data_2LUV # _entry.id 2LUV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LUV pdb_00002luv 10.2210/pdb2luv/pdb RCSB RCSB102862 ? ? BMRB 18542 ? 10.13018/BMR18542 WWPDB D_1000102862 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-07-04 2 'Structure model' 1 1 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_nmr_software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LUV _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2012-06-21 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2LKE PDB 'Myristoylated alphaM in Dodecylphospholine micelles' unspecified 2LKJ PDB 'Myristoylated alphaM SER phosphorylated in Dodecylphospholine micelles' unspecified 18542 BMRB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chua, G.L.' 1 'Tang, X.' 2 'Patra, T.A.' 3 'Tan, S.M.' 4 'Bhattacharjya, S.' 5 # _citation.id primary _citation.title 'Structure and Binding Interface of the Cytosolic Tails of aXb2 Integrin' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chua, G.L.' 1 ? primary 'Tang, X.' 2 ? primary 'Patra, T.A.' 3 ? primary 'Tan, S.M.' 4 ? primary 'Bhattacharjya, S.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Integrin alpha-X' _entity.formula_weight 3960.423 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Cytoplasmic domain, UNP residues 1129-1163' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CD11 antigen-like family member C, Leu M5, Leukocyte adhesion glycoprotein p150,95 alpha chain, Leukocyte adhesion receptor p150,95' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code KVGFFKRQYKEMMEEANGQIAPENGTQTPSPPSEK _entity_poly.pdbx_seq_one_letter_code_can KVGFFKRQYKEMMEEANGQIAPENGTQTPSPPSEK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 VAL n 1 3 GLY n 1 4 PHE n 1 5 PHE n 1 6 LYS n 1 7 ARG n 1 8 GLN n 1 9 TYR n 1 10 LYS n 1 11 GLU n 1 12 MET n 1 13 MET n 1 14 GLU n 1 15 GLU n 1 16 ALA n 1 17 ASN n 1 18 GLY n 1 19 GLN n 1 20 ILE n 1 21 ALA n 1 22 PRO n 1 23 GLU n 1 24 ASN n 1 25 GLY n 1 26 THR n 1 27 GLN n 1 28 THR n 1 29 PRO n 1 30 SER n 1 31 PRO n 1 32 PRO n 1 33 SER n 1 34 GLU n 1 35 LYS n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 LYS 35 35 35 LYS LYS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LUV _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LUV _struct.title 'Structure and Binding Interface of the Cytosolic Tails of aXb2 Integrin' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LUV _struct_keywords.pdbx_keywords 'CELL ADHESION' _struct_keywords.text 'MYRISTOYLATED, DPC MICELLES, CELL ADHESION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ITAX_HUMAN _struct_ref.pdbx_db_accession P20702 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KVGFFKRQYKEMMEEANGQIAPENGTQTPSPPSEK _struct_ref.pdbx_align_begin 1129 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LUV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 35 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P20702 _struct_ref_seq.db_align_beg 1129 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1163 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 35 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PHE _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 4 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 17 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PHE _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 4 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 17 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 2 ? ? -155.01 -40.05 2 1 ASN A 24 ? ? -55.10 104.25 3 1 PRO A 29 ? ? -69.81 64.96 4 2 VAL A 2 ? ? -155.12 -39.71 5 2 ASN A 24 ? ? -51.87 104.79 6 2 PRO A 29 ? ? -69.75 66.57 7 3 VAL A 2 ? ? -155.04 -39.55 8 3 ASN A 24 ? ? -55.95 104.10 9 3 THR A 28 ? ? -47.73 155.49 10 3 PRO A 29 ? ? -69.74 68.91 11 4 VAL A 2 ? ? -154.73 -39.87 12 4 ASN A 24 ? ? -54.41 104.01 13 4 THR A 28 ? ? -47.76 155.51 14 4 PRO A 29 ? ? -69.76 68.95 15 5 VAL A 2 ? ? -155.03 -39.62 16 5 ASN A 24 ? ? -55.47 104.13 17 5 THR A 28 ? ? -47.76 155.45 18 5 PRO A 29 ? ? -69.75 69.02 19 5 PRO A 32 ? ? -69.75 87.65 20 6 VAL A 2 ? ? -154.99 -39.73 21 6 ASN A 24 ? ? -55.04 104.21 22 6 PRO A 29 ? ? -69.74 64.97 23 7 VAL A 2 ? ? -155.05 -39.76 24 7 ASN A 24 ? ? -55.95 104.10 25 7 PRO A 29 ? ? -69.73 64.43 26 7 PRO A 32 ? ? -69.79 -171.48 27 8 VAL A 2 ? ? -154.69 -39.84 28 8 ASN A 24 ? ? -51.78 104.71 29 8 PRO A 29 ? ? -69.73 66.61 30 9 VAL A 2 ? ? -154.61 -39.44 31 9 ASN A 24 ? ? -55.19 104.17 32 9 PRO A 29 ? ? -69.79 64.98 33 10 VAL A 2 ? ? -155.16 -39.73 34 10 ASN A 24 ? ? -51.91 103.87 35 10 THR A 26 ? ? -93.10 -66.74 36 10 PRO A 29 ? ? -69.72 65.32 37 11 VAL A 2 ? ? -154.46 -39.40 38 11 ASN A 24 ? ? -53.96 104.12 39 11 THR A 28 ? ? -47.75 155.49 40 11 PRO A 29 ? ? -69.75 68.92 41 12 VAL A 2 ? ? -154.66 -39.94 42 12 ASN A 24 ? ? -50.45 103.60 43 12 THR A 28 ? ? -47.77 155.36 44 12 PRO A 29 ? ? -69.77 69.64 45 13 VAL A 2 ? ? -155.09 -39.66 46 13 ASN A 24 ? ? -49.96 103.68 47 13 THR A 28 ? ? -47.87 155.33 48 13 PRO A 29 ? ? -69.74 69.48 49 13 PRO A 32 ? ? -69.77 89.09 50 14 VAL A 2 ? ? -155.11 -39.70 51 14 THR A 28 ? ? -47.54 155.64 52 14 PRO A 29 ? ? -69.77 68.64 53 15 VAL A 2 ? ? -143.40 -36.86 54 15 ASN A 24 ? ? -54.57 104.13 55 15 THR A 28 ? ? -47.79 155.54 56 15 PRO A 29 ? ? -69.78 68.94 57 16 VAL A 2 ? ? -142.99 -36.70 58 16 ASN A 24 ? ? -52.58 104.19 59 16 THR A 28 ? ? -47.35 155.84 60 16 PRO A 29 ? ? -69.77 67.74 61 17 VAL A 2 ? ? -154.49 -39.44 62 17 ASN A 24 ? ? -49.58 103.55 63 17 THR A 26 ? ? -92.76 -69.69 64 17 PRO A 29 ? ? -69.77 65.34 65 18 VAL A 2 ? ? -142.99 -36.78 66 18 ASN A 24 ? ? -54.49 104.01 67 18 THR A 28 ? ? -47.83 155.52 68 18 PRO A 29 ? ? -69.81 68.91 69 19 VAL A 2 ? ? -143.62 -36.84 70 19 ASN A 24 ? ? -54.49 104.11 71 19 THR A 28 ? ? -47.72 155.52 72 19 PRO A 29 ? ? -69.79 68.93 73 20 VAL A 2 ? ? -143.30 -36.53 74 20 ASN A 24 ? ? -51.83 104.34 75 20 PRO A 29 ? ? -69.70 65.00 # _pdbx_entry_details.entry_id 2LUV _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details 'THIS PEPTIDE IS CHEMICALLY SYNTHESIZED WITH A N-TERMINAL MYRISTATE GROUP.' _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation 8.9 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LUV _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 0 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 8.9 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0 _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0 _pdbx_nmr_ensemble_rms.entry_id 2LUV _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LUV _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '200mM [U-99% 2H] DPC-1, 10mM sodium phosphate-2, 10% [U-100% 2H] D2O-3, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '200mM [U-99% 2H] DPC-4, 10mM sodium phosphate-5, 100% [U-100% 2H] D2O-6, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id DPC-1 200 ? mM '[U-99% 2H]' 1 'sodium phosphate-2' 10 ? mM ? 1 D2O-3 10 ? % '[U-100% 2H]' 1 DPC-4 200 ? mM '[U-99% 2H]' 2 'sodium phosphate-5' 10 ? mM ? 2 D2O-6 100 ? % '[U-100% 2H]' 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pH 5.6 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H TOCSY' 1 2 1 '2D 1H-1H NOESY' 1 3 2 '2D 1H-13C HSQC' 1 4 2 '2D 1H-1H NOESY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LUV _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 263 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 74 _pdbx_nmr_constraints.NOE_long_range_total_count 3 _pdbx_nmr_constraints.NOE_medium_range_total_count 96 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 90 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 29 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 28 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Bruker Biospin' collection TopSpin 1 2.1 'Bruker Biospin' processing TopSpin 2 2.1 Goddard 'chemical shift assignment' Sparky 3 ? 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 4 2.0 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 5 2.0 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 GLN N N N N 58 GLN CA C N S 59 GLN C C N N 60 GLN O O N N 61 GLN CB C N N 62 GLN CG C N N 63 GLN CD C N N 64 GLN OE1 O N N 65 GLN NE2 N N N 66 GLN OXT O N N 67 GLN H H N N 68 GLN H2 H N N 69 GLN HA H N N 70 GLN HB2 H N N 71 GLN HB3 H N N 72 GLN HG2 H N N 73 GLN HG3 H N N 74 GLN HE21 H N N 75 GLN HE22 H N N 76 GLN HXT H N N 77 GLU N N N N 78 GLU CA C N S 79 GLU C C N N 80 GLU O O N N 81 GLU CB C N N 82 GLU CG C N N 83 GLU CD C N N 84 GLU OE1 O N N 85 GLU OE2 O N N 86 GLU OXT O N N 87 GLU H H N N 88 GLU H2 H N N 89 GLU HA H N N 90 GLU HB2 H N N 91 GLU HB3 H N N 92 GLU HG2 H N N 93 GLU HG3 H N N 94 GLU HE2 H N N 95 GLU HXT H N N 96 GLY N N N N 97 GLY CA C N N 98 GLY C C N N 99 GLY O O N N 100 GLY OXT O N N 101 GLY H H N N 102 GLY H2 H N N 103 GLY HA2 H N N 104 GLY HA3 H N N 105 GLY HXT H N N 106 ILE N N N N 107 ILE CA C N S 108 ILE C C N N 109 ILE O O N N 110 ILE CB C N S 111 ILE CG1 C N N 112 ILE CG2 C N N 113 ILE CD1 C N N 114 ILE OXT O N N 115 ILE H H N N 116 ILE H2 H N N 117 ILE HA H N N 118 ILE HB H N N 119 ILE HG12 H N N 120 ILE HG13 H N N 121 ILE HG21 H N N 122 ILE HG22 H N N 123 ILE HG23 H N N 124 ILE HD11 H N N 125 ILE HD12 H N N 126 ILE HD13 H N N 127 ILE HXT H N N 128 LYS N N N N 129 LYS CA C N S 130 LYS C C N N 131 LYS O O N N 132 LYS CB C N N 133 LYS CG C N N 134 LYS CD C N N 135 LYS CE C N N 136 LYS NZ N N N 137 LYS OXT O N N 138 LYS H H N N 139 LYS H2 H N N 140 LYS HA H N N 141 LYS HB2 H N N 142 LYS HB3 H N N 143 LYS HG2 H N N 144 LYS HG3 H N N 145 LYS HD2 H N N 146 LYS HD3 H N N 147 LYS HE2 H N N 148 LYS HE3 H N N 149 LYS HZ1 H N N 150 LYS HZ2 H N N 151 LYS HZ3 H N N 152 LYS HXT H N N 153 MET N N N N 154 MET CA C N S 155 MET C C N N 156 MET O O N N 157 MET CB C N N 158 MET CG C N N 159 MET SD S N N 160 MET CE C N N 161 MET OXT O N N 162 MET H H N N 163 MET H2 H N N 164 MET HA H N N 165 MET HB2 H N N 166 MET HB3 H N N 167 MET HG2 H N N 168 MET HG3 H N N 169 MET HE1 H N N 170 MET HE2 H N N 171 MET HE3 H N N 172 MET HXT H N N 173 PHE N N N N 174 PHE CA C N S 175 PHE C C N N 176 PHE O O N N 177 PHE CB C N N 178 PHE CG C Y N 179 PHE CD1 C Y N 180 PHE CD2 C Y N 181 PHE CE1 C Y N 182 PHE CE2 C Y N 183 PHE CZ C Y N 184 PHE OXT O N N 185 PHE H H N N 186 PHE H2 H N N 187 PHE HA H N N 188 PHE HB2 H N N 189 PHE HB3 H N N 190 PHE HD1 H N N 191 PHE HD2 H N N 192 PHE HE1 H N N 193 PHE HE2 H N N 194 PHE HZ H N N 195 PHE HXT H N N 196 PRO N N N N 197 PRO CA C N S 198 PRO C C N N 199 PRO O O N N 200 PRO CB C N N 201 PRO CG C N N 202 PRO CD C N N 203 PRO OXT O N N 204 PRO H H N N 205 PRO HA H N N 206 PRO HB2 H N N 207 PRO HB3 H N N 208 PRO HG2 H N N 209 PRO HG3 H N N 210 PRO HD2 H N N 211 PRO HD3 H N N 212 PRO HXT H N N 213 SER N N N N 214 SER CA C N S 215 SER C C N N 216 SER O O N N 217 SER CB C N N 218 SER OG O N N 219 SER OXT O N N 220 SER H H N N 221 SER H2 H N N 222 SER HA H N N 223 SER HB2 H N N 224 SER HB3 H N N 225 SER HG H N N 226 SER HXT H N N 227 THR N N N N 228 THR CA C N S 229 THR C C N N 230 THR O O N N 231 THR CB C N R 232 THR OG1 O N N 233 THR CG2 C N N 234 THR OXT O N N 235 THR H H N N 236 THR H2 H N N 237 THR HA H N N 238 THR HB H N N 239 THR HG1 H N N 240 THR HG21 H N N 241 THR HG22 H N N 242 THR HG23 H N N 243 THR HXT H N N 244 TYR N N N N 245 TYR CA C N S 246 TYR C C N N 247 TYR O O N N 248 TYR CB C N N 249 TYR CG C Y N 250 TYR CD1 C Y N 251 TYR CD2 C Y N 252 TYR CE1 C Y N 253 TYR CE2 C Y N 254 TYR CZ C Y N 255 TYR OH O N N 256 TYR OXT O N N 257 TYR H H N N 258 TYR H2 H N N 259 TYR HA H N N 260 TYR HB2 H N N 261 TYR HB3 H N N 262 TYR HD1 H N N 263 TYR HD2 H N N 264 TYR HE1 H N N 265 TYR HE2 H N N 266 TYR HH H N N 267 TYR HXT H N N 268 VAL N N N N 269 VAL CA C N S 270 VAL C C N N 271 VAL O O N N 272 VAL CB C N N 273 VAL CG1 C N N 274 VAL CG2 C N N 275 VAL OXT O N N 276 VAL H H N N 277 VAL H2 H N N 278 VAL HA H N N 279 VAL HB H N N 280 VAL HG11 H N N 281 VAL HG12 H N N 282 VAL HG13 H N N 283 VAL HG21 H N N 284 VAL HG22 H N N 285 VAL HG23 H N N 286 VAL HXT H N N 287 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 GLN N CA sing N N 55 GLN N H sing N N 56 GLN N H2 sing N N 57 GLN CA C sing N N 58 GLN CA CB sing N N 59 GLN CA HA sing N N 60 GLN C O doub N N 61 GLN C OXT sing N N 62 GLN CB CG sing N N 63 GLN CB HB2 sing N N 64 GLN CB HB3 sing N N 65 GLN CG CD sing N N 66 GLN CG HG2 sing N N 67 GLN CG HG3 sing N N 68 GLN CD OE1 doub N N 69 GLN CD NE2 sing N N 70 GLN NE2 HE21 sing N N 71 GLN NE2 HE22 sing N N 72 GLN OXT HXT sing N N 73 GLU N CA sing N N 74 GLU N H sing N N 75 GLU N H2 sing N N 76 GLU CA C sing N N 77 GLU CA CB sing N N 78 GLU CA HA sing N N 79 GLU C O doub N N 80 GLU C OXT sing N N 81 GLU CB CG sing N N 82 GLU CB HB2 sing N N 83 GLU CB HB3 sing N N 84 GLU CG CD sing N N 85 GLU CG HG2 sing N N 86 GLU CG HG3 sing N N 87 GLU CD OE1 doub N N 88 GLU CD OE2 sing N N 89 GLU OE2 HE2 sing N N 90 GLU OXT HXT sing N N 91 GLY N CA sing N N 92 GLY N H sing N N 93 GLY N H2 sing N N 94 GLY CA C sing N N 95 GLY CA HA2 sing N N 96 GLY CA HA3 sing N N 97 GLY C O doub N N 98 GLY C OXT sing N N 99 GLY OXT HXT sing N N 100 ILE N CA sing N N 101 ILE N H sing N N 102 ILE N H2 sing N N 103 ILE CA C sing N N 104 ILE CA CB sing N N 105 ILE CA HA sing N N 106 ILE C O doub N N 107 ILE C OXT sing N N 108 ILE CB CG1 sing N N 109 ILE CB CG2 sing N N 110 ILE CB HB sing N N 111 ILE CG1 CD1 sing N N 112 ILE CG1 HG12 sing N N 113 ILE CG1 HG13 sing N N 114 ILE CG2 HG21 sing N N 115 ILE CG2 HG22 sing N N 116 ILE CG2 HG23 sing N N 117 ILE CD1 HD11 sing N N 118 ILE CD1 HD12 sing N N 119 ILE CD1 HD13 sing N N 120 ILE OXT HXT sing N N 121 LYS N CA sing N N 122 LYS N H sing N N 123 LYS N H2 sing N N 124 LYS CA C sing N N 125 LYS CA CB sing N N 126 LYS CA HA sing N N 127 LYS C O doub N N 128 LYS C OXT sing N N 129 LYS CB CG sing N N 130 LYS CB HB2 sing N N 131 LYS CB HB3 sing N N 132 LYS CG CD sing N N 133 LYS CG HG2 sing N N 134 LYS CG HG3 sing N N 135 LYS CD CE sing N N 136 LYS CD HD2 sing N N 137 LYS CD HD3 sing N N 138 LYS CE NZ sing N N 139 LYS CE HE2 sing N N 140 LYS CE HE3 sing N N 141 LYS NZ HZ1 sing N N 142 LYS NZ HZ2 sing N N 143 LYS NZ HZ3 sing N N 144 LYS OXT HXT sing N N 145 MET N CA sing N N 146 MET N H sing N N 147 MET N H2 sing N N 148 MET CA C sing N N 149 MET CA CB sing N N 150 MET CA HA sing N N 151 MET C O doub N N 152 MET C OXT sing N N 153 MET CB CG sing N N 154 MET CB HB2 sing N N 155 MET CB HB3 sing N N 156 MET CG SD sing N N 157 MET CG HG2 sing N N 158 MET CG HG3 sing N N 159 MET SD CE sing N N 160 MET CE HE1 sing N N 161 MET CE HE2 sing N N 162 MET CE HE3 sing N N 163 MET OXT HXT sing N N 164 PHE N CA sing N N 165 PHE N H sing N N 166 PHE N H2 sing N N 167 PHE CA C sing N N 168 PHE CA CB sing N N 169 PHE CA HA sing N N 170 PHE C O doub N N 171 PHE C OXT sing N N 172 PHE CB CG sing N N 173 PHE CB HB2 sing N N 174 PHE CB HB3 sing N N 175 PHE CG CD1 doub Y N 176 PHE CG CD2 sing Y N 177 PHE CD1 CE1 sing Y N 178 PHE CD1 HD1 sing N N 179 PHE CD2 CE2 doub Y N 180 PHE CD2 HD2 sing N N 181 PHE CE1 CZ doub Y N 182 PHE CE1 HE1 sing N N 183 PHE CE2 CZ sing Y N 184 PHE CE2 HE2 sing N N 185 PHE CZ HZ sing N N 186 PHE OXT HXT sing N N 187 PRO N CA sing N N 188 PRO N CD sing N N 189 PRO N H sing N N 190 PRO CA C sing N N 191 PRO CA CB sing N N 192 PRO CA HA sing N N 193 PRO C O doub N N 194 PRO C OXT sing N N 195 PRO CB CG sing N N 196 PRO CB HB2 sing N N 197 PRO CB HB3 sing N N 198 PRO CG CD sing N N 199 PRO CG HG2 sing N N 200 PRO CG HG3 sing N N 201 PRO CD HD2 sing N N 202 PRO CD HD3 sing N N 203 PRO OXT HXT sing N N 204 SER N CA sing N N 205 SER N H sing N N 206 SER N H2 sing N N 207 SER CA C sing N N 208 SER CA CB sing N N 209 SER CA HA sing N N 210 SER C O doub N N 211 SER C OXT sing N N 212 SER CB OG sing N N 213 SER CB HB2 sing N N 214 SER CB HB3 sing N N 215 SER OG HG sing N N 216 SER OXT HXT sing N N 217 THR N CA sing N N 218 THR N H sing N N 219 THR N H2 sing N N 220 THR CA C sing N N 221 THR CA CB sing N N 222 THR CA HA sing N N 223 THR C O doub N N 224 THR C OXT sing N N 225 THR CB OG1 sing N N 226 THR CB CG2 sing N N 227 THR CB HB sing N N 228 THR OG1 HG1 sing N N 229 THR CG2 HG21 sing N N 230 THR CG2 HG22 sing N N 231 THR CG2 HG23 sing N N 232 THR OXT HXT sing N N 233 TYR N CA sing N N 234 TYR N H sing N N 235 TYR N H2 sing N N 236 TYR CA C sing N N 237 TYR CA CB sing N N 238 TYR CA HA sing N N 239 TYR C O doub N N 240 TYR C OXT sing N N 241 TYR CB CG sing N N 242 TYR CB HB2 sing N N 243 TYR CB HB3 sing N N 244 TYR CG CD1 doub Y N 245 TYR CG CD2 sing Y N 246 TYR CD1 CE1 sing Y N 247 TYR CD1 HD1 sing N N 248 TYR CD2 CE2 doub Y N 249 TYR CD2 HD2 sing N N 250 TYR CE1 CZ doub Y N 251 TYR CE1 HE1 sing N N 252 TYR CE2 CZ sing Y N 253 TYR CE2 HE2 sing N N 254 TYR CZ OH sing N N 255 TYR OH HH sing N N 256 TYR OXT HXT sing N N 257 VAL N CA sing N N 258 VAL N H sing N N 259 VAL N H2 sing N N 260 VAL CA C sing N N 261 VAL CA CB sing N N 262 VAL CA HA sing N N 263 VAL C O doub N N 264 VAL C OXT sing N N 265 VAL CB CG1 sing N N 266 VAL CB CG2 sing N N 267 VAL CB HB sing N N 268 VAL CG1 HG11 sing N N 269 VAL CG1 HG12 sing N N 270 VAL CG1 HG13 sing N N 271 VAL CG2 HG21 sing N N 272 VAL CG2 HG22 sing N N 273 VAL CG2 HG23 sing N N 274 VAL OXT HXT sing N N 275 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DRX' # _atom_sites.entry_id 2LUV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_