data_2LTA # _entry.id 2LTA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LTA pdb_00002lta 10.2210/pdb2lta/pdb RCSB RCSB102806 ? ? BMRB 18465 ? ? WWPDB D_1000102806 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 18465 BMRB unspecified . NESG-OR157 TargetTrack unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LTA _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-05-15 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, G.' 1 'Koga, R.' 2 'Koga, N.' 3 'Xiao, R.' 4 'Pederson, K.' 5 'Hamilton, K.' 6 'Kohan, E.' 7 'Acton, T.B.' 8 'Kornhaber, G.' 9 'Everett, J.K.' 10 'Baker, D.' 11 'Montelione, G.T.' 12 'Northeast Structural Genomics Consortium (NESG)' 13 # _citation.id primary _citation.title 'Principles for designing ideal protein structures.' _citation.journal_abbrev Nature _citation.journal_volume 491 _citation.page_first 222 _citation.page_last 227 _citation.year 2012 _citation.journal_id_ASTM NATUAS _citation.country UK _citation.journal_id_ISSN 0028-0836 _citation.journal_id_CSD 0006 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23135467 _citation.pdbx_database_id_DOI 10.1038/nature11600 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Koga, N.' 1 ? primary 'Tatsumi-Koga, R.' 2 ? primary 'Liu, G.' 3 ? primary 'Xiao, R.' 4 ? primary 'Acton, T.B.' 5 ? primary 'Montelione, G.T.' 6 ? primary 'Baker, D.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'De novo designed protein' _entity.formula_weight 13064.995 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSKIIVIISSDDTTLEELARKIKDEGLEVYILLKDKDEKRLEEKIQKLKSQGFEVRKVKDDDDIDKWIDKIKKERPQLE VRKVTDEDQAKQILEDLKKKGSLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSKIIVIISSDDTTLEELARKIKDEGLEVYILLKDKDEKRLEEKIQKLKSQGFEVRKVKDDDDIDKWIDKIKKERPQLE VRKVTDEDQAKQILEDLKKKGSLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NESG-OR157 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 LYS n 1 5 ILE n 1 6 ILE n 1 7 VAL n 1 8 ILE n 1 9 ILE n 1 10 SER n 1 11 SER n 1 12 ASP n 1 13 ASP n 1 14 THR n 1 15 THR n 1 16 LEU n 1 17 GLU n 1 18 GLU n 1 19 LEU n 1 20 ALA n 1 21 ARG n 1 22 LYS n 1 23 ILE n 1 24 LYS n 1 25 ASP n 1 26 GLU n 1 27 GLY n 1 28 LEU n 1 29 GLU n 1 30 VAL n 1 31 TYR n 1 32 ILE n 1 33 LEU n 1 34 LEU n 1 35 LYS n 1 36 ASP n 1 37 LYS n 1 38 ASP n 1 39 GLU n 1 40 LYS n 1 41 ARG n 1 42 LEU n 1 43 GLU n 1 44 GLU n 1 45 LYS n 1 46 ILE n 1 47 GLN n 1 48 LYS n 1 49 LEU n 1 50 LYS n 1 51 SER n 1 52 GLN n 1 53 GLY n 1 54 PHE n 1 55 GLU n 1 56 VAL n 1 57 ARG n 1 58 LYS n 1 59 VAL n 1 60 LYS n 1 61 ASP n 1 62 ASP n 1 63 ASP n 1 64 ASP n 1 65 ILE n 1 66 ASP n 1 67 LYS n 1 68 TRP n 1 69 ILE n 1 70 ASP n 1 71 LYS n 1 72 ILE n 1 73 LYS n 1 74 LYS n 1 75 GLU n 1 76 ARG n 1 77 PRO n 1 78 GLN n 1 79 LEU n 1 80 GLU n 1 81 VAL n 1 82 ARG n 1 83 LYS n 1 84 VAL n 1 85 THR n 1 86 ASP n 1 87 GLU n 1 88 ASP n 1 89 GLN n 1 90 ALA n 1 91 LYS n 1 92 GLN n 1 93 ILE n 1 94 LEU n 1 95 GLU n 1 96 ASP n 1 97 LEU n 1 98 LYS n 1 99 LYS n 1 100 LYS n 1 101 GLY n 1 102 SER n 1 103 LEU n 1 104 GLU n 1 105 HIS n 1 106 HIS n 1 107 HIS n 1 108 HIS n 1 109 HIS n 1 110 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'artificial gene' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pMgK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET29b+ _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2LTA _struct_ref.pdbx_db_accession 2LTA _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LTA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 110 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2LTA _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 110 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 110 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D 1H-13C arom NOESY' 1 7 1 '3D simutaneous 13C-aromatic,13C-aliphatic,15N edited 1H-1H NOESY' 1 8 3 '2D 1H-15N HSQC' 1 9 1 '3D HBHA(CO)NH' 1 10 1 '3D HCCH-TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.035 mM [U-100% 13C; U-100% 15N] OR157.004, 100 mM NaCl, 5 mM DTT, 0.02 % NaN3, 10 mM Tris-HCl pH 7.5, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.805 mM [U-100% 13C; U-100% 15N] OR157.006, 100 mM NaCl, 5 mM DTT, 0.02 % NaN3, 10 mM Tris-HCl pH 7.5, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '0.805 mM [U-100% 13C; U-100% 15N] OR157.006, 100 mM NaCl, 5 mM DTT, 0.02 % NaN3, 10 mM Tris-HCl pH 7.5, 100% D2O' 3 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Varian INOVA 2 'Varian INOVA' 600 Varian INOVA 3 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2LTA _pdbx_nmr_refine.method 'distance geometry, simulated annealing, molecular dynamics, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LTA _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LTA _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'geometry optimization' CNS ? 3 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 4 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA 3.0 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 6 'Huang, Tejero, Powers and Montelione' 'data analysis' AutoStructure 2.1 7 'Huang, Tejero, Powers and Montelione' refinement AutoStructure 2.1 8 'Zimmerman, Moseley, Kulikowski and Montelione' 'data analysis' AutoAssign 2.1 9 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.1 10 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 11 'Bartels et al.' 'data analysis' XEASY ? 12 'Bartels et al.' 'peak picking' XEASY ? 13 'Bartels et al.' 'chemical shift assignment' XEASY ? 14 'Bruker Biospin' collection TopSpin ? 15 Varian collection VnmrJ ? 16 Goddard 'data analysis' Sparky ? 17 'Shen, Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS+ ? 18 'Valafar, Prestegard' 'geometry optimization' REDCAT ? 19 'Bhattacharya, Montelione' 'structure validation' PSVS ? 20 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LTA _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LTA _struct.title 'Solution NMR structure of De novo designed protein, rossmann 3x1 fold, Northeast Structural Genomics Consortium target OR157' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LTA _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' _struct_keywords.text 'Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, NESG, PSI-Biology, Protein Structure Initiative, DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 14 ? GLU A 26 ? THR A 14 GLU A 26 1 ? 13 HELX_P HELX_P2 2 ASP A 38 ? GLY A 53 ? ASP A 38 GLY A 53 1 ? 16 HELX_P HELX_P3 3 ASP A 61 ? ARG A 76 ? ASP A 61 ARG A 76 1 ? 16 HELX_P HELX_P4 4 ASP A 86 ? LYS A 99 ? ASP A 86 LYS A 99 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 55 ? LYS A 58 ? GLU A 55 LYS A 58 A 2 GLU A 29 ? LYS A 35 ? GLU A 29 LYS A 35 A 3 ILE A 5 ? SER A 11 ? ILE A 5 SER A 11 A 4 VAL A 81 ? VAL A 84 ? VAL A 81 VAL A 84 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ARG A 57 ? O ARG A 57 N ILE A 32 ? N ILE A 32 A 2 3 O TYR A 31 ? O TYR A 31 N ILE A 6 ? N ILE A 6 A 3 4 N ILE A 9 ? N ILE A 9 O VAL A 84 ? O VAL A 84 # _atom_sites.entry_id 2LTA _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 TRP 68 68 68 TRP TRP A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 HIS 110 110 110 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-06-13 2 'Structure model' 1 1 2012-10-31 3 'Structure model' 1 2 2012-11-07 4 'Structure model' 1 3 2013-01-23 5 'Structure model' 1 4 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' database_2 2 5 'Structure model' pdbx_database_status 3 5 'Structure model' pdbx_nmr_software 4 5 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 5 'Structure model' '_pdbx_nmr_software.name' 5 5 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id OR157.004-1 1.035 ? mM '[U-100% 13C; U-100% 15N]' 1 NaCl-2 100 ? mM ? 1 DTT-3 5 ? mM ? 1 NaN3-4 0.02 ? % ? 1 'Tris-HCl pH 7.5-5' 10 ? mM ? 1 OR157.006-6 0.805 ? mM '[U-100% 13C; U-100% 15N]' 2 NaCl-7 100 ? mM ? 2 DTT-8 5 ? mM ? 2 NaN3-9 0.02 ? % ? 2 'Tris-HCl pH 7.5-10' 10 ? mM ? 2 OR157.006-11 0.805 ? mM '[U-100% 13C; U-100% 15N]' 3 NaCl-12 100 ? mM ? 3 DTT-13 5 ? mM ? 3 NaN3-14 0.02 ? % ? 3 'Tris-HCl pH 7.5-15' 10 ? mM ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 12 ? ? 76.30 -62.39 2 1 LYS A 60 ? ? -83.79 -78.69 3 1 LEU A 103 ? ? -92.96 -61.62 4 1 GLU A 104 ? ? -151.07 -36.02 5 1 HIS A 106 ? ? -90.10 50.41 6 2 ASP A 12 ? ? 73.75 -61.07 7 2 HIS A 105 ? ? -97.39 36.95 8 2 HIS A 107 ? ? -68.32 84.85 9 3 ASP A 61 ? ? -165.88 -167.36 10 3 LYS A 100 ? ? -118.63 73.51 11 3 LEU A 103 ? ? -75.77 -77.31 12 3 GLU A 104 ? ? -109.62 63.82 13 3 HIS A 107 ? ? -40.71 109.66 14 3 HIS A 109 ? ? 68.72 119.17 15 4 ASP A 12 ? ? 78.69 -53.08 16 4 LYS A 60 ? ? -79.03 -73.51 17 4 HIS A 105 ? ? -147.24 37.67 18 5 ASP A 12 ? ? 69.78 -69.79 19 5 ASP A 61 ? ? -172.02 -174.96 20 5 LYS A 99 ? ? -88.39 -76.33 21 5 SER A 102 ? ? 51.81 73.25 22 6 ASP A 12 ? ? 71.98 -68.20 23 6 LYS A 60 ? ? -94.23 -61.71 24 6 LYS A 99 ? ? -67.06 -71.11 25 6 LYS A 100 ? ? 171.87 142.19 26 6 SER A 102 ? ? -105.17 -68.03 27 6 HIS A 105 ? ? -69.07 79.88 28 7 SER A 11 ? ? -80.86 -153.90 29 7 LYS A 100 ? ? 168.93 -36.88 30 7 SER A 102 ? ? -175.17 -67.73 31 7 LEU A 103 ? ? 72.57 -66.48 32 7 HIS A 107 ? ? 78.59 -11.97 33 8 ASP A 12 ? ? 75.49 -61.22 34 8 PRO A 77 ? ? -79.83 -168.15 35 8 GLN A 78 ? ? 73.06 -24.10 36 8 HIS A 108 ? ? -68.24 89.02 37 9 ASP A 12 ? ? 47.85 22.74 38 9 LYS A 60 ? ? -66.41 -74.80 39 9 HIS A 109 ? ? 68.17 168.92 40 10 ASP A 12 ? ? 72.65 -78.28 41 10 LYS A 60 ? ? -93.85 -69.34 42 10 LYS A 100 ? ? -69.57 92.24 43 10 LEU A 103 ? ? -90.50 54.06 44 11 ASP A 12 ? ? 76.94 -38.13 45 11 ASP A 61 ? ? -173.61 -175.66 46 11 LYS A 99 ? ? -69.26 -76.24 47 11 SER A 102 ? ? -69.13 93.96 48 11 HIS A 105 ? ? -65.89 -74.45 49 11 HIS A 106 ? ? 44.73 28.27 50 11 HIS A 109 ? ? 71.19 89.48 51 12 ASP A 12 ? ? 77.09 -59.39 52 12 LYS A 60 ? ? -109.24 -96.58 53 12 HIS A 106 ? ? -55.74 106.06 54 12 HIS A 108 ? ? 40.25 78.34 55 13 ASP A 12 ? ? 73.20 -79.85 56 13 LYS A 60 ? ? -103.84 -78.34 57 13 LYS A 100 ? ? 44.57 -67.30 58 13 HIS A 105 ? ? -149.72 -49.26 59 13 HIS A 108 ? ? -69.83 82.53 60 13 HIS A 109 ? ? -146.29 25.89 61 14 SER A 11 ? ? -82.23 -145.06 62 14 ASP A 61 ? ? -170.60 -172.98 63 14 HIS A 109 ? ? -167.57 43.85 64 15 ASP A 12 ? ? 74.17 -68.76 65 15 LYS A 60 ? ? -82.06 -70.82 66 15 LYS A 100 ? ? 65.43 91.05 67 15 GLU A 104 ? ? -76.81 40.43 68 15 HIS A 106 ? ? -88.71 47.50 69 15 HIS A 107 ? ? 70.11 126.21 70 16 ASP A 12 ? ? 77.17 -54.66 71 16 GLU A 26 ? ? -69.91 1.28 72 16 LYS A 60 ? ? -106.49 -73.50 73 16 HIS A 107 ? ? -163.38 119.83 74 17 ASP A 12 ? ? 67.62 -76.30 75 17 LYS A 60 ? ? -90.32 -69.47 76 17 ASP A 61 ? ? -166.94 -169.83 77 18 ASP A 12 ? ? 77.41 -51.01 78 18 LYS A 100 ? ? 59.36 100.14 79 18 HIS A 106 ? ? -91.92 35.55 80 19 ASP A 12 ? ? 74.89 -33.90 81 19 LYS A 100 ? ? -163.81 117.09 82 19 SER A 102 ? ? -158.54 -14.33 83 19 LEU A 103 ? ? -107.16 70.42 84 20 SER A 11 ? ? -97.64 -159.58 85 20 LYS A 60 ? ? -85.54 -84.43 86 20 LYS A 100 ? ? 56.35 80.37 87 20 SER A 102 ? ? -163.25 -164.38 #