data_2LTL # _entry.id 2LTL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LTL pdb_00002ltl 10.2210/pdb2ltl/pdb RCSB RCSB102817 ? ? BMRB 18487 ? ? WWPDB D_1000102817 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 18487 BMRB unspecified . NESG-YR313A TargetTrack unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LTL _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-05-29 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category CASP _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, G.' 1 'Xiao, R.' 2 'Hamilton, K.' 3 'Janjua, H.' 4 'Shastry, R.' 5 'Kohan, E.' 6 'Acton, T.B.' 7 'Everett, J.K.' 8 'Lee, H.' 9 'Huang, Y.J.' 10 'Montelione, G.T.' 11 'Northeast Structural Genomics Consortium (NESG)' 12 'Mitochondrial Protein Partnership (MPP)' 13 # _citation.id primary _citation.title ;Solution NMR Structure of NifU-like protein from Saccharomyces cerevisiae, Northeast Structural Genomics Consortium (NESG) Target YR313A ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, G.' 1 ? primary 'Xiao, R.' 2 ? primary 'Hamilton, K.' 3 ? primary 'Janjua, H.' 4 ? primary 'Shastry, R.' 5 ? primary 'Kohan, E.' 6 ? primary 'Acton, T.B.' 7 ? primary 'Everett, J.K.' 8 ? primary 'Lee, H.' 9 ? primary 'Huang, Y.J.' 10 ? primary 'Montelione, G.T.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'NifU-like protein, mitochondrial' _entity.formula_weight 13639.600 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 17-124' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGHHHHHHSHMNSQRLIHIKTLTTPNENALKFLSTDGEMLQTRGSKSIVIKNTDENLINHSKLAQQIFLQCPGVESLMIG DDFLTINKDRMVHWNSIKPEIIDLLTKQLAYGEDVISKE ; _entity_poly.pdbx_seq_one_letter_code_can ;MGHHHHHHSHMNSQRLIHIKTLTTPNENALKFLSTDGEMLQTRGSKSIVIKNTDENLINHSKLAQQIFLQCPGVESLMIG DDFLTINKDRMVHWNSIKPEIIDLLTKQLAYGEDVISKE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NESG-YR313A # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 SER n 1 10 HIS n 1 11 MET n 1 12 ASN n 1 13 SER n 1 14 GLN n 1 15 ARG n 1 16 LEU n 1 17 ILE n 1 18 HIS n 1 19 ILE n 1 20 LYS n 1 21 THR n 1 22 LEU n 1 23 THR n 1 24 THR n 1 25 PRO n 1 26 ASN n 1 27 GLU n 1 28 ASN n 1 29 ALA n 1 30 LEU n 1 31 LYS n 1 32 PHE n 1 33 LEU n 1 34 SER n 1 35 THR n 1 36 ASP n 1 37 GLY n 1 38 GLU n 1 39 MET n 1 40 LEU n 1 41 GLN n 1 42 THR n 1 43 ARG n 1 44 GLY n 1 45 SER n 1 46 LYS n 1 47 SER n 1 48 ILE n 1 49 VAL n 1 50 ILE n 1 51 LYS n 1 52 ASN n 1 53 THR n 1 54 ASP n 1 55 GLU n 1 56 ASN n 1 57 LEU n 1 58 ILE n 1 59 ASN n 1 60 HIS n 1 61 SER n 1 62 LYS n 1 63 LEU n 1 64 ALA n 1 65 GLN n 1 66 GLN n 1 67 ILE n 1 68 PHE n 1 69 LEU n 1 70 GLN n 1 71 CYS n 1 72 PRO n 1 73 GLY n 1 74 VAL n 1 75 GLU n 1 76 SER n 1 77 LEU n 1 78 MET n 1 79 ILE n 1 80 GLY n 1 81 ASP n 1 82 ASP n 1 83 PHE n 1 84 LEU n 1 85 THR n 1 86 ILE n 1 87 ASN n 1 88 LYS n 1 89 ASP n 1 90 ARG n 1 91 MET n 1 92 VAL n 1 93 HIS n 1 94 TRP n 1 95 ASN n 1 96 SER n 1 97 ILE n 1 98 LYS n 1 99 PRO n 1 100 GLU n 1 101 ILE n 1 102 ILE n 1 103 ASP n 1 104 LEU n 1 105 LEU n 1 106 THR n 1 107 LYS n 1 108 GLN n 1 109 LEU n 1 110 ALA n 1 111 TYR n 1 112 GLY n 1 113 GLU n 1 114 ASP n 1 115 VAL n 1 116 ILE n 1 117 SER n 1 118 LYS n 1 119 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;Baker's yeast ; _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'NFU1, NUB1, YKL040C, YKL253' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 204508 / S288c' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 559292 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pMgK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET15_NESG _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NFU1_YEAST _struct_ref.pdbx_db_accession P32860 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NSQRLIHIKTLTTPNENALKFLSTDGEMLQTRGSKSIVIKNTDENLINHSKLAQQIFLQCPGVESLMIGDDFLTINKDRM VHWNSIKPEIIDLLTKQLAYGEDVISKE ; _struct_ref.pdbx_align_begin 17 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LTL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 12 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 119 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P32860 _struct_ref_seq.db_align_beg 17 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 124 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 12 _struct_ref_seq.pdbx_auth_seq_align_end 119 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LTL MET A 1 ? UNP P32860 ? ? 'expression tag' 1 1 1 2LTL GLY A 2 ? UNP P32860 ? ? 'expression tag' 2 2 1 2LTL HIS A 3 ? UNP P32860 ? ? 'expression tag' 3 3 1 2LTL HIS A 4 ? UNP P32860 ? ? 'expression tag' 4 4 1 2LTL HIS A 5 ? UNP P32860 ? ? 'expression tag' 5 5 1 2LTL HIS A 6 ? UNP P32860 ? ? 'expression tag' 6 6 1 2LTL HIS A 7 ? UNP P32860 ? ? 'expression tag' 7 7 1 2LTL HIS A 8 ? UNP P32860 ? ? 'expression tag' 8 8 1 2LTL SER A 9 ? UNP P32860 ? ? 'expression tag' 9 9 1 2LTL HIS A 10 ? UNP P32860 ? ? 'expression tag' 10 10 1 2LTL MET A 11 ? UNP P32860 ? ? 'expression tag' 11 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D 1H-13C arom NOESY' 1 7 1 '3D simutaneous 13C-aromatic,13C-aliphatic,15N edited 1H-1H NOESY' 1 8 2 '2D 1H-15N HSQC' 1 9 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1.027 mM [U-100% 13C; U-100% 15N] YR313A.037, 450 mM NaCl, 25 mM Na2PO4, 10 mM DTT, 20 uM ZnSO4, 1 X Proteinase inhibitors, 0.02 % NaN3, 5 % D2O, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;0.52 mM [U-10% 13C; U-100% 15N] YR313A.040, 450 mM NaCl, 25 mM Na2PO4, 10 mM DTT, 20 uM ZnSO4, 1 X Proteinase inhibitors, 0.02 % NaN3, 5 % D2O, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Varian INOVA 2 'Varian INOVA' 600 Varian INOVA 3 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2LTL _pdbx_nmr_refine.method 'distance geometry, simulated annealing, torsion angle dynamics, molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LTL _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LTL _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'geometry optimization' CNS ? 3 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 4 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA 3.0 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 6 'Huang, Tejero, Powers and Montelione' 'data analysis' AutoStructure 2.1 7 'Huang, Tejero, Powers and Montelione' refinement AutoStructure 2.1 8 'Zimmerman, Moseley, Kulikowski and Montelione' 'data analysis' AutoAssign 2.1 9 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.1 10 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 11 'Bartels et al.' 'data analysis' XEASY ? 12 'Bartels et al.' 'peak picking' XEASY ? 13 'Bartels et al.' 'chemical shift assignment' XEASY ? 14 'Bruker Biospin' collection TopSpin ? 15 Varian collection VnmrJ ? 16 'Bahrami, Markley, Assadi, and Eghbalnia' 'chemical shift assignment' PINE ? 17 Goddard 'data analysis' Sparky ? 18 'Shen, Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS+ ? 19 'PALES (Zweckstetter, Bax)' 'geometry optimization' PALES ? 20 'Valafar, Prestegard' 'geometry optimization' REDCAT ? 21 'Bhattacharya, Montelione' 'structure validation' PSVS ? 22 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'CASP target and CASD-NMR target' _exptl.entry_id 2LTL _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LTL _struct.title ;Solution NMR Structure of NifU-like protein from Saccharomyces cerevisiae, Northeast Structural Genomics Consortium (NESG) Target YR313A ; _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag Y _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LTL _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text ;NifU-like protein, Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, NESG, Mitochondrial Protein Partnership, MPP, PSI-Biology, Protein Structure Initiative, ELECTRON TRANSPORT ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 54 ? SER A 61 ? ASP A 54 SER A 61 1 ? 8 HELX_P HELX_P2 2 SER A 61 ? CYS A 71 ? SER A 61 CYS A 71 1 ? 11 HELX_P HELX_P3 3 HIS A 93 ? GLY A 112 ? HIS A 93 GLY A 112 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 19 ? LEU A 22 ? ILE A 19 LEU A 22 A 2 ALA A 29 ? SER A 34 ? ALA A 29 SER A 34 A 3 PHE A 83 ? LYS A 88 ? PHE A 83 LYS A 88 A 4 VAL A 74 ? ILE A 79 ? VAL A 74 ILE A 79 A 5 ILE A 48 ? LYS A 51 ? ILE A 48 LYS A 51 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 20 ? N LYS A 20 O LEU A 33 ? O LEU A 33 A 2 3 N LEU A 30 ? N LEU A 30 O ILE A 86 ? O ILE A 86 A 3 4 O ASN A 87 ? O ASN A 87 N SER A 76 ? N SER A 76 A 4 5 O ILE A 79 ? O ILE A 79 N ILE A 48 ? N ILE A 48 # _atom_sites.entry_id 2LTL _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 CYS 71 71 71 CYS CYS A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 MET 78 78 78 MET MET A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 MET 91 91 91 MET MET A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 HIS 93 93 93 HIS HIS A . n A 1 94 TRP 94 94 94 TRP TRP A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 GLU 119 119 119 GLU GLU A . n # loop_ _pdbx_SG_project.full_name_of_center _pdbx_SG_project.id _pdbx_SG_project.initial_of_center _pdbx_SG_project.project_name 'Northeast Structural Genomics Consortium' 1 NESG PSI:Biology 'Mitochondrial Protein Partnership' 2 MPP PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-07-25 2 'Structure model' 1 1 2012-08-01 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' 6 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id YR313A.037-1 1.027 ? mM '[U-100% 13C; U-100% 15N]' 1 NaCl-2 450 ? mM ? 1 Na2PO4-3 25 ? mM ? 1 DTT-4 10 ? mM ? 1 ZnSO4-5 20 ? uM ? 1 'Proteinase inhibitors-6' 1 ? % ? 1 NaN3-7 0.02 ? % ? 1 D2O-8 5 ? % ? 1 YR313A.040-9 0.52 ? mM '[U-10% 13C; U-100% 15N]' 2 NaCl-10 450 ? mM ? 2 Na2PO4-11 25 ? mM ? 2 DTT-12 10 ? mM ? 2 ZnSO4-13 20 ? uM ? 2 'Proteinase inhibitors-14' 1 ? % ? 2 NaN3-15 0.02 ? % ? 2 D2O-16 5 ? % ? 2 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 3 ? ? -66.12 99.40 2 1 ASP A 36 ? ? -174.26 -58.59 3 1 LYS A 118 ? ? -53.69 88.63 4 2 HIS A 5 ? ? -150.92 84.35 5 2 HIS A 6 ? ? -161.59 87.65 6 2 MET A 11 ? ? -160.94 119.99 7 2 GLN A 14 ? ? -84.20 33.32 8 2 ASP A 36 ? ? -137.16 -156.14 9 2 GLN A 41 ? ? -116.28 -106.11 10 2 SER A 117 ? ? -66.96 89.74 11 2 LYS A 118 ? ? -68.86 93.31 12 3 HIS A 4 ? ? -74.32 -78.21 13 3 ASP A 36 ? ? -93.58 -64.30 14 3 GLN A 41 ? ? -129.64 -156.06 15 3 THR A 42 ? ? -67.32 -146.76 16 3 LYS A 118 ? ? -142.30 37.18 17 4 HIS A 10 ? ? -66.18 97.70 18 4 GLN A 14 ? ? -65.59 91.99 19 4 ARG A 43 ? ? -57.50 97.02 20 4 SER A 117 ? ? -104.43 -87.69 21 5 HIS A 8 ? ? -158.79 44.14 22 5 SER A 13 ? ? -79.32 33.90 23 5 ILE A 116 ? ? -140.49 -59.67 24 5 LYS A 118 ? ? -87.67 41.20 25 6 HIS A 5 ? ? -127.53 -73.37 26 6 HIS A 7 ? ? -64.31 95.64 27 6 GLU A 38 ? ? -59.29 92.06 28 6 ASP A 81 ? ? -73.13 -74.68 29 7 ASN A 12 ? ? -67.33 86.42 30 7 GLU A 113 ? ? -69.18 -70.46 31 8 HIS A 8 ? ? -160.78 78.42 32 8 SER A 9 ? ? -100.60 79.01 33 8 ARG A 43 ? ? 67.47 67.91 34 8 SER A 117 ? ? -59.42 105.33 35 9 HIS A 7 ? ? -164.66 94.16 36 9 ARG A 15 ? ? 62.18 79.38 37 9 GLN A 41 ? ? -103.97 -157.84 38 9 ILE A 116 ? ? -105.52 69.18 39 9 SER A 117 ? ? 62.72 157.15 40 9 LYS A 118 ? ? -159.23 11.35 41 10 HIS A 4 ? ? -113.44 78.54 42 10 GLN A 14 ? ? -160.66 115.08 43 10 LEU A 30 ? ? -160.74 118.82 44 10 ARG A 43 ? ? -55.58 107.58 45 10 SER A 45 ? ? -103.44 -168.57 46 10 PRO A 72 ? ? -67.25 1.95 47 11 ARG A 43 ? ? -51.29 97.83 48 12 HIS A 6 ? ? -162.13 108.93 49 12 HIS A 7 ? ? -163.75 73.77 50 12 HIS A 8 ? ? -163.68 20.31 51 12 ARG A 43 ? ? -58.50 -5.04 52 12 GLU A 113 ? ? -160.85 -60.18 53 13 HIS A 4 ? ? -170.75 144.11 54 13 ASP A 36 ? ? 57.99 73.79 55 13 PRO A 72 ? ? -69.91 2.64 56 13 SER A 117 ? ? -148.31 -86.50 57 13 LYS A 118 ? ? -139.22 -50.05 58 14 SER A 9 ? ? -58.92 98.52 59 14 PRO A 25 ? ? -75.81 43.77 60 14 ASP A 81 ? ? -149.32 -57.68 61 14 SER A 117 ? ? -99.29 -157.68 62 15 HIS A 7 ? ? -68.94 99.49 63 15 SER A 13 ? ? -64.75 92.39 64 15 HIS A 18 ? ? -62.86 99.73 65 15 ASP A 36 ? ? 62.26 74.87 66 15 THR A 42 ? ? -83.87 31.94 67 15 ARG A 43 ? ? 62.77 -78.19 68 15 SER A 47 ? ? -69.68 97.74 69 16 PRO A 25 ? ? -79.29 30.85 70 16 ASN A 28 ? ? 70.49 -6.46 71 16 GLU A 113 ? ? -131.85 -60.17 72 16 ILE A 116 ? ? -92.06 -80.51 73 17 HIS A 4 ? ? -162.27 108.65 74 17 HIS A 5 ? ? -156.36 41.02 75 17 HIS A 8 ? ? -175.01 121.53 76 17 GLN A 41 ? ? -132.50 -84.77 77 18 SER A 9 ? ? -154.16 87.92 78 18 ASP A 54 ? ? -111.38 79.27 79 19 GLN A 14 ? ? -62.48 87.45 80 19 ARG A 15 ? ? -113.60 69.83 81 19 GLU A 38 ? ? -68.06 96.76 82 19 ILE A 116 ? ? -96.46 -71.63 83 20 HIS A 7 ? ? 40.29 79.80 84 20 SER A 9 ? ? -66.99 96.27 85 20 GLN A 41 ? ? -114.84 -91.90 86 20 THR A 42 ? ? 176.44 155.65 #