data_2LS8 # _entry.id 2LS8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LS8 pdb_00002ls8 10.2210/pdb2ls8/pdb RCSB RCSB102768 ? ? BMRB 18415 ? 10.13018/BMR18415 WWPDB D_1000102768 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-05-09 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' 6 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_ref_seq_dif 6 3 'Structure model' chem_comp_atom 7 3 'Structure model' chem_comp_bond 8 3 'Structure model' database_2 9 3 'Structure model' pdbx_entry_details 10 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 2 'Structure model' '_struct_ref_seq_dif.details' 7 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LS8 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-04-23 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified NYSGRC-020344 TargetTrack . unspecified 18415 BMRB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Harris, R.' 1 'Gaudette, J.' 2 'Bandaranayake, A.D.' 3 'Banu, R.' 4 'Bonanno, J.B.' 5 'Calarese, D.A.' 6 'Celikgil, A.' 7 'Chamala, S.' 8 'Chan, M.K.' 9 'Chaparro, R.' 10 'Evans, B.' 11 'Garforth, S.' 12 'Gizzi, A.' 13 'Hillerich, B.' 14 'Kar, A.' 15 'Lafleur, J.' 16 'Lim, S.' 17 'Love, J.' 18 'Matikainen, B.' 19 'Patel, H.' 20 'Seidel, R.D.' 21 'Smith, B.' 22 'Stead, M.' 23 'Girvin, M.E.' 24 'Almo, S.C.' 25 'New York Structural Genomics Research Consortium (NYSGRC)' 26 # _citation.id primary _citation.title 'Solution structure of human C-type lectin domain family 4 member D' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Harris, R.' 1 ? primary 'Gaudette, J.' 2 ? primary 'Bandaranayake, A.D.' 3 ? primary 'Banu, R.' 4 ? primary 'Bonanno, J.B.' 5 ? primary 'Calarese, D.A.' 6 ? primary 'Celikgil, A.' 7 ? primary 'Chamala, S.' 8 ? primary 'Chan, M.K.' 9 ? primary 'Chaparro, R.' 10 ? primary 'Evans, B.' 11 ? primary 'Garforth, S.' 12 ? primary 'Gizzi, A.' 13 ? primary 'Hillerich, B.' 14 ? primary 'Kar, A.' 15 ? primary 'Lafleur, J.' 16 ? primary 'Lim, S.' 17 ? primary 'Love, J.' 18 ? primary 'Matikainen, B.' 19 ? primary 'Patel, H.' 20 ? primary 'Seidel, R.D.' 21 ? primary 'Smith, B.' 22 ? primary 'Stead, M.' 23 ? primary 'Girvin, M.E.' 24 ? primary 'Almo, S.C.' 25 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'C-type lectin domain family 4 member D' _entity.formula_weight 18610.725 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 84-215' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'C-type lectin superfamily member 8, C-type lectin-like receptor 6, CLEC-6' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTP FNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLNAENLYFQSHHHHHHWSHPQFEK ; _entity_poly.pdbx_seq_one_letter_code_can ;MVCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTP FNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLNAENLYFQSHHHHHHWSHPQFEK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NYSGRC-020344 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 CYS n 1 4 PRO n 1 5 ILE n 1 6 ASP n 1 7 TRP n 1 8 ARG n 1 9 ALA n 1 10 PHE n 1 11 GLN n 1 12 SER n 1 13 ASN n 1 14 CYS n 1 15 TYR n 1 16 PHE n 1 17 PRO n 1 18 LEU n 1 19 THR n 1 20 ASP n 1 21 ASN n 1 22 LYS n 1 23 THR n 1 24 TRP n 1 25 ALA n 1 26 GLU n 1 27 SER n 1 28 GLU n 1 29 ARG n 1 30 ASN n 1 31 CYS n 1 32 SER n 1 33 GLY n 1 34 MET n 1 35 GLY n 1 36 ALA n 1 37 HIS n 1 38 LEU n 1 39 MET n 1 40 THR n 1 41 ILE n 1 42 SER n 1 43 THR n 1 44 GLU n 1 45 ALA n 1 46 GLU n 1 47 GLN n 1 48 ASN n 1 49 PHE n 1 50 ILE n 1 51 ILE n 1 52 GLN n 1 53 PHE n 1 54 LEU n 1 55 ASP n 1 56 ARG n 1 57 ARG n 1 58 LEU n 1 59 SER n 1 60 TYR n 1 61 PHE n 1 62 LEU n 1 63 GLY n 1 64 LEU n 1 65 ARG n 1 66 ASP n 1 67 GLU n 1 68 ASN n 1 69 ALA n 1 70 LYS n 1 71 GLY n 1 72 GLN n 1 73 TRP n 1 74 ARG n 1 75 TRP n 1 76 VAL n 1 77 ASP n 1 78 GLN n 1 79 THR n 1 80 PRO n 1 81 PHE n 1 82 ASN n 1 83 PRO n 1 84 ARG n 1 85 ARG n 1 86 VAL n 1 87 PHE n 1 88 TRP n 1 89 HIS n 1 90 LYS n 1 91 ASN n 1 92 GLU n 1 93 PRO n 1 94 ASP n 1 95 ASN n 1 96 SER n 1 97 GLN n 1 98 GLY n 1 99 GLU n 1 100 ASN n 1 101 CYS n 1 102 VAL n 1 103 VAL n 1 104 LEU n 1 105 VAL n 1 106 TYR n 1 107 ASN n 1 108 GLN n 1 109 ASP n 1 110 LYS n 1 111 TRP n 1 112 ALA n 1 113 TRP n 1 114 ASN n 1 115 ASP n 1 116 VAL n 1 117 PRO n 1 118 CYS n 1 119 ASN n 1 120 PHE n 1 121 GLU n 1 122 ALA n 1 123 SER n 1 124 ARG n 1 125 ILE n 1 126 CYS n 1 127 LYS n 1 128 ILE n 1 129 PRO n 1 130 GLY n 1 131 THR n 1 132 THR n 1 133 LEU n 1 134 ASN n 1 135 ALA n 1 136 GLU n 1 137 ASN n 1 138 LEU n 1 139 TYR n 1 140 PHE n 1 141 GLN n 1 142 SER n 1 143 HIS n 1 144 HIS n 1 145 HIS n 1 146 HIS n 1 147 HIS n 1 148 HIS n 1 149 TRP n 1 150 SER n 1 151 HIS n 1 152 PRO n 1 153 GLN n 1 154 PHE n 1 155 GLU n 1 156 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CLEC4D, CLECSF8, MCL' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'modified pET23a' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 MET 34 34 34 MET MET A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 TRP 73 73 73 TRP TRP A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 TRP 75 75 75 TRP TRP A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 TRP 88 88 88 TRP TRP A . n A 1 89 HIS 89 89 89 HIS HIS A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 CYS 101 101 101 CYS CYS A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 TRP 111 111 111 TRP TRP A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 TRP 113 113 113 TRP TRP A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 CYS 118 118 118 CYS CYS A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 CYS 126 126 126 CYS CYS A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 ASN 134 134 134 ASN ASN A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 PHE 140 140 140 PHE PHE A . n A 1 141 GLN 141 141 141 GLN GLN A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 HIS 143 143 ? ? ? A . n A 1 144 HIS 144 144 ? ? ? A . n A 1 145 HIS 145 145 ? ? ? A . n A 1 146 HIS 146 146 ? ? ? A . n A 1 147 HIS 147 147 ? ? ? A . n A 1 148 HIS 148 148 ? ? ? A . n A 1 149 TRP 149 149 ? ? ? A . n A 1 150 SER 150 150 ? ? ? A . n A 1 151 HIS 151 151 ? ? ? A . n A 1 152 PRO 152 152 ? ? ? A . n A 1 153 GLN 153 153 ? ? ? A . n A 1 154 PHE 154 154 ? ? ? A . n A 1 155 GLU 155 155 ? ? ? A . n A 1 156 LYS 156 156 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LS8 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LS8 _struct.title 'Solution structure of human C-type lectin domain family 4 member D' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LS8 _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' _struct_keywords.text 'STRUCTURAL GENOMICS, New York Structural Genomics Research Consortium, NYSGRC, PSI-Biology, IMMUNE SYSTEM' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CLC4D_HUMAN _struct_ref.pdbx_db_accession Q8WXI8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;CPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFN PRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN ; _struct_ref.pdbx_align_begin 84 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LS8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 134 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8WXI8 _struct_ref_seq.db_align_beg 84 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 215 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 134 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LS8 MET A 1 ? UNP Q8WXI8 ? ? 'expression tag' 1 1 1 2LS8 VAL A 2 ? UNP Q8WXI8 ? ? 'expression tag' 2 2 1 2LS8 ALA A 135 ? UNP Q8WXI8 ? ? 'expression tag' 135 3 1 2LS8 GLU A 136 ? UNP Q8WXI8 ? ? 'expression tag' 136 4 1 2LS8 ASN A 137 ? UNP Q8WXI8 ? ? 'expression tag' 137 5 1 2LS8 LEU A 138 ? UNP Q8WXI8 ? ? 'expression tag' 138 6 1 2LS8 TYR A 139 ? UNP Q8WXI8 ? ? 'expression tag' 139 7 1 2LS8 PHE A 140 ? UNP Q8WXI8 ? ? 'expression tag' 140 8 1 2LS8 GLN A 141 ? UNP Q8WXI8 ? ? 'expression tag' 141 9 1 2LS8 SER A 142 ? UNP Q8WXI8 ? ? 'expression tag' 142 10 1 2LS8 HIS A 143 ? UNP Q8WXI8 ? ? 'expression tag' 143 11 1 2LS8 HIS A 144 ? UNP Q8WXI8 ? ? 'expression tag' 144 12 1 2LS8 HIS A 145 ? UNP Q8WXI8 ? ? 'expression tag' 145 13 1 2LS8 HIS A 146 ? UNP Q8WXI8 ? ? 'expression tag' 146 14 1 2LS8 HIS A 147 ? UNP Q8WXI8 ? ? 'expression tag' 147 15 1 2LS8 HIS A 148 ? UNP Q8WXI8 ? ? 'expression tag' 148 16 1 2LS8 TRP A 149 ? UNP Q8WXI8 ? ? 'expression tag' 149 17 1 2LS8 SER A 150 ? UNP Q8WXI8 ? ? 'expression tag' 150 18 1 2LS8 HIS A 151 ? UNP Q8WXI8 ? ? 'expression tag' 151 19 1 2LS8 PRO A 152 ? UNP Q8WXI8 ? ? 'expression tag' 152 20 1 2LS8 GLN A 153 ? UNP Q8WXI8 ? ? 'expression tag' 153 21 1 2LS8 PHE A 154 ? UNP Q8WXI8 ? ? 'expression tag' 154 22 1 2LS8 GLU A 155 ? UNP Q8WXI8 ? ? 'expression tag' 155 23 1 2LS8 LYS A 156 ? UNP Q8WXI8 ? ? 'expression tag' 156 24 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 23 ? CYS A 31 ? THR A 23 CYS A 31 1 ? 9 HELX_P HELX_P2 2 THR A 43 ? ILE A 51 ? THR A 43 ILE A 51 1 ? 9 HELX_P HELX_P3 3 GLY A 130 ? LEU A 133 ? GLY A 130 LEU A 133 5 ? 4 HELX_P HELX_P4 4 ASN A 134 ? SER A 142 ? ASN A 134 SER A 142 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 14 SG ? ? A CYS 3 A CYS 14 1_555 ? ? ? ? ? ? ? 2.018 ? ? disulf2 disulf ? ? A CYS 31 SG ? ? ? 1_555 A CYS 126 SG ? ? A CYS 31 A CYS 126 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf3 disulf ? ? A CYS 101 SG ? ? ? 1_555 A CYS 118 SG ? ? A CYS 101 A CYS 118 1_555 ? ? ? ? ? ? ? 2.016 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 3 ? CYS A 14 ? CYS A 3 ? 1_555 CYS A 14 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 31 ? CYS A 126 ? CYS A 31 ? 1_555 CYS A 126 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 101 ? CYS A 118 ? CYS A 101 ? 1_555 CYS A 118 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 8 ? PHE A 10 ? ARG A 8 PHE A 10 A 2 ASN A 13 ? LYS A 22 ? ASN A 13 LYS A 22 A 3 ALA A 122 ? ILE A 128 ? ALA A 122 ILE A 128 A 4 SER A 59 ? ASP A 66 ? SER A 59 ASP A 66 A 5 ARG A 74 ? TRP A 75 ? ARG A 74 TRP A 75 B 1 HIS A 37 ? LEU A 38 ? HIS A 37 LEU A 38 B 2 ALA A 122 ? ILE A 128 ? ALA A 122 ILE A 128 B 3 SER A 59 ? ASP A 66 ? SER A 59 ASP A 66 B 4 ASN A 100 ? ASN A 107 ? ASN A 100 ASN A 107 B 5 LYS A 110 ? VAL A 116 ? LYS A 110 VAL A 116 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 8 ? N ARG A 8 O TYR A 15 ? O TYR A 15 A 2 3 N LEU A 18 ? N LEU A 18 O ARG A 124 ? O ARG A 124 A 3 4 O SER A 123 ? O SER A 123 N PHE A 61 ? N PHE A 61 A 4 5 N ARG A 65 ? N ARG A 65 O ARG A 74 ? O ARG A 74 B 1 2 N HIS A 37 ? N HIS A 37 O LYS A 127 ? O LYS A 127 B 2 3 O SER A 123 ? O SER A 123 N PHE A 61 ? N PHE A 61 B 3 4 N TYR A 60 ? N TYR A 60 O LEU A 104 ? O LEU A 104 B 4 5 N CYS A 101 ? N CYS A 101 O VAL A 116 ? O VAL A 116 # _pdbx_entry_details.entry_id 2LS8 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 67 ? ? HZ3 A LYS 70 ? ? 1.58 2 1 HG1 A THR 43 ? ? OE1 A GLU 46 ? ? 1.59 3 1 O A HIS 37 ? ? H A LYS 127 ? ? 1.60 4 2 OE2 A GLU 67 ? ? HZ2 A LYS 70 ? ? 1.57 5 2 OD2 A ASP 55 ? ? HH21 A ARG 57 ? ? 1.59 6 2 OD1 A ASP 66 ? ? HZ3 A LYS 70 ? ? 1.60 7 3 HD3 A LYS 22 ? ? HB3 A GLU 26 ? ? 1.32 8 3 OE1 A GLU 67 ? ? HZ2 A LYS 70 ? ? 1.55 9 3 OD2 A ASP 55 ? ? HH21 A ARG 57 ? ? 1.60 10 4 OD1 A ASP 66 ? ? HZ1 A LYS 70 ? ? 1.55 11 4 HZ2 A LYS 22 ? ? OE1 A GLU 26 ? ? 1.56 12 5 HB3 A ALA 69 ? ? HA2 A GLY 98 ? ? 1.32 13 6 HZ1 A LYS 22 ? ? OE2 A GLU 26 ? ? 1.59 14 6 OE1 A GLU 67 ? ? HZ3 A LYS 70 ? ? 1.59 15 7 OD2 A ASP 77 ? ? HZ3 A LYS 127 ? ? 1.56 16 7 HH21 A ARG 65 ? ? OE2 A GLU 99 ? ? 1.59 17 7 OD2 A ASP 55 ? ? HH21 A ARG 57 ? ? 1.60 18 8 OE2 A GLU 67 ? ? HZ1 A LYS 70 ? ? 1.57 19 8 HH12 A ARG 56 ? ? OD2 A ASP 109 ? ? 1.59 20 9 HG2 A GLU 67 ? ? HD2 A LYS 70 ? ? 1.33 21 9 OE2 A GLU 67 ? ? HZ2 A LYS 70 ? ? 1.58 22 9 H A SER 42 ? ? OE1 A GLU 46 ? ? 1.58 23 9 OE2 A GLU 46 ? ? HZ1 A LYS 127 ? ? 1.58 24 10 OD2 A ASP 20 ? ? HZ1 A LYS 22 ? ? 1.53 25 11 OE1 A GLU 67 ? ? HZ3 A LYS 70 ? ? 1.55 26 11 OD2 A ASP 55 ? ? HH21 A ARG 57 ? ? 1.59 27 12 HG A SER 27 ? ? HD13 A LEU 38 ? ? 1.30 28 13 HB3 A ASN 68 ? ? HZ3 A LYS 70 ? ? 1.26 29 13 HE2 A MET 39 ? ? HD12 A ILE 41 ? ? 1.33 30 13 HZ1 A LYS 90 ? ? OE2 A GLU 92 ? ? 1.53 31 13 OE1 A GLU 67 ? ? HZ1 A LYS 70 ? ? 1.59 32 14 OE2 A GLU 46 ? ? HZ2 A LYS 127 ? ? 1.54 33 14 O A GLY 130 ? ? HG1 A THR 131 ? ? 1.58 34 14 OE1 A GLU 67 ? ? HH22 A ARG 74 ? ? 1.59 35 14 OD2 A ASP 20 ? ? HZ3 A LYS 22 ? ? 1.59 36 14 HZ1 A LYS 90 ? ? OE2 A GLU 92 ? ? 1.59 37 15 HH12 A ARG 56 ? ? OD1 A ASP 109 ? ? 1.58 38 16 OE2 A GLU 67 ? ? HZ1 A LYS 70 ? ? 1.56 39 16 O A HIS 37 ? ? H A LYS 127 ? ? 1.59 40 17 OE2 A GLU 46 ? ? HZ1 A LYS 127 ? ? 1.56 41 17 HG A SER 96 ? ? OD2 A ASP 115 ? ? 1.56 42 17 OE2 A GLU 67 ? ? HZ2 A LYS 70 ? ? 1.56 43 17 OD2 A ASP 55 ? ? HH21 A ARG 57 ? ? 1.58 44 17 HH12 A ARG 65 ? ? OE1 A GLU 67 ? ? 1.59 45 17 O A ASN 21 ? ? HZ1 A LYS 22 ? ? 1.60 46 18 OD1 A ASP 20 ? ? HZ3 A LYS 22 ? ? 1.54 47 19 HB3 A HIS 89 ? ? HB2 A GLU 92 ? ? 1.30 48 19 H2 A MET 1 ? ? OD1 A ASP 6 ? ? 1.59 49 19 OE2 A GLU 67 ? ? HZ2 A LYS 70 ? ? 1.59 50 20 OE2 A GLU 46 ? ? HZ3 A LYS 127 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 5 ? ? 65.15 -98.11 2 1 GLN A 11 ? ? 60.02 -99.57 3 1 SER A 32 ? ? 75.86 -44.99 4 1 MET A 39 ? ? -53.85 102.33 5 1 ARG A 57 ? ? -162.47 -31.38 6 1 ASN A 68 ? ? 179.87 29.92 7 1 GLN A 72 ? ? -100.39 63.59 8 1 ASP A 77 ? ? -172.88 -59.54 9 1 GLN A 78 ? ? 163.34 -31.83 10 1 LYS A 90 ? ? 175.79 -159.21 11 1 ASP A 94 ? ? 55.17 -97.40 12 1 ASN A 95 ? ? 175.75 -8.73 13 2 GLN A 11 ? ? 67.64 -68.42 14 2 SER A 12 ? ? -145.88 -28.24 15 2 SER A 32 ? ? 75.25 -43.91 16 2 MET A 39 ? ? -52.92 99.40 17 2 ILE A 41 ? ? -55.65 106.08 18 2 ARG A 56 ? ? -79.05 20.21 19 2 GLU A 67 ? ? -74.45 -71.04 20 2 ASN A 68 ? ? -84.67 31.61 21 2 VAL A 76 ? ? 45.77 -80.72 22 2 ASP A 77 ? ? -96.33 -82.50 23 2 LYS A 90 ? ? 81.79 -5.59 24 2 GLU A 99 ? ? 63.20 88.58 25 2 ALA A 135 ? ? -91.27 41.60 26 3 ASP A 6 ? ? 176.68 -51.46 27 3 GLN A 11 ? ? 60.67 -89.11 28 3 SER A 32 ? ? 73.34 -44.92 29 3 MET A 39 ? ? -50.71 103.41 30 3 ILE A 41 ? ? -66.99 95.80 31 3 ALA A 69 ? ? 62.23 87.55 32 3 ASP A 77 ? ? -107.24 -168.78 33 3 PHE A 87 ? ? 66.70 -70.01 34 3 TRP A 88 ? ? 53.49 -158.49 35 3 LYS A 90 ? ? 171.11 -70.90 36 3 ASN A 91 ? ? -140.38 11.75 37 3 PRO A 93 ? ? -101.22 -151.90 38 3 ASN A 95 ? ? -134.67 -37.91 39 3 GLU A 99 ? ? -113.29 74.69 40 3 ALA A 135 ? ? -85.46 31.22 41 4 ASP A 6 ? ? 77.81 -33.79 42 4 GLN A 11 ? ? 58.89 -101.53 43 4 SER A 32 ? ? 80.04 -45.11 44 4 MET A 39 ? ? -40.02 98.68 45 4 ILE A 41 ? ? -59.40 100.72 46 4 ARG A 56 ? ? -90.23 38.82 47 4 ARG A 57 ? ? -142.15 -46.83 48 4 GLU A 67 ? ? -46.81 -78.24 49 4 ALA A 69 ? ? 55.35 70.87 50 4 ASP A 77 ? ? -123.89 -104.74 51 4 LYS A 90 ? ? -177.82 -59.80 52 4 PRO A 93 ? ? -95.82 -154.10 53 4 ASN A 95 ? ? -147.56 -34.66 54 4 SER A 96 ? ? -65.27 97.89 55 4 GLU A 99 ? ? 59.90 74.81 56 4 ASP A 109 ? ? 58.76 4.35 57 4 ALA A 112 ? ? -179.27 -179.40 58 4 ALA A 122 ? ? -162.30 -168.80 59 4 ALA A 135 ? ? -91.52 33.79 60 5 GLN A 11 ? ? 65.60 -73.26 61 5 ASN A 21 ? ? 70.08 116.19 62 5 SER A 32 ? ? 79.46 -43.68 63 5 ARG A 57 ? ? -160.33 -29.95 64 5 ALA A 69 ? ? 69.07 95.94 65 5 ASP A 77 ? ? -94.03 -158.06 66 5 PHE A 87 ? ? -110.37 72.14 67 5 ASP A 109 ? ? 73.68 -17.47 68 5 ALA A 135 ? ? -89.83 38.30 69 6 ASP A 6 ? ? -166.96 -42.61 70 6 GLN A 11 ? ? 66.03 -82.59 71 6 SER A 12 ? ? -152.19 8.64 72 6 SER A 32 ? ? 75.77 -48.48 73 6 MET A 39 ? ? -61.55 96.41 74 6 ALA A 69 ? ? 66.79 92.57 75 6 ASP A 77 ? ? -116.09 79.23 76 6 GLN A 78 ? ? 70.79 -50.00 77 6 PHE A 87 ? ? -115.65 74.50 78 6 HIS A 89 ? ? -89.97 -70.41 79 6 LYS A 90 ? ? 166.96 -30.12 80 6 SER A 96 ? ? -51.06 108.79 81 6 GLU A 99 ? ? 55.75 83.93 82 6 ALA A 135 ? ? -89.96 44.75 83 7 ASP A 6 ? ? 81.40 -18.51 84 7 GLN A 11 ? ? 61.44 -82.64 85 7 SER A 32 ? ? 73.59 -43.00 86 7 ILE A 41 ? ? -58.50 104.23 87 7 GLU A 67 ? ? -145.03 26.77 88 7 ASN A 68 ? ? -179.54 14.27 89 7 GLN A 78 ? ? 72.36 -12.31 90 7 PHE A 87 ? ? 68.44 -65.19 91 7 TRP A 88 ? ? 53.89 -169.06 92 7 LYS A 90 ? ? 83.56 -5.21 93 7 ASN A 91 ? ? -168.92 72.48 94 7 GLN A 97 ? ? -69.47 95.44 95 7 ASP A 109 ? ? 72.00 -3.04 96 7 THR A 131 ? ? 58.98 -12.07 97 8 GLN A 11 ? ? 67.68 -71.59 98 8 SER A 12 ? ? -145.88 13.53 99 8 SER A 32 ? ? 76.88 -33.94 100 8 MET A 39 ? ? -58.54 103.73 101 8 ARG A 57 ? ? -162.54 -29.32 102 8 GLU A 67 ? ? -145.02 -1.79 103 8 ASN A 68 ? ? -157.32 26.22 104 8 GLN A 78 ? ? 76.53 -19.72 105 8 LYS A 90 ? ? -154.65 -79.99 106 8 ASN A 91 ? ? -153.68 23.45 107 8 ASN A 95 ? ? -170.82 92.83 108 8 ASP A 109 ? ? 73.44 -28.30 109 8 ASN A 119 ? ? -94.66 53.21 110 8 THR A 131 ? ? -61.21 2.71 111 8 ALA A 135 ? ? -92.45 35.46 112 9 GLN A 11 ? ? 58.78 -96.51 113 9 SER A 32 ? ? 73.56 -45.79 114 9 MET A 39 ? ? -49.60 109.60 115 9 ARG A 57 ? ? -132.21 -56.36 116 9 ASN A 68 ? ? -161.42 71.30 117 9 ASP A 77 ? ? -50.89 -77.88 118 9 GLN A 78 ? ? -153.61 -18.07 119 9 ASN A 91 ? ? 160.58 -51.99 120 9 GLU A 92 ? ? 35.66 94.78 121 9 PRO A 93 ? ? -61.18 99.42 122 9 ALA A 135 ? ? -89.14 40.56 123 10 GLN A 11 ? ? 69.55 -61.98 124 10 SER A 12 ? ? -152.31 -25.83 125 10 SER A 32 ? ? 76.88 -46.54 126 10 MET A 39 ? ? -48.88 108.64 127 10 ARG A 57 ? ? -161.90 -30.93 128 10 ALA A 69 ? ? 62.27 84.74 129 10 GLN A 78 ? ? 69.36 -48.59 130 10 ARG A 85 ? ? -114.28 70.49 131 10 TRP A 88 ? ? 59.11 -165.02 132 10 LYS A 90 ? ? 173.27 -36.63 133 10 ASN A 95 ? ? 175.60 -44.80 134 10 ASP A 109 ? ? 72.82 -14.61 135 11 GLN A 11 ? ? 63.74 -81.25 136 11 SER A 32 ? ? 74.02 -40.15 137 11 ARG A 57 ? ? -154.16 -32.68 138 11 ASN A 68 ? ? -163.95 17.25 139 11 ASP A 77 ? ? -98.89 -80.79 140 11 GLN A 78 ? ? -160.14 -23.77 141 11 HIS A 89 ? ? -108.74 -166.25 142 11 ASN A 91 ? ? 61.45 76.57 143 11 ASN A 100 ? ? 78.27 118.16 144 11 ASP A 109 ? ? 59.55 17.79 145 11 THR A 131 ? ? 62.96 -14.46 146 12 PRO A 4 ? ? -48.48 150.20 147 12 GLN A 11 ? ? 63.73 -82.89 148 12 SER A 32 ? ? 78.98 -43.39 149 12 ASN A 68 ? ? 71.94 36.30 150 12 ALA A 69 ? ? 62.34 67.21 151 12 GLN A 78 ? ? 81.04 6.36 152 12 LYS A 90 ? ? 176.55 -75.39 153 12 ASP A 94 ? ? 67.57 -161.00 154 12 GLN A 97 ? ? -138.99 -157.32 155 12 GLU A 99 ? ? 72.30 61.98 156 12 ASP A 109 ? ? 53.05 18.91 157 13 GLN A 11 ? ? 57.48 -94.77 158 13 SER A 12 ? ? -141.03 27.72 159 13 SER A 32 ? ? 166.13 -60.42 160 13 ILE A 41 ? ? -55.12 106.33 161 13 ARG A 56 ? ? -68.98 57.95 162 13 ARG A 57 ? ? -158.20 -33.50 163 13 GLU A 67 ? ? -87.72 31.28 164 13 ASN A 68 ? ? 179.05 137.17 165 13 ALA A 69 ? ? -62.51 87.51 166 13 GLN A 72 ? ? -154.26 44.68 167 13 TRP A 73 ? ? -37.11 117.00 168 13 GLN A 78 ? ? 68.29 -56.45 169 13 LYS A 90 ? ? -155.48 -41.03 170 13 ASN A 91 ? ? -171.37 65.50 171 13 PRO A 93 ? ? -94.94 -149.11 172 13 ASN A 95 ? ? -133.81 -50.04 173 13 GLU A 99 ? ? -105.12 -148.81 174 13 ASN A 100 ? ? -165.64 -91.85 175 13 CYS A 101 ? ? 66.80 116.46 176 13 ASP A 109 ? ? 71.31 -25.46 177 13 ALA A 135 ? ? -90.14 40.06 178 14 ILE A 5 ? ? 56.88 -98.84 179 14 GLN A 11 ? ? 66.76 -70.70 180 14 SER A 12 ? ? -142.35 -11.57 181 14 SER A 32 ? ? 79.62 -43.65 182 14 MET A 39 ? ? -46.51 104.19 183 14 ARG A 56 ? ? -80.28 30.17 184 14 ASN A 68 ? ? 72.26 -66.74 185 14 ALA A 69 ? ? -179.82 80.26 186 14 LYS A 70 ? ? -101.51 -61.60 187 14 GLN A 78 ? ? 79.29 -8.18 188 14 ARG A 84 ? ? -89.83 34.41 189 14 ARG A 85 ? ? -140.43 21.73 190 14 LYS A 90 ? ? -131.07 -68.74 191 14 ASN A 91 ? ? 179.65 52.49 192 14 GLU A 99 ? ? 43.17 92.94 193 14 ALA A 122 ? ? -162.91 -167.62 194 14 THR A 131 ? ? 61.93 -31.76 195 15 GLN A 11 ? ? 58.31 -97.35 196 15 SER A 32 ? ? 74.96 -50.65 197 15 ARG A 56 ? ? -75.86 24.67 198 15 ASN A 68 ? ? 76.09 -63.79 199 15 ALA A 69 ? ? 179.30 77.99 200 15 GLN A 72 ? ? -154.40 66.14 201 15 VAL A 76 ? ? 28.25 -72.72 202 15 ASP A 77 ? ? -78.85 -86.75 203 15 GLN A 78 ? ? -145.99 -1.72 204 15 ARG A 84 ? ? -130.39 -34.53 205 15 GLU A 99 ? ? 44.45 84.61 206 15 ASP A 109 ? ? 74.31 -25.45 207 16 ASP A 6 ? ? -172.81 -52.48 208 16 GLN A 11 ? ? 64.00 -82.21 209 16 SER A 32 ? ? 76.85 -47.19 210 16 MET A 39 ? ? -49.77 108.47 211 16 ASN A 68 ? ? 78.70 -45.29 212 16 ALA A 69 ? ? 165.14 -6.34 213 16 LYS A 70 ? ? -68.09 94.03 214 16 ASP A 77 ? ? -100.69 -60.05 215 16 GLN A 78 ? ? -170.24 -21.57 216 16 LYS A 90 ? ? -107.21 59.21 217 16 ASN A 91 ? ? -155.05 -53.67 218 16 PRO A 93 ? ? -93.66 -65.23 219 16 GLU A 99 ? ? -133.48 -43.22 220 16 ASN A 100 ? ? 69.53 123.44 221 16 ASP A 109 ? ? 78.82 -16.22 222 17 GLN A 11 ? ? 56.76 -129.60 223 17 ASP A 20 ? ? 82.44 -168.10 224 17 SER A 32 ? ? 154.31 -65.06 225 17 MET A 39 ? ? -46.65 106.64 226 17 ALA A 69 ? ? 67.99 80.79 227 17 VAL A 76 ? ? -78.33 39.82 228 17 ASP A 77 ? ? -164.74 -160.16 229 17 TRP A 88 ? ? -67.97 -176.05 230 17 HIS A 89 ? ? -101.64 -154.93 231 17 ASN A 91 ? ? -164.25 81.63 232 17 GLU A 99 ? ? 73.07 50.05 233 17 ASP A 109 ? ? 71.18 -11.30 234 17 ALA A 122 ? ? -161.87 -169.24 235 17 THR A 131 ? ? -78.21 33.22 236 18 GLN A 11 ? ? 56.96 -103.57 237 18 SER A 32 ? ? 75.33 -34.82 238 18 MET A 39 ? ? -36.26 111.15 239 18 ALA A 69 ? ? 55.37 75.14 240 18 VAL A 76 ? ? -79.20 47.98 241 18 ASP A 77 ? ? -162.09 32.67 242 18 GLN A 78 ? ? 76.76 -37.29 243 18 ARG A 85 ? ? -105.92 76.91 244 18 LYS A 90 ? ? -58.55 108.48 245 18 ASN A 91 ? ? 61.05 90.13 246 19 ILE A 5 ? ? 60.19 159.45 247 19 GLN A 11 ? ? 66.88 -77.57 248 19 SER A 12 ? ? -149.07 17.33 249 19 SER A 32 ? ? 81.39 -41.23 250 19 ARG A 56 ? ? 64.94 -57.51 251 19 GLN A 78 ? ? 64.88 -64.68 252 19 HIS A 89 ? ? -100.84 56.74 253 19 LYS A 90 ? ? 63.27 -86.95 254 19 PRO A 93 ? ? -98.39 -150.76 255 19 ASN A 95 ? ? -133.52 -152.21 256 19 SER A 96 ? ? 68.29 -163.65 257 19 ALA A 135 ? ? -89.67 39.31 258 20 GLN A 11 ? ? 66.00 -77.50 259 20 SER A 12 ? ? -151.92 30.19 260 20 THR A 19 ? ? -101.16 66.29 261 20 ASP A 20 ? ? 81.42 178.39 262 20 ASN A 21 ? ? 86.57 15.23 263 20 SER A 32 ? ? 71.78 -45.66 264 20 ARG A 56 ? ? -85.48 32.02 265 20 ALA A 69 ? ? 57.94 70.07 266 20 GLN A 72 ? ? -109.43 74.99 267 20 GLN A 78 ? ? 163.44 -29.89 268 20 ASN A 95 ? ? 176.73 101.78 269 20 GLN A 97 ? ? 45.35 25.83 # _pdbx_SG_project.full_name_of_center 'New York Structural Genomics Research Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NYSGRC _pdbx_SG_project.project_name PSI:Biology # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria '20 structures for lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LS8 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LS8 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-13C; U-15N] C-type lectin, 10 mM sodium acetate, 0.1 mM EDTA, 90% H2O, 10% D2O' 1 '90% H2O/10% D2O' '1 mM [U-13C; U-15N] C-type lectin, 10 mM sodium acetate, 0.1 mM EDTA, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'C-type lectin-1' 1 ? mM '[U-13C; U-15N]' 1 'sodium acetate-2' 10 ? mM ? 1 EDTA-3 0.1 ? mM ? 1 'C-type lectin-4' 1 ? mM '[U-13C; U-15N]' 2 'sodium acetate-5' 10 ? mM ? 2 EDTA-6 0.1 ? mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 10 _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '15N HSQC' 1 2 1 '15N NOESY-HSQC' 1 3 2 '13C CT-HSQC' 1 4 2 'aromatic 13C CT-HSQC' 1 5 2 '13C NOESY-HSQC' 1 6 2 '13C aromatic NOESY-HSQC' 1 7 1 HNCO 1 8 1 HNCACO 1 9 1 HNCA 1 10 1 HNCOCA 1 11 1 HNCACB 1 12 1 CBCACONH # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count 9 _pdbx_nmr_constraints.entry_id 2LS8 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 72 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2310 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 668 _pdbx_nmr_constraints.NOE_long_range_total_count 671 _pdbx_nmr_constraints.NOE_medium_range_total_count 349 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 558 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 6 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 81 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 80 # _pdbx_nmr_refine.entry_id 2LS8 _pdbx_nmr_refine.method 'simulating annealing' _pdbx_nmr_refine.details 'Refinement in a box of water' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal CCPN 'chemical shift assignment' CCPN 2.1.5 1 CCPN 'peak picking' CCPN 2.1.5 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 1.21 3 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.21 4 ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 2.3 5 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 5.4 6 Varian collection VnmrJ 2.2D 7 'Bruker Biospin' collection TopSpin ? 8 'Orekhov, Jaravine, Kazimierczuk' collection MddNMR 2.0 9 'Orekhov, Jaravine, Kazimierczuk' processing MddNMR 2.0 10 'Lemak, Gutmanas, Chitayat, Karra, Fares, Sunnerhagen, Arrowsmith' collection MDDGUI 1.0 11 'Lemak, Gutmanas, Chitayat, Karra, Fares, Sunnerhagen, Arrowsmith' processing MDDGUI 1.0 12 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 143 ? A HIS 143 2 1 Y 1 A HIS 144 ? A HIS 144 3 1 Y 1 A HIS 145 ? A HIS 145 4 1 Y 1 A HIS 146 ? A HIS 146 5 1 Y 1 A HIS 147 ? A HIS 147 6 1 Y 1 A HIS 148 ? A HIS 148 7 1 Y 1 A TRP 149 ? A TRP 149 8 1 Y 1 A SER 150 ? A SER 150 9 1 Y 1 A HIS 151 ? A HIS 151 10 1 Y 1 A PRO 152 ? A PRO 152 11 1 Y 1 A GLN 153 ? A GLN 153 12 1 Y 1 A PHE 154 ? A PHE 154 13 1 Y 1 A GLU 155 ? A GLU 155 14 1 Y 1 A LYS 156 ? A LYS 156 15 2 Y 1 A HIS 143 ? A HIS 143 16 2 Y 1 A HIS 144 ? A HIS 144 17 2 Y 1 A HIS 145 ? A HIS 145 18 2 Y 1 A HIS 146 ? A HIS 146 19 2 Y 1 A HIS 147 ? A HIS 147 20 2 Y 1 A HIS 148 ? A HIS 148 21 2 Y 1 A TRP 149 ? A TRP 149 22 2 Y 1 A SER 150 ? A SER 150 23 2 Y 1 A HIS 151 ? A HIS 151 24 2 Y 1 A PRO 152 ? A PRO 152 25 2 Y 1 A GLN 153 ? A GLN 153 26 2 Y 1 A PHE 154 ? A PHE 154 27 2 Y 1 A GLU 155 ? A GLU 155 28 2 Y 1 A LYS 156 ? A LYS 156 29 3 Y 1 A HIS 143 ? A HIS 143 30 3 Y 1 A HIS 144 ? A HIS 144 31 3 Y 1 A HIS 145 ? A HIS 145 32 3 Y 1 A HIS 146 ? A HIS 146 33 3 Y 1 A HIS 147 ? A HIS 147 34 3 Y 1 A HIS 148 ? A HIS 148 35 3 Y 1 A TRP 149 ? A TRP 149 36 3 Y 1 A SER 150 ? A SER 150 37 3 Y 1 A HIS 151 ? A HIS 151 38 3 Y 1 A PRO 152 ? A PRO 152 39 3 Y 1 A GLN 153 ? A GLN 153 40 3 Y 1 A PHE 154 ? A PHE 154 41 3 Y 1 A GLU 155 ? A GLU 155 42 3 Y 1 A LYS 156 ? A LYS 156 43 4 Y 1 A HIS 143 ? A HIS 143 44 4 Y 1 A HIS 144 ? A HIS 144 45 4 Y 1 A HIS 145 ? A HIS 145 46 4 Y 1 A HIS 146 ? A HIS 146 47 4 Y 1 A HIS 147 ? A HIS 147 48 4 Y 1 A HIS 148 ? A HIS 148 49 4 Y 1 A TRP 149 ? A TRP 149 50 4 Y 1 A SER 150 ? A SER 150 51 4 Y 1 A HIS 151 ? A HIS 151 52 4 Y 1 A PRO 152 ? A PRO 152 53 4 Y 1 A GLN 153 ? A GLN 153 54 4 Y 1 A PHE 154 ? A PHE 154 55 4 Y 1 A GLU 155 ? A GLU 155 56 4 Y 1 A LYS 156 ? A LYS 156 57 5 Y 1 A HIS 143 ? A HIS 143 58 5 Y 1 A HIS 144 ? A HIS 144 59 5 Y 1 A HIS 145 ? A HIS 145 60 5 Y 1 A HIS 146 ? A HIS 146 61 5 Y 1 A HIS 147 ? A HIS 147 62 5 Y 1 A HIS 148 ? A HIS 148 63 5 Y 1 A TRP 149 ? A TRP 149 64 5 Y 1 A SER 150 ? A SER 150 65 5 Y 1 A HIS 151 ? A HIS 151 66 5 Y 1 A PRO 152 ? A PRO 152 67 5 Y 1 A GLN 153 ? A GLN 153 68 5 Y 1 A PHE 154 ? A PHE 154 69 5 Y 1 A GLU 155 ? A GLU 155 70 5 Y 1 A LYS 156 ? A LYS 156 71 6 Y 1 A HIS 143 ? A HIS 143 72 6 Y 1 A HIS 144 ? A HIS 144 73 6 Y 1 A HIS 145 ? A HIS 145 74 6 Y 1 A HIS 146 ? A HIS 146 75 6 Y 1 A HIS 147 ? A HIS 147 76 6 Y 1 A HIS 148 ? A HIS 148 77 6 Y 1 A TRP 149 ? A TRP 149 78 6 Y 1 A SER 150 ? A SER 150 79 6 Y 1 A HIS 151 ? A HIS 151 80 6 Y 1 A PRO 152 ? A PRO 152 81 6 Y 1 A GLN 153 ? A GLN 153 82 6 Y 1 A PHE 154 ? A PHE 154 83 6 Y 1 A GLU 155 ? A GLU 155 84 6 Y 1 A LYS 156 ? A LYS 156 85 7 Y 1 A HIS 143 ? A HIS 143 86 7 Y 1 A HIS 144 ? A HIS 144 87 7 Y 1 A HIS 145 ? A HIS 145 88 7 Y 1 A HIS 146 ? A HIS 146 89 7 Y 1 A HIS 147 ? A HIS 147 90 7 Y 1 A HIS 148 ? A HIS 148 91 7 Y 1 A TRP 149 ? A TRP 149 92 7 Y 1 A SER 150 ? A SER 150 93 7 Y 1 A HIS 151 ? A HIS 151 94 7 Y 1 A PRO 152 ? A PRO 152 95 7 Y 1 A GLN 153 ? A GLN 153 96 7 Y 1 A PHE 154 ? A PHE 154 97 7 Y 1 A GLU 155 ? A GLU 155 98 7 Y 1 A LYS 156 ? A LYS 156 99 8 Y 1 A HIS 143 ? A HIS 143 100 8 Y 1 A HIS 144 ? A HIS 144 101 8 Y 1 A HIS 145 ? A HIS 145 102 8 Y 1 A HIS 146 ? A HIS 146 103 8 Y 1 A HIS 147 ? A HIS 147 104 8 Y 1 A HIS 148 ? A HIS 148 105 8 Y 1 A TRP 149 ? A TRP 149 106 8 Y 1 A SER 150 ? A SER 150 107 8 Y 1 A HIS 151 ? A HIS 151 108 8 Y 1 A PRO 152 ? A PRO 152 109 8 Y 1 A GLN 153 ? A GLN 153 110 8 Y 1 A PHE 154 ? A PHE 154 111 8 Y 1 A GLU 155 ? A GLU 155 112 8 Y 1 A LYS 156 ? A LYS 156 113 9 Y 1 A HIS 143 ? A HIS 143 114 9 Y 1 A HIS 144 ? A HIS 144 115 9 Y 1 A HIS 145 ? A HIS 145 116 9 Y 1 A HIS 146 ? A HIS 146 117 9 Y 1 A HIS 147 ? A HIS 147 118 9 Y 1 A HIS 148 ? A HIS 148 119 9 Y 1 A TRP 149 ? A TRP 149 120 9 Y 1 A SER 150 ? A SER 150 121 9 Y 1 A HIS 151 ? A HIS 151 122 9 Y 1 A PRO 152 ? A PRO 152 123 9 Y 1 A GLN 153 ? A GLN 153 124 9 Y 1 A PHE 154 ? A PHE 154 125 9 Y 1 A GLU 155 ? A GLU 155 126 9 Y 1 A LYS 156 ? A LYS 156 127 10 Y 1 A HIS 143 ? A HIS 143 128 10 Y 1 A HIS 144 ? A HIS 144 129 10 Y 1 A HIS 145 ? A HIS 145 130 10 Y 1 A HIS 146 ? A HIS 146 131 10 Y 1 A HIS 147 ? A HIS 147 132 10 Y 1 A HIS 148 ? A HIS 148 133 10 Y 1 A TRP 149 ? A TRP 149 134 10 Y 1 A SER 150 ? A SER 150 135 10 Y 1 A HIS 151 ? A HIS 151 136 10 Y 1 A PRO 152 ? A PRO 152 137 10 Y 1 A GLN 153 ? A GLN 153 138 10 Y 1 A PHE 154 ? A PHE 154 139 10 Y 1 A GLU 155 ? A GLU 155 140 10 Y 1 A LYS 156 ? A LYS 156 141 11 Y 1 A HIS 143 ? A HIS 143 142 11 Y 1 A HIS 144 ? A HIS 144 143 11 Y 1 A HIS 145 ? A HIS 145 144 11 Y 1 A HIS 146 ? A HIS 146 145 11 Y 1 A HIS 147 ? A HIS 147 146 11 Y 1 A HIS 148 ? A HIS 148 147 11 Y 1 A TRP 149 ? A TRP 149 148 11 Y 1 A SER 150 ? A SER 150 149 11 Y 1 A HIS 151 ? A HIS 151 150 11 Y 1 A PRO 152 ? A PRO 152 151 11 Y 1 A GLN 153 ? A GLN 153 152 11 Y 1 A PHE 154 ? A PHE 154 153 11 Y 1 A GLU 155 ? A GLU 155 154 11 Y 1 A LYS 156 ? A LYS 156 155 12 Y 1 A HIS 143 ? A HIS 143 156 12 Y 1 A HIS 144 ? A HIS 144 157 12 Y 1 A HIS 145 ? A HIS 145 158 12 Y 1 A HIS 146 ? A HIS 146 159 12 Y 1 A HIS 147 ? A HIS 147 160 12 Y 1 A HIS 148 ? A HIS 148 161 12 Y 1 A TRP 149 ? A TRP 149 162 12 Y 1 A SER 150 ? A SER 150 163 12 Y 1 A HIS 151 ? A HIS 151 164 12 Y 1 A PRO 152 ? A PRO 152 165 12 Y 1 A GLN 153 ? A GLN 153 166 12 Y 1 A PHE 154 ? A PHE 154 167 12 Y 1 A GLU 155 ? A GLU 155 168 12 Y 1 A LYS 156 ? A LYS 156 169 13 Y 1 A HIS 143 ? A HIS 143 170 13 Y 1 A HIS 144 ? A HIS 144 171 13 Y 1 A HIS 145 ? A HIS 145 172 13 Y 1 A HIS 146 ? A HIS 146 173 13 Y 1 A HIS 147 ? A HIS 147 174 13 Y 1 A HIS 148 ? A HIS 148 175 13 Y 1 A TRP 149 ? A TRP 149 176 13 Y 1 A SER 150 ? A SER 150 177 13 Y 1 A HIS 151 ? A HIS 151 178 13 Y 1 A PRO 152 ? A PRO 152 179 13 Y 1 A GLN 153 ? A GLN 153 180 13 Y 1 A PHE 154 ? A PHE 154 181 13 Y 1 A GLU 155 ? A GLU 155 182 13 Y 1 A LYS 156 ? A LYS 156 183 14 Y 1 A HIS 143 ? A HIS 143 184 14 Y 1 A HIS 144 ? A HIS 144 185 14 Y 1 A HIS 145 ? A HIS 145 186 14 Y 1 A HIS 146 ? A HIS 146 187 14 Y 1 A HIS 147 ? A HIS 147 188 14 Y 1 A HIS 148 ? A HIS 148 189 14 Y 1 A TRP 149 ? A TRP 149 190 14 Y 1 A SER 150 ? A SER 150 191 14 Y 1 A HIS 151 ? A HIS 151 192 14 Y 1 A PRO 152 ? A PRO 152 193 14 Y 1 A GLN 153 ? A GLN 153 194 14 Y 1 A PHE 154 ? A PHE 154 195 14 Y 1 A GLU 155 ? A GLU 155 196 14 Y 1 A LYS 156 ? A LYS 156 197 15 Y 1 A HIS 143 ? A HIS 143 198 15 Y 1 A HIS 144 ? A HIS 144 199 15 Y 1 A HIS 145 ? A HIS 145 200 15 Y 1 A HIS 146 ? A HIS 146 201 15 Y 1 A HIS 147 ? A HIS 147 202 15 Y 1 A HIS 148 ? A HIS 148 203 15 Y 1 A TRP 149 ? A TRP 149 204 15 Y 1 A SER 150 ? A SER 150 205 15 Y 1 A HIS 151 ? A HIS 151 206 15 Y 1 A PRO 152 ? A PRO 152 207 15 Y 1 A GLN 153 ? A GLN 153 208 15 Y 1 A PHE 154 ? A PHE 154 209 15 Y 1 A GLU 155 ? A GLU 155 210 15 Y 1 A LYS 156 ? A LYS 156 211 16 Y 1 A HIS 143 ? A HIS 143 212 16 Y 1 A HIS 144 ? A HIS 144 213 16 Y 1 A HIS 145 ? A HIS 145 214 16 Y 1 A HIS 146 ? A HIS 146 215 16 Y 1 A HIS 147 ? A HIS 147 216 16 Y 1 A HIS 148 ? A HIS 148 217 16 Y 1 A TRP 149 ? A TRP 149 218 16 Y 1 A SER 150 ? A SER 150 219 16 Y 1 A HIS 151 ? A HIS 151 220 16 Y 1 A PRO 152 ? A PRO 152 221 16 Y 1 A GLN 153 ? A GLN 153 222 16 Y 1 A PHE 154 ? A PHE 154 223 16 Y 1 A GLU 155 ? A GLU 155 224 16 Y 1 A LYS 156 ? A LYS 156 225 17 Y 1 A HIS 143 ? A HIS 143 226 17 Y 1 A HIS 144 ? A HIS 144 227 17 Y 1 A HIS 145 ? A HIS 145 228 17 Y 1 A HIS 146 ? A HIS 146 229 17 Y 1 A HIS 147 ? A HIS 147 230 17 Y 1 A HIS 148 ? A HIS 148 231 17 Y 1 A TRP 149 ? A TRP 149 232 17 Y 1 A SER 150 ? A SER 150 233 17 Y 1 A HIS 151 ? A HIS 151 234 17 Y 1 A PRO 152 ? A PRO 152 235 17 Y 1 A GLN 153 ? A GLN 153 236 17 Y 1 A PHE 154 ? A PHE 154 237 17 Y 1 A GLU 155 ? A GLU 155 238 17 Y 1 A LYS 156 ? A LYS 156 239 18 Y 1 A HIS 143 ? A HIS 143 240 18 Y 1 A HIS 144 ? A HIS 144 241 18 Y 1 A HIS 145 ? A HIS 145 242 18 Y 1 A HIS 146 ? A HIS 146 243 18 Y 1 A HIS 147 ? A HIS 147 244 18 Y 1 A HIS 148 ? A HIS 148 245 18 Y 1 A TRP 149 ? A TRP 149 246 18 Y 1 A SER 150 ? A SER 150 247 18 Y 1 A HIS 151 ? A HIS 151 248 18 Y 1 A PRO 152 ? A PRO 152 249 18 Y 1 A GLN 153 ? A GLN 153 250 18 Y 1 A PHE 154 ? A PHE 154 251 18 Y 1 A GLU 155 ? A GLU 155 252 18 Y 1 A LYS 156 ? A LYS 156 253 19 Y 1 A HIS 143 ? A HIS 143 254 19 Y 1 A HIS 144 ? A HIS 144 255 19 Y 1 A HIS 145 ? A HIS 145 256 19 Y 1 A HIS 146 ? A HIS 146 257 19 Y 1 A HIS 147 ? A HIS 147 258 19 Y 1 A HIS 148 ? A HIS 148 259 19 Y 1 A TRP 149 ? A TRP 149 260 19 Y 1 A SER 150 ? A SER 150 261 19 Y 1 A HIS 151 ? A HIS 151 262 19 Y 1 A PRO 152 ? A PRO 152 263 19 Y 1 A GLN 153 ? A GLN 153 264 19 Y 1 A PHE 154 ? A PHE 154 265 19 Y 1 A GLU 155 ? A GLU 155 266 19 Y 1 A LYS 156 ? A LYS 156 267 20 Y 1 A HIS 143 ? A HIS 143 268 20 Y 1 A HIS 144 ? A HIS 144 269 20 Y 1 A HIS 145 ? A HIS 145 270 20 Y 1 A HIS 146 ? A HIS 146 271 20 Y 1 A HIS 147 ? A HIS 147 272 20 Y 1 A HIS 148 ? A HIS 148 273 20 Y 1 A TRP 149 ? A TRP 149 274 20 Y 1 A SER 150 ? A SER 150 275 20 Y 1 A HIS 151 ? A HIS 151 276 20 Y 1 A PRO 152 ? A PRO 152 277 20 Y 1 A GLN 153 ? A GLN 153 278 20 Y 1 A PHE 154 ? A PHE 154 279 20 Y 1 A GLU 155 ? A GLU 155 280 20 Y 1 A LYS 156 ? A LYS 156 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian Inova' 800 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2LS8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_