2 3 ? parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 20 ? LYS A 21 ? LEU A 20 LYS A 21 A 2 THR A 27 ? ARG A 28 ? THR A 27 ARG A 28 B 1 VAL A 93 ? ARG A 96 ? VAL A 93 ARG A 96 B 2 PHE A 69 ? SER A 75 ? PHE A 69 SER A 75 B 3 VAL A 37 ? THR A 43 ? VAL A 37 THR A 43 B 4 SER A 116 ? ASN A 121 ? SER A 116 ASN A 121 B 5 GLU A 125 ? ARG A 129 ? GLU A 125 ARG A 129 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 20 ? N LEU A 20 O ARG A 28 ? O ARG A 28 B 1 2 O VAL A 95 ? O VAL A 95 N GLN A 73 ? N GLN A 73 B 2 3 O ILE A 74 ? O ILE A 74 N ASP A 41 ? N ASP A 41 B 3 4 N PHE A 42 ? N PHE A 42 O SER A 116 ? O SER A 116 B 4 5 N LEU A 119 ? N LEU A 119 O ALA A 128 ? O ALA A 128 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HB3 A LEU 30 ? ? HD22 A ASN 124 ? ? 1.34 2 1 OD1 A ASP 41 ? ? HE2 A HIS 53 ? ? 1.54 3 1 HZ1 A LYS 36 ? ? OE1 A GLU 70 ? ? 1.56 4 1 OE1 A GLU 80 ? ? HZ1 A LYS 84 ? ? 1.56 5 1 OD1 A ASP 79 ? ? HD1 A HIS 81 ? ? 1.57 6 1 HZ1 A LYS 141 ? ? OE2 A GLU 145 ? ? 1.58 7 1 HZ1 A LYS 11 ? ? OE2 A GLU 12 ? ? 1.59 8 1 OE1 A GLU 138 ? ? HZ3 A LYS 141 ? ? 1.59 9 1 H2 A MET 1 ? ? OD2 A ASP 17 ? ? 1.59 10 2 HD3 A LYS 36 ? ? HB2 A GLU 70 ? ? 1.15 11 2 HB3 A LEU 119 ? ? HB2 A SER 127 ? ? 1.34 12 2 OD1 A ASP 41 ? ? HE2 A HIS 53 ? ? 1.53 13 2 HZ2 A LYS 36 ? ? OE1 A GLU 70 ? ? 1.56 14 2 OE1 A GLU 7 ? ? HZ2 A LYS 9 ? ? 1.56 15 2 OE2 A GLU 7 ? ? HZ2 A LYS 11 ? ? 1.58 16 3 OD1 A ASP 41 ? ? HE2 A HIS 53 ? ? 1.54 17 3 HZ3 A LYS 36 ? ? OE2 A GLU 70 ? ? 1.56 18 3 OE2 A GLU 145 ? ? HD1 A HIS 152 ? ? 1.58 19 3 OE1 A GLU 138 ? ? HZ2 A LYS 142 ? ? 1.60 20 4 HB3 A LEU 119 ? ? HB2 A SER 127 ? ? 1.32 21 4 OE1 A GLU 138 ? ? HZ3 A LYS 142 ? ? 1.54 22 4 HZ2 A LYS 36 ? ? OE1 A GLU 70 ? ? 1.55 23 4 OD1 A ASP 41 ? ? HE2 A HIS 53 ? ? 1.56 24 5 OD1 A ASP 41 ? ? HE2 A HIS 53 ? ? 1.53 25 5 HZ1 A LYS 11 ? ? OE2 A GLU 125 ? ? 1.56 26 6 HZ3 A LYS 36 ? ? OE1 A GLU 70 ? ? 1.53 27 6 OE1 A GLU 138 ? ? HZ3 A LYS 142 ? ? 1.55 28 6 HZ1 A LYS 63 ? ? OD2 A ASP 137 ? ? 1.56 29 6 OE2 A GLU 80 ? ? HZ3 A LYS 84 ? ? 1.57 30 7 OD1 A ASP 41 ? ? HE2 A HIS 53 ? ? 1.54 31 7 H1 A MET 1 ? ? OE1 A GLU 4 ? ? 1.56 32 7 OD2 A ASP 22 ? ? HZ1 A LYS 24 ? ? 1.58 33 7 OE2 A GLU 138 ? ? HZ1 A LYS 142 ? ? 1.59 34 7 OD1 A ASP 79 ? ? H A PHE 82 ? ? 1.60 35 8 HZ2 A LYS 11 ? ? OE2 A GLU 125 ? ? 1.55 36 8 OE1 A GLU 80 ? ? HH22 A ARG 96 ? ? 1.58 37 8 HZ3 A LYS 36 ? ? OE1 A GLU 70 ? ? 1.58 38 8 OE2 A GLU 145 ? ? HD1 A HIS 151 ? ? 1.59 39 8 HZ1 A LYS 63 ? ? OD2 A ASP 137 ? ? 1.60 40 8 OD1 A ASP 41 ? ? HE2 A HIS 53 ? ? 1.60 41 9 OD1 A ASP 41 ? ? HE2 A HIS 53 ? ? 1.51 42 9 HZ1 A LYS 36 ? ? OE1 A GLU 70 ? ? 1.54 43 9 H3 A MET 1 ? ? OE1 A GLU 4 ? ? 1.57 44 9 OE2 A GLU 80 ? ? HZ2 A LYS 84 ? ? 1.58 45 9 OE1 A GLU 138 ? ? HZ1 A LYS 141 ? ? 1.59 46 10 HH A TYR 45 ? ? HD11 A LEU 90 ? ? 1.15 47 10 HG A SER 75 ? ? OD2 A ASP 77 ? ? 1.56 48 11 HA2 A GLY 130 ? ? HG12 A ILE 133 ? ? 1.29 49 11 HH21 A ARG 58 ? ? HD3 A PRO 91 ? ? 1.30 50 11 OD1 A ASP 41 ? ? HE2 A HIS 53 ? ? 1.51 51 11 HZ3 A LYS 134 ? ? OD1 A ASP 135 ? ? 1.55 52 11 HZ1 A LYS 36 ? ? OE1 A GLU 70 ? ? 1.56 53 11 H1 A MET 1 ? ? OE1 A GLU 4 ? ? 1.58 54 11 OE2 A GLU 125 ? ? HE2 A HIS 148 ? ? 1.59 55 12 HD1 A TYR 45 ? ? HB3 A SER 75 ? ? 1.11 56 12 HB3 A LEU 119 ? ? HB2 A SER 127 ? ? 1.33 57 12 OD1 A ASP 41 ? ? HE2 A HIS 53 ? ? 1.56 58 12 HZ2 A LYS 134 ? ? OD1 A ASP 135 ? ? 1.57 59 12 OD1 A ASP 8 ? ? HZ2 A LYS 9 ? ? 1.59 60 13 HD11 A LEU 23 ? ? HA A ASP 88 ? ? 1.22 61 13 OD1 A ASP 41 ? ? HE2 A HIS 53 ? ? 1.53 62 13 HZ2 A LYS 36 ? ? OE1 A GLU 70 ? ? 1.56 63 13 OD1 A ASP 79 ? ? HD1 A HIS 81 ? ? 1.57 64 13 HH22 A ARG 28 ? ? OD1 A ASP 32 ? ? 1.59 65 13 OE2 A GLU 80 ? ? HZ2 A LYS 84 ? ? 1.59 66 13 HZ3 A LYS 63 ? ? OD2 A ASP 137 ? ? 1.60 67 14 HG21 A ILE 15 ? ? H A LEU 126 ? ? 1.23 68 14 HB3 A LEU 119 ? ? HB2 A SER 127 ? ? 1.30 69 14 HZ3 A LYS 9 ? ? OE2 A GLU 12 ? ? 1.56 70 14 HZ2 A LYS 36 ? ? OE1 A GLU 70 ? ? 1.56 71 14 OD1 A ASP 41 ? ? HE2 A HIS 53 ? ? 1.57 72 14 OE2 A GLU 80 ? ? HZ2 A LYS 84 ? ? 1.57 73 15 OD1 A ASP 41 ? ? HE2 A HIS 53 ? ? 1.56 74 15 OE2 A GLU 80 ? ? HZ2 A LYS 84 ? ? 1.58 75 15 HZ1 A LYS 24 ? ? OD1 A ASP 88 ? ? 1.58 76 15 OD2 A ASP 41 ? ? HG1 A THR 43 ? ? 1.59 77 15 HZ2 A LYS 134 ? ? OD1 A ASP 135 ? ? 1.60 78 16 H1 A MET 1 ? ? OE2 A GLU 4 ? ? 1.51 79 16 OE1 A GLU 4 ? ? HZ3 A LYS 34 ? ? 1.55 80 16 HZ1 A LYS 141 ? ? OE1 A GLU 145 ? ? 1.58 81 16 OE1 A GLU 59 ? ? HZ1 A LYS 63 ? ? 1.59 82 17 HB3 A LEU 119 ? ? HB2 A SER 127 ? ? 1.35 83 17 OD1 A ASP 41 ? ? HE2 A HIS 53 ? ? 1.54 84 17 HZ3 A LYS 36 ? ? OE1 A GLU 70 ? ? 1.54 85 18 HA A ALA 139 ? ? HE2 A LYS 142 ? ? 1.21 86 18 OE2 A GLU 138 ? ? HZ3 A LYS 141 ? ? 1.57 87 18 OD1 A ASP 41 ? ? HG1 A THR 43 ? ? 1.57 88 18 OE1 A GLU 145 ? ? HE2 A HIS 150 ? ? 1.60 89 18 OE1 A GLU 80 ? ? HZ3 A LYS 84 ? ? 1.60 90 19 OD1 A ASP 41 ? ? HE2 A HIS 53 ? ? 1.54 91 20 OD1 A ASP 41 ? ? HE2 A HIS 53 ? ? 1.55 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 8 ? ? 173.31 -40.16 2 1 ILE A 10 ? ? 63.00 -90.90 3 1 ASN A 46 ? ? 177.45 -39.07 4 1 THR A 112 ? ? 71.77 -53.72 5 1 ASN A 113 ? ? -67.24 -80.04 6 1 LEU A 114 ? ? 67.41 143.19 7 1 ALA A 128 ? ? 178.95 173.04 8 1 ASP A 135 ? ? -143.43 41.40 9 1 HIS A 150 ? ? -175.98 -164.90 10 2 SER A 2 ? ? -151.96 -67.42 11 2 LEU A 3 ? ? -153.46 68.06 12 2 PRO A 6 ? ? -76.86 -131.91 13 2 LYS A 9 ? ? 175.61 125.09 14 2 ILE A 10 ? ? -49.99 103.99 15 2 LYS A 11 ? ? 153.84 4.70 16 2 ILE A 15 ? ? 42.50 -159.83 17 2 ASN A 46 ? ? 177.14 -50.03 18 2 SER A 66 ? ? 71.61 -35.68 19 2 ASP A 77 ? ? -73.41 -77.67 20 2 ALA A 101 ? ? 77.81 -16.11 21 2 LEU A 126 ? ? -59.56 107.66 22 2 ASP A 135 ? ? 69.22 117.53 23 2 HIS A 149 ? ? 179.35 145.21 24 2 HIS A 150 ? ? 67.47 111.70 25 3 LYS A 9 ? ? -125.62 -154.72 26 3 ILE A 10 ? ? 63.78 -77.43 27 3 LYS A 11 ? ? -158.45 -14.29 28 3 ASP A 22 ? ? -69.06 -177.00 29 3 LYS A 34 ? ? -57.26 101.74 30 3 TYR A 45 ? ? -105.98 78.44 31 3 ASN A 46 ? ? -163.15 16.82 32 3 SER A 66 ? ? 71.50 -38.43 33 3 ASP A 79 ? ? -162.89 109.36 34 3 TRP A 92 ? ? -102.16 -169.28 35 3 ASN A 110 ? ? 48.13 29.03 36 3 HIS A 150 ? ? -68.16 99.86 37 4 PRO A 6 ? ? -75.77 -164.84 38 4 LYS A 11 ? ? 63.06 71.91 39 4 SER A 14 ? ? 68.14 -53.15 40 4 ASN A 46 ? ? 172.95 -32.33 41 4 ARG A 122 ? ? -73.88 29.68 42 4 ASN A 124 ? ? 69.28 62.78 43 4 ASP A 135 ? ? -173.05 116.48 44 4 HIS A 150 ? ? -174.70 95.84 45 5 ILE A 5 ? ? 62.81 88.08 46 5 LYS A 9 ? ? 68.63 -75.50 47 5 ILE A 10 ? ? -148.94 30.05 48 5 ALA A 13 ? ? 68.23 -71.35 49 5 SER A 14 ? ? 70.23 -15.93 50 5 ASN A 46 ? ? 177.69 -37.81 51 5 ASN A 110 ? ? 59.53 79.88 52 5 ASN A 113 ? ? -170.11 127.52 53 5 ARG A 122 ? ? -66.86 4.68 54 5 ASP A 135 ? ? -161.36 110.43 55 5 HIS A 147 ? ? 60.87 -89.53 56 5 HIS A 148 ? ? 62.18 -78.45 57 5 HIS A 149 ? ? -153.63 24.70 58 6 GLU A 7 ? ? 48.96 -171.75 59 6 ASP A 8 ? ? -159.38 14.57 60 6 LYS A 9 ? ? -137.84 -146.26 61 6 LYS A 11 ? ? -51.43 109.60 62 6 ASN A 46 ? ? -178.13 -35.19 63 6 ASN A 110 ? ? 75.42 -5.28 64 6 ASN A 113 ? ? -113.38 -100.89 65 6 LEU A 114 ? ? 67.93 154.68 66 6 ASP A 135 ? ? 69.54 116.30 67 6 HIS A 147 ? ? 60.33 -167.59 68 6 HIS A 149 ? ? -169.59 100.29 69 6 HIS A 151 ? ? -178.77 -44.81 70 7 PRO A 6 ? ? -71.27 -168.72 71 7 LYS A 9 ? ? -139.25 -143.82 72 7 ALA A 13 ? ? 40.36 87.22 73 7 ASN A 46 ? ? 177.90 21.68 74 7 GLN A 67 ? ? -91.10 -61.97 75 7 TRP A 92 ? ? -105.28 -163.26 76 7 THR A 112 ? ? 71.26 -56.02 77 7 ARG A 122 ? ? -63.97 1.57 78 7 ASP A 135 ? ? -166.00 116.75 79 7 HIS A 147 ? ? 71.52 -8.04 80 8 LYS A 11 ? ? -174.65 56.69 81 8 ASN A 46 ? ? 176.10 -27.56 82 8 ASN A 110 ? ? 62.60 78.38 83 8 GLU A 131 ? ? 71.84 -40.48 84 8 LYS A 134 ? ? 74.29 -58.47 85 8 HIS A 150 ? ? 72.06 140.88 86 8 HIS A 151 ? ? 75.94 -58.03 87 9 SER A 2 ? ? -143.05 -79.50 88 9 LEU A 3 ? ? -162.31 48.62 89 9 LYS A 34 ? ? -61.17 99.83 90 9 ASN A 46 ? ? 174.79 -30.55 91 9 ALA A 101 ? ? 75.19 -32.78 92 9 TYR A 102 ? ? -86.28 37.04 93 9 LYS A 134 ? ? 48.45 -86.51 94 9 HIS A 150 ? ? -178.25 -65.02 95 9 HIS A 151 ? ? 166.15 -43.50 96 10 LYS A 11 ? ? 76.18 77.92 97 10 ASN A 46 ? ? 172.51 -25.59 98 10 ASN A 110 ? ? 58.70 77.68 99 10 ASN A 113 ? ? 174.84 169.83 100 10 HIS A 149 ? ? -51.92 107.30 101 11 SER A 2 ? ? -116.57 -150.02 102 11 PRO A 6 ? ? -72.55 -132.70 103 11 LYS A 9 ? ? 44.90 130.91 104 11 ILE A 10 ? ? 52.68 -107.50 105 11 LYS A 11 ? ? -156.93 83.05 106 11 GLU A 12 ? ? -91.86 -92.87 107 11 SER A 14 ? ? -90.21 -158.66 108 11 TYR A 45 ? ? -67.72 84.77 109 11 ASN A 46 ? ? 174.04 -35.65 110 11 ASP A 77 ? ? -65.89 -73.91 111 11 ASN A 110 ? ? 90.12 23.20 112 11 THR A 112 ? ? -155.10 20.54 113 11 ASN A 113 ? ? -146.01 -62.00 114 11 LEU A 114 ? ? 69.95 169.77 115 11 ARG A 122 ? ? 49.80 -86.27 116 11 ASN A 123 ? ? -97.56 30.54 117 11 HIS A 147 ? ? 77.41 -6.95 118 11 HIS A 149 ? ? 70.92 -9.20 119 11 HIS A 151 ? ? -92.10 -93.28 120 12 SER A 2 ? ? -160.14 -78.49 121 12 GLU A 7 ? ? -85.67 46.07 122 12 LYS A 9 ? ? 62.37 -172.00 123 12 ILE A 10 ? ? 64.90 -100.96 124 12 LYS A 11 ? ? -157.07 8.12 125 12 ALA A 13 ? ? 57.34 -99.42 126 12 ASN A 46 ? ? -176.25 -38.55 127 12 ALA A 101 ? ? 168.54 -29.74 128 12 ASN A 110 ? ? 80.77 -8.81 129 12 ASN A 124 ? ? 63.64 60.68 130 12 LEU A 126 ? ? -57.58 109.04 131 12 HIS A 148 ? ? -167.37 72.36 132 12 HIS A 149 ? ? 177.70 -35.75 133 12 HIS A 150 ? ? -113.66 -164.64 134 13 LYS A 11 ? ? -168.88 25.79 135 13 ALA A 13 ? ? 60.45 100.79 136 13 ASN A 46 ? ? 173.94 -36.21 137 13 LEU A 76 ? ? -101.56 43.29 138 13 ASP A 77 ? ? -77.48 -169.76 139 13 ASP A 79 ? ? -162.64 115.14 140 13 ALA A 101 ? ? 74.35 -29.06 141 13 ASN A 110 ? ? 62.42 67.55 142 13 ASN A 113 ? ? -172.44 129.57 143 13 GLU A 145 ? ? -72.11 -82.88 144 13 HIS A 147 ? ? -175.81 137.97 145 13 HIS A 149 ? ? -159.15 17.85 146 13 HIS A 150 ? ? -170.53 -74.34 147 14 PRO A 6 ? ? -57.60 -129.19 148 14 LYS A 9 ? ? -144.07 25.92 149 14 LYS A 11 ? ? -160.76 -10.46 150 14 GLU A 12 ? ? 64.41 109.21 151 14 ILE A 15 ? ? -99.17 -159.77 152 14 ASN A 46 ? ? 178.10 -27.17 153 14 SER A 66 ? ? 70.06 -35.04 154 14 TRP A 92 ? ? -101.17 -169.84 155 14 ASN A 110 ? ? 56.47 72.47 156 14 LEU A 126 ? ? -56.52 107.21 157 14 ALA A 128 ? ? 179.96 172.74 158 14 ASP A 135 ? ? 64.93 106.11 159 14 HIS A 147 ? ? 73.69 -60.82 160 14 HIS A 149 ? ? 71.33 145.55 161 14 HIS A 150 ? ? -177.56 -66.84 162 15 ILE A 15 ? ? -171.07 147.49 163 15 ASN A 46 ? ? 174.35 -33.47 164 15 ASP A 77 ? ? -61.42 -71.91 165 15 ASP A 79 ? ? -163.10 100.47 166 15 ALA A 101 ? ? 80.42 -31.53 167 15 TYR A 102 ? ? -85.01 37.34 168 15 HIS A 147 ? ? -159.67 64.83 169 15 HIS A 148 ? ? -145.25 21.70 170 15 HIS A 150 ? ? 72.90 -60.83 171 16 ASP A 8 ? ? -163.04 94.46 172 16 LYS A 9 ? ? 67.36 -79.02 173 16 ASN A 46 ? ? 179.98 -39.38 174 16 ASN A 110 ? ? 63.54 75.32 175 16 ASN A 113 ? ? -170.57 133.10 176 16 HIS A 149 ? ? -154.22 80.78 177 16 HIS A 150 ? ? -151.88 -70.96 178 17 GLU A 7 ? ? -156.01 -89.88 179 17 ASP A 8 ? ? -88.02 47.37 180 17 GLU A 12 ? ? -100.82 -161.05 181 17 TYR A 45 ? ? -66.71 87.77 182 17 ASN A 46 ? ? 177.82 -35.51 183 17 SER A 66 ? ? 72.82 -35.70 184 17 ASP A 77 ? ? -50.31 -73.77 185 17 TRP A 92 ? ? -122.55 -153.64 186 17 ALA A 101 ? ? 78.20 -15.81 187 17 ASN A 110 ? ? 131.98 -43.31 188 17 VAL A 111 ? ? 13.39 -86.51 189 17 THR A 112 ? ? 70.98 -52.99 190 18 ASP A 8 ? ? -60.89 -84.25 191 18 ASP A 22 ? ? -76.68 -167.13 192 18 ASN A 46 ? ? 178.25 -34.69 193 18 SER A 66 ? ? 77.73 -34.76 194 18 ARG A 122 ? ? -69.78 27.82 195 18 ASP A 135 ? ? -144.87 48.93 196 18 HIS A 147 ? ? 76.14 -57.90 197 18 HIS A 148 ? ? -175.11 -64.53 198 18 HIS A 150 ? ? -177.06 45.16 199 19 SER A 2 ? ? -150.04 -73.49 200 19 PRO A 6 ? ? -48.97 159.80 201 19 ASP A 8 ? ? -163.99 12.54 202 19 ALA A 13 ? ? -177.42 -25.63 203 19 ASN A 46 ? ? -178.75 -35.47 204 19 SER A 66 ? ? 70.89 -10.95 205 19 TRP A 92 ? ? -100.77 -167.00 206 19 ALA A 101 ? ? 77.55 -5.17 207 19 ASN A 113 ? ? -176.50 135.53 208 19 ASP A 135 ? ? 67.70 102.31 209 19 HIS A 147 ? ? -68.47 96.78 210 19 HIS A 149 ? ? -165.26 19.40 211 19 HIS A 150 ? ? -135.10 -159.82 212 20 LEU A 3 ? ? -178.01 -29.51 213 20 ASP A 8 ? ? -69.48 25.43 214 20 LYS A 9 ? ? 65.66 -156.34 215 20 ILE A 10 ? ? 71.70 -71.23 216 20 ALA A 13 ? ? -162.42 29.00 217 20 ASN A 46 ? ? -179.67 -35.47 218 20 ASP A 77 ? ? 44.13 -111.33 219 20 TRP A 92 ? ? -104.58 -167.91 220 20 ALA A 101 ? ? 167.24 -33.90 221 20 ASN A 113 ? ? -169.50 119.72 222 20 LYS A 134 ? ? 72.09 -55.30 223 20 HIS A 147 ? ? 62.15 -0.45 224 20 HIS A 148 ? ? 69.27 -74.73 # _pdbx_SG_project.full_name_of_center 'New York Structural Genomics Research Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NYSGRC _pdbx_SG_project.project_name PSI:Biology # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria '20 structures for lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LRT _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LRT _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1 mM [U-13C; U-15N] uncharacterized thioredoxin-like protein, 20 mM sodium phosphate, 50 mM sodium chloride, 1 mM DTT, 1 mM EDTA, 90% H2O, 10% D2O ; 1 '90% H2O/10% D2O' ;1 mM [U-13C; U-15N] uncharacterized thioredoxin-like protein, 20 mM sodium phosphate, 50 mM sodium chloride, 1 mM DTT, 1 mM EDTA, 100% D2O ; 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'uncharacterized thioredoxin-like protein-1' 1 ? mM '[U-13C; U-15N]' 1 'sodium phosphate-2' 20 ? mM ? 1 'sodium chloride-3' 50 ? mM ? 1 DTT-4 1 ? mM ? 1 EDTA-5 1 ? mM ? 1 'uncharacterized thioredoxin-like protein-6' 1 ? mM '[U-13C; U-15N]' 2 'sodium phosphate-7' 20 ? mM ? 2 'sodium chloride-8' 50 ? mM ? 2 DTT-9 1 ? mM ? 2 EDTA-10 1 ? mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 70 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '15N HSQC' 1 2 1 '15N NOESY-HSQC' 1 3 2 '13C CT-HSQC' 1 4 2 'aromatic 13C CT-HSQC' 1 5 2 '13C NOESY-HSQC' 1 6 2 '13C aromatic NOESY-HSQC' 1 7 1 HNCO 1 8 1 HNCACO 1 9 1 HNCA 1 10 1 HNCOCA 1 11 1 HNCACB 1 12 1 CBCACONH # _pdbx_nmr_details.entry_id 2LRT _pdbx_nmr_details.text 'All 3Ds were collected as NUS experiments using the MDDNMR or MDDgui approach' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LRT _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 43 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2861 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 676 _pdbx_nmr_constraints.NOE_long_range_total_count 841 _pdbx_nmr_constraints.NOE_medium_range_total_count 603 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 672 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 11 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 84 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 84 # _pdbx_nmr_refine.entry_id 2LRT _pdbx_nmr_refine.method 'simulating annealing' _pdbx_nmr_refine.details 'Refinement in a box of water' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger A. T. et.al.' refinement CNS ? 1 CCPN 'chemical shift assignment' CCPN 2.1.5 2 CCPN 'peak picking' CCPN 2.1.5 3 Varian collection VNMR 2.2D 4 'Bruker Biospin' collection TopSpin 2.1 5 '(MDDNMR) Orekhov, Jaravine, Kazimierczuk' collection MddNMR 2.0 6 '(MDDNMR) Orekhov, Jaravine, Kazimierczuk' processing MddNMR 2.0 7 '(MDDGUI) Lemak, Gutmanas, Chitayat, Karra, Fares, Sunnerhagen, Arrowsmith' collection MDDGUI 1.0 8 '(MDDGUI) Lemak, Gutmanas, Chitayat, Karra, Fares, Sunnerhagen, Arrowsmith' processing MDDGUI 1.0 9 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 5.4 10 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian Inova' 700 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2LRT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_