data_2LV7
# 
_entry.id   2LV7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.392 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2LV7         pdb_00002lv7 10.2210/pdb2lv7/pdb 
RCSB  RCSB102874   ?            ?                   
BMRB  18557        ?            10.13018/BMR18557   
WWPDB D_1000102874 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-09-26 
2 'Structure model' 1 1 2012-11-21 
3 'Structure model' 1 2 2023-06-14 
4 'Structure model' 1 3 2024-05-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 3 'Structure model' 'Data collection'      
3 3 'Structure model' 'Database references'  
4 3 'Structure model' 'Derived calculations' 
5 3 'Structure model' Other                  
6 4 'Structure model' 'Data collection'      
7 4 'Structure model' 'Database references'  
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' database_2             
2 3 'Structure model' pdbx_database_status   
3 3 'Structure model' pdbx_nmr_spectrometer  
4 3 'Structure model' pdbx_struct_conn_angle 
5 3 'Structure model' struct_conn            
6 3 'Structure model' struct_site            
7 4 'Structure model' chem_comp_atom         
8 4 'Structure model' chem_comp_bond         
9 4 'Structure model' database_2             
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_database_2.pdbx_DOI'                        
2  3 'Structure model' '_database_2.pdbx_database_accession'         
3  3 'Structure model' '_pdbx_database_status.status_code_nmr_data'  
4  3 'Structure model' '_pdbx_nmr_spectrometer.model'                
5  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
6  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
7  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
8  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
9  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id'   
11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
17 3 'Structure model' '_pdbx_struct_conn_angle.value'               
18 3 'Structure model' '_struct_conn.pdbx_dist_value'                
19 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
20 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
21 3 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
22 3 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
23 3 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
24 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
25 3 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
26 3 'Structure model' '_struct_site.pdbx_auth_asym_id'              
27 3 'Structure model' '_struct_site.pdbx_auth_comp_id'              
28 3 'Structure model' '_struct_site.pdbx_auth_seq_id'               
29 4 'Structure model' '_database_2.pdbx_DOI'                        
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2LV7 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-06-29 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            REL 
# 
_pdbx_database_related.db_id          18557 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mccue, H.V.'    1 
'Patel, P.'      2 
'Herbert, A.P.'  3 
'Lian, L.'       4 
'Burgoyne, R.D.' 5 
'Haynes, L.P.'   6 
# 
_citation.id                        primary 
_citation.title                     
'Solution NMR Structure of the Ca2+-bound N-terminal Domain of CaBP7: A REGULATOR OF GOLGI TRAFFICKING.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            287 
_citation.page_first                38231 
_citation.page_last                 38243 
_citation.year                      2012 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22989873 
_citation.pdbx_database_id_DOI      10.1074/jbc.M112.402289 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'McCue, H.V.'    1 ? 
primary 'Patel, P.'      2 ? 
primary 'Herbert, A.P.'  3 ? 
primary 'Lian, L.Y.'     4 ? 
primary 'Burgoyne, R.D.' 5 ? 
primary 'Haynes, L.P.'   6 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Calcium-binding protein 7' 11400.866 1 ? ? 'N-terminal residues 1-100' ? 
2 non-polymer syn 'CALCIUM ION'               40.078    2 ? ? ?                           ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'CaBP7, Calneuron II, Calneuron-2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MPFHPVTAALMYRGIYTVPNLLSEQRPVDIPEDELEEIREAFKVFDRDGNGFISKQELGTAMRSLGYMPNEVELEVIIQR
LDMDGDGQVDFEEFVTLLGP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPFHPVTAALMYRGIYTVPNLLSEQRPVDIPEDELEEIREAFKVFDRDGNGFISKQELGTAMRSLGYMPNEVELEVIIQR
LDMDGDGQVDFEEFVTLLGP
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'CALCIUM ION' 
_pdbx_entity_nonpoly.comp_id     CA 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   PHE n 
1 4   HIS n 
1 5   PRO n 
1 6   VAL n 
1 7   THR n 
1 8   ALA n 
1 9   ALA n 
1 10  LEU n 
1 11  MET n 
1 12  TYR n 
1 13  ARG n 
1 14  GLY n 
1 15  ILE n 
1 16  TYR n 
1 17  THR n 
1 18  VAL n 
1 19  PRO n 
1 20  ASN n 
1 21  LEU n 
1 22  LEU n 
1 23  SER n 
1 24  GLU n 
1 25  GLN n 
1 26  ARG n 
1 27  PRO n 
1 28  VAL n 
1 29  ASP n 
1 30  ILE n 
1 31  PRO n 
1 32  GLU n 
1 33  ASP n 
1 34  GLU n 
1 35  LEU n 
1 36  GLU n 
1 37  GLU n 
1 38  ILE n 
1 39  ARG n 
1 40  GLU n 
1 41  ALA n 
1 42  PHE n 
1 43  LYS n 
1 44  VAL n 
1 45  PHE n 
1 46  ASP n 
1 47  ARG n 
1 48  ASP n 
1 49  GLY n 
1 50  ASN n 
1 51  GLY n 
1 52  PHE n 
1 53  ILE n 
1 54  SER n 
1 55  LYS n 
1 56  GLN n 
1 57  GLU n 
1 58  LEU n 
1 59  GLY n 
1 60  THR n 
1 61  ALA n 
1 62  MET n 
1 63  ARG n 
1 64  SER n 
1 65  LEU n 
1 66  GLY n 
1 67  TYR n 
1 68  MET n 
1 69  PRO n 
1 70  ASN n 
1 71  GLU n 
1 72  VAL n 
1 73  GLU n 
1 74  LEU n 
1 75  GLU n 
1 76  VAL n 
1 77  ILE n 
1 78  ILE n 
1 79  GLN n 
1 80  ARG n 
1 81  LEU n 
1 82  ASP n 
1 83  MET n 
1 84  ASP n 
1 85  GLY n 
1 86  ASP n 
1 87  GLY n 
1 88  GLN n 
1 89  VAL n 
1 90  ASP n 
1 91  PHE n 
1 92  GLU n 
1 93  GLU n 
1 94  PHE n 
1 95  VAL n 
1 96  THR n 
1 97  LEU n 
1 98  LEU n 
1 99  GLY n 
1 100 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CABP7, CALN2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               'pE-Sumo Vector, T7, Kan' 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   PRO 2   2   2   PRO PRO A . n 
A 1 3   PHE 3   3   3   PHE PHE A . n 
A 1 4   HIS 4   4   4   HIS HIS A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   ALA 8   8   8   ALA ALA A . n 
A 1 9   ALA 9   9   9   ALA ALA A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  MET 11  11  11  MET MET A . n 
A 1 12  TYR 12  12  12  TYR TYR A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  ILE 15  15  15  ILE ILE A . n 
A 1 16  TYR 16  16  16  TYR TYR A . n 
A 1 17  THR 17  17  17  THR THR A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  PRO 19  19  19  PRO PRO A . n 
A 1 20  ASN 20  20  20  ASN ASN A . n 
A 1 21  LEU 21  21  21  LEU LEU A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  SER 23  23  23  SER SER A . n 
A 1 24  GLU 24  24  24  GLU GLU A . n 
A 1 25  GLN 25  25  25  GLN GLN A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  PRO 27  27  27  PRO PRO A . n 
A 1 28  VAL 28  28  28  VAL VAL A . n 
A 1 29  ASP 29  29  29  ASP ASP A . n 
A 1 30  ILE 30  30  30  ILE ILE A . n 
A 1 31  PRO 31  31  31  PRO PRO A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  ASP 33  33  33  ASP ASP A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  LEU 35  35  35  LEU LEU A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  ILE 38  38  38  ILE ILE A . n 
A 1 39  ARG 39  39  39  ARG ARG A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  PHE 42  42  42  PHE PHE A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ASP 46  46  46  ASP ASP A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  ASP 48  48  48  ASP ASP A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  ASN 50  50  50  ASN ASN A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  PHE 52  52  52  PHE PHE A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  SER 54  54  54  SER SER A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  GLN 56  56  56  GLN GLN A . n 
A 1 57  GLU 57  57  57  GLU GLU A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  MET 62  62  62  MET MET A . n 
A 1 63  ARG 63  63  63  ARG ARG A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  TYR 67  67  67  TYR TYR A . n 
A 1 68  MET 68  68  68  MET MET A . n 
A 1 69  PRO 69  69  69  PRO PRO A . n 
A 1 70  ASN 70  70  70  ASN ASN A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  GLU 75  75  75  GLU GLU A . n 
A 1 76  VAL 76  76  76  VAL VAL A . n 
A 1 77  ILE 77  77  77  ILE ILE A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  GLN 79  79  79  GLN GLN A . n 
A 1 80  ARG 80  80  80  ARG ARG A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  ASP 84  84  84  ASP ASP A . n 
A 1 85  GLY 85  85  85  GLY GLY A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  GLN 88  88  88  GLN GLN A . n 
A 1 89  VAL 89  89  89  VAL VAL A . n 
A 1 90  ASP 90  90  90  ASP ASP A . n 
A 1 91  PHE 91  91  91  PHE PHE A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  PHE 94  94  94  PHE PHE A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  THR 96  96  96  THR THR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CA 1 201 101 CA CA2 A . 
C 2 CA 1 202 102 CA CA2 A . 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2LV7 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2LV7 
_struct.title                     'Solution structure of Ca2+-bound CaBP7 N-terminal doman' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2LV7 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            'calcium-binding protein, METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CABP7_HUMAN 
_struct_ref.pdbx_db_accession          Q86V35 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MPFHPVTAALMYRGIYTVPNLLSEQRPVDIPEDELEEIREAFKVFDRDGNGFISKQELGTAMRSLGYMPNEVELEVIIQR
LDMDGDGQVDFEEFVTLLGP
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2LV7 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 100 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q86V35 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  100 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       100 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 31 ? ASP A 33 ? PRO A 31 ASP A 33 5 ? 3  
HELX_P HELX_P2 2 GLU A 34 ? PHE A 45 ? GLU A 34 PHE A 45 1 ? 12 
HELX_P HELX_P3 3 SER A 54 ? LEU A 65 ? SER A 54 LEU A 65 1 ? 12 
HELX_P HELX_P4 4 GLU A 73 ? ASP A 82 ? GLU A 73 ASP A 82 1 ? 10 
HELX_P HELX_P5 5 ASP A 90 ? LEU A 98 ? ASP A 90 LEU A 98 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A ASP 46 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 46 A CA 201 1_555 ? ? ? ? ? ? ? 2.351 ? ? 
metalc2  metalc ? ? A ASP 48 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 48 A CA 201 1_555 ? ? ? ? ? ? ? 2.807 ? ? 
metalc3  metalc ? ? A ASN 50 OD1 ? ? ? 1_555 B CA . CA ? ? A ASN 50 A CA 201 1_555 ? ? ? ? ? ? ? 2.817 ? ? 
metalc4  metalc ? ? A PHE 52 O   ? ? ? 1_555 B CA . CA ? ? A PHE 52 A CA 201 1_555 ? ? ? ? ? ? ? 2.643 ? ? 
metalc5  metalc ? ? A GLU 57 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 57 A CA 201 1_555 ? ? ? ? ? ? ? 2.825 ? ? 
metalc6  metalc ? ? A GLU 57 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 57 A CA 201 1_555 ? ? ? ? ? ? ? 2.593 ? ? 
metalc7  metalc ? ? A ASP 82 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 82 A CA 202 1_555 ? ? ? ? ? ? ? 2.479 ? ? 
metalc8  metalc ? ? A ASP 84 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 84 A CA 202 1_555 ? ? ? ? ? ? ? 2.649 ? ? 
metalc9  metalc ? ? A ASP 86 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 86 A CA 202 1_555 ? ? ? ? ? ? ? 2.518 ? ? 
metalc10 metalc ? ? A GLN 88 O   ? ? ? 1_555 C CA . CA ? ? A GLN 88 A CA 202 1_555 ? ? ? ? ? ? ? 2.615 ? ? 
metalc11 metalc ? ? A GLU 93 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 93 A CA 202 1_555 ? ? ? ? ? ? ? 2.473 ? ? 
metalc12 metalc ? ? A GLU 93 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 93 A CA 202 1_555 ? ? ? ? ? ? ? 2.799 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 46 ? A ASP 46 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD2 ? A ASP 48 ? A ASP 48 ? 1_555 101.5 ? 
2  OD1 ? A ASP 46 ? A ASP 46 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASN 50 ? A ASN 50 ? 1_555 82.3  ? 
3  OD2 ? A ASP 48 ? A ASP 48 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASN 50 ? A ASN 50 ? 1_555 125.2 ? 
4  OD1 ? A ASP 46 ? A ASP 46 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O   ? A PHE 52 ? A PHE 52 ? 1_555 71.1  ? 
5  OD2 ? A ASP 48 ? A ASP 48 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O   ? A PHE 52 ? A PHE 52 ? 1_555 168.9 ? 
6  OD1 ? A ASN 50 ? A ASN 50 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O   ? A PHE 52 ? A PHE 52 ? 1_555 63.0  ? 
7  OD1 ? A ASP 46 ? A ASP 46 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 57 ? A GLU 57 ? 1_555 59.9  ? 
8  OD2 ? A ASP 48 ? A ASP 48 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 57 ? A GLU 57 ? 1_555 71.8  ? 
9  OD1 ? A ASN 50 ? A ASN 50 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 57 ? A GLU 57 ? 1_555 141.8 ? 
10 O   ? A PHE 52 ? A PHE 52 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 57 ? A GLU 57 ? 1_555 97.2  ? 
11 OD1 ? A ASP 46 ? A ASP 46 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 57 ? A GLU 57 ? 1_555 105.2 ? 
12 OD2 ? A ASP 48 ? A ASP 48 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 57 ? A GLU 57 ? 1_555 73.5  ? 
13 OD1 ? A ASN 50 ? A ASN 50 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 57 ? A GLU 57 ? 1_555 158.7 ? 
14 O   ? A PHE 52 ? A PHE 52 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 57 ? A GLU 57 ? 1_555 100.0 ? 
15 OE1 ? A GLU 57 ? A GLU 57 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 57 ? A GLU 57 ? 1_555 47.6  ? 
16 OD1 ? A ASP 82 ? A ASP 82 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 84 ? A ASP 84 ? 1_555 78.1  ? 
17 OD1 ? A ASP 82 ? A ASP 82 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 86 ? A ASP 86 ? 1_555 65.5  ? 
18 OD1 ? A ASP 84 ? A ASP 84 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 86 ? A ASP 86 ? 1_555 71.4  ? 
19 OD1 ? A ASP 82 ? A ASP 82 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O   ? A GLN 88 ? A GLN 88 ? 1_555 80.6  ? 
20 OD1 ? A ASP 84 ? A ASP 84 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O   ? A GLN 88 ? A GLN 88 ? 1_555 134.8 ? 
21 OD1 ? A ASP 86 ? A ASP 86 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O   ? A GLN 88 ? A GLN 88 ? 1_555 63.5  ? 
22 OD1 ? A ASP 82 ? A ASP 82 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 93 ? A GLU 93 ? 1_555 145.4 ? 
23 OD1 ? A ASP 84 ? A ASP 84 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 93 ? A GLU 93 ? 1_555 69.8  ? 
24 OD1 ? A ASP 86 ? A ASP 86 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 93 ? A GLU 93 ? 1_555 114.0 ? 
25 O   ? A GLN 88 ? A GLN 88 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 93 ? A GLU 93 ? 1_555 132.0 ? 
26 OD1 ? A ASP 82 ? A ASP 82 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 93 ? A GLU 93 ? 1_555 108.5 ? 
27 OD1 ? A ASP 84 ? A ASP 84 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 93 ? A GLU 93 ? 1_555 70.7  ? 
28 OD1 ? A ASP 86 ? A ASP 86 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 93 ? A GLU 93 ? 1_555 142.0 ? 
29 O   ? A GLN 88 ? A GLN 88 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 93 ? A GLU 93 ? 1_555 154.4 ? 
30 OE2 ? A GLU 93 ? A GLU 93 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 93 ? A GLU 93 ? 1_555 48.8  ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CA 201 ? 6 'BINDING SITE FOR RESIDUE CA A 201' 
AC2 Software A CA 202 ? 6 'BINDING SITE FOR RESIDUE CA A 202' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP A 46 ? ASP A 46 . ? 1_555 ? 
2  AC1 6 ASP A 48 ? ASP A 48 . ? 1_555 ? 
3  AC1 6 ASN A 50 ? ASN A 50 . ? 1_555 ? 
4  AC1 6 PHE A 52 ? PHE A 52 . ? 1_555 ? 
5  AC1 6 GLU A 57 ? GLU A 57 . ? 1_555 ? 
6  AC1 6 GLN A 88 ? GLN A 88 . ? 1_555 ? 
7  AC2 6 ASP A 82 ? ASP A 82 . ? 1_555 ? 
8  AC2 6 ASP A 84 ? ASP A 84 . ? 1_555 ? 
9  AC2 6 ASP A 86 ? ASP A 86 . ? 1_555 ? 
10 AC2 6 GLN A 88 ? GLN A 88 . ? 1_555 ? 
11 AC2 6 ASP A 90 ? ASP A 90 . ? 1_555 ? 
12 AC2 6 GLU A 93 ? GLU A 93 . ? 1_555 ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  VAL A 6  ? ? 62.94   113.09  
2   1  THR A 7  ? ? -123.45 -68.63  
3   1  ALA A 8  ? ? -172.96 118.27  
4   1  LEU A 10 ? ? -87.87  -156.20 
5   1  MET A 11 ? ? 66.44   106.60  
6   1  ARG A 13 ? ? -166.72 -58.44  
7   1  TYR A 16 ? ? -63.05  -82.67  
8   1  THR A 17 ? ? -171.41 -3.99   
9   1  PRO A 19 ? ? -90.11  -60.29  
10  1  ASN A 20 ? ? -141.86 59.21   
11  1  SER A 23 ? ? -106.72 -60.75  
12  1  GLN A 25 ? ? 60.20   -92.37  
13  1  ASP A 29 ? ? -175.01 119.88  
14  1  GLU A 32 ? ? -48.89  -11.20  
15  1  GLU A 40 ? ? -38.76  -29.32  
16  1  ALA A 41 ? ? -70.92  -82.18  
17  2  THR A 7  ? ? -175.25 127.71  
18  2  LEU A 10 ? ? 56.32   96.30   
19  2  ARG A 13 ? ? -166.47 117.60  
20  2  ASP A 33 ? ? -45.51  -70.32  
21  2  GLU A 40 ? ? -38.38  -31.85  
22  2  ALA A 41 ? ? -67.91  -83.68  
23  2  ASP A 82 ? ? -68.65  83.24   
24  3  VAL A 6  ? ? -94.66  -71.41  
25  3  PRO A 19 ? ? -39.90  -30.47  
26  3  ASN A 20 ? ? -94.03  47.38   
27  3  GLU A 40 ? ? -38.96  -31.62  
28  3  ALA A 41 ? ? -66.95  -81.76  
29  3  SER A 54 ? ? -66.09  -178.17 
30  4  PRO A 2  ? ? -65.50  87.98   
31  4  ALA A 9  ? ? -58.88  -70.34  
32  4  LEU A 10 ? ? 48.22   92.05   
33  4  MET A 11 ? ? -64.70  95.50   
34  4  THR A 17 ? ? -156.11 88.32   
35  4  ASN A 20 ? ? -170.66 84.47   
36  4  GLN A 25 ? ? 64.42   131.99  
37  4  ARG A 39 ? ? -68.00  -70.62  
38  4  GLU A 40 ? ? -39.06  -31.01  
39  4  ALA A 41 ? ? -64.52  -81.74  
40  4  SER A 54 ? ? -69.45  -178.57 
41  4  ASP A 82 ? ? -69.43  82.85   
42  5  THR A 7  ? ? -97.57  -60.08  
43  5  ALA A 9  ? ? -87.32  -70.21  
44  5  THR A 17 ? ? 35.76   46.79   
45  5  ASN A 20 ? ? -49.98  -86.86  
46  5  GLN A 25 ? ? 57.25   -109.50 
47  5  PRO A 27 ? ? -84.13  38.85   
48  5  VAL A 28 ? ? -54.80  108.28  
49  5  ASP A 29 ? ? -175.35 84.32   
50  5  ARG A 39 ? ? -68.27  -70.83  
51  5  GLU A 40 ? ? -38.83  -31.27  
52  5  ALA A 41 ? ? -68.91  -77.87  
53  5  ASP A 82 ? ? -68.71  88.25   
54  6  THR A 7  ? ? 64.15   88.09   
55  6  ARG A 13 ? ? 60.97   90.24   
56  6  THR A 17 ? ? -152.00 41.92   
57  6  GLU A 24 ? ? -47.61  -12.09  
58  6  GLN A 25 ? ? 71.26   -163.08 
59  6  ASP A 29 ? ? 52.28   84.05   
60  6  GLU A 32 ? ? -48.27  -11.00  
61  6  GLU A 40 ? ? -38.62  -31.20  
62  6  ALA A 41 ? ? -66.11  -79.48  
63  6  ASP A 82 ? ? -65.63  86.26   
64  7  LEU A 10 ? ? 58.95   73.75   
65  7  MET A 11 ? ? -59.89  98.90   
66  7  ARG A 13 ? ? 63.13   161.44  
67  7  ASN A 20 ? ? -152.84 59.45   
68  7  GLN A 25 ? ? -74.60  -80.30  
69  7  PRO A 27 ? ? -57.83  97.91   
70  7  ASP A 29 ? ? 61.46   109.14  
71  7  GLU A 32 ? ? -50.85  -7.41   
72  8  THR A 7  ? ? -175.25 146.48  
73  8  LEU A 10 ? ? 75.80   -48.14  
74  8  MET A 11 ? ? 60.08   179.25  
75  8  ARG A 13 ? ? 61.16   -83.93  
76  8  TYR A 16 ? ? -78.95  -86.59  
77  8  THR A 17 ? ? 44.00   72.78   
78  8  ASN A 20 ? ? -150.68 46.72   
79  8  ASP A 29 ? ? 63.82   88.99   
80  8  ALA A 41 ? ? -69.08  -81.33  
81  8  GLN A 79 ? ? -58.84  -8.85   
82  9  VAL A 6  ? ? 59.49   -85.67  
83  9  LEU A 10 ? ? 57.68   16.87   
84  9  ARG A 13 ? ? -166.31 96.23   
85  9  ASN A 20 ? ? -152.73 59.34   
86  9  LEU A 21 ? ? -97.92  32.25   
87  9  GLU A 32 ? ? -47.55  -19.19  
88  9  GLU A 40 ? ? -38.60  -28.66  
89  9  ALA A 41 ? ? -68.99  -80.94  
90  10 PRO A 2  ? ? -76.36  -89.43  
91  10 ALA A 8  ? ? -162.66 -164.50 
92  10 LEU A 10 ? ? 64.94   154.88  
93  10 ARG A 13 ? ? 55.77   76.11   
94  10 ASN A 20 ? ? -151.42 65.66   
95  10 GLN A 25 ? ? 61.60   99.60   
96  10 GLU A 32 ? ? -49.45  -12.22  
97  10 GLU A 40 ? ? -38.54  -31.07  
98  10 ALA A 41 ? ? -65.57  -80.63  
99  10 ASP A 46 ? ? -69.92  93.79   
100 10 SER A 54 ? ? -66.45  -178.88 
101 10 GLN A 79 ? ? -56.99  -8.78   
102 11 THR A 7  ? ? -142.66 -35.77  
103 11 MET A 11 ? ? -140.26 28.31   
104 11 ARG A 13 ? ? 57.36   88.36   
105 11 TYR A 16 ? ? -53.23  -86.14  
106 11 THR A 17 ? ? 43.38   77.92   
107 11 VAL A 18 ? ? -47.87  107.03  
108 11 PRO A 27 ? ? -80.78  33.63   
109 11 ASP A 29 ? ? -179.21 136.07  
110 11 GLU A 40 ? ? -38.79  -29.79  
111 11 ALA A 41 ? ? -69.76  -82.67  
112 11 ASP A 82 ? ? -67.70  88.45   
113 12 VAL A 6  ? ? -108.35 -169.33 
114 12 THR A 7  ? ? -91.40  -68.19  
115 12 ARG A 39 ? ? -61.53  -70.51  
116 12 GLU A 40 ? ? -38.98  -30.69  
117 12 ALA A 41 ? ? -65.11  -83.84  
118 13 PRO A 2  ? ? -83.65  40.97   
119 13 THR A 17 ? ? 62.09   -83.49  
120 13 ASN A 20 ? ? -157.99 55.52   
121 13 ASP A 29 ? ? 71.81   155.95  
122 13 GLU A 40 ? ? -38.46  -30.60  
123 13 ALA A 41 ? ? -66.60  -84.15  
124 13 ASP A 46 ? ? -68.91  92.27   
125 13 ASP A 82 ? ? -67.25  80.88   
126 14 VAL A 6  ? ? 57.78   89.15   
127 14 LEU A 10 ? ? 58.34   -85.73  
128 14 ARG A 13 ? ? 52.00   77.37   
129 14 TYR A 16 ? ? -109.48 57.73   
130 14 ASN A 20 ? ? -149.85 -43.34  
131 14 PRO A 27 ? ? -78.38  46.74   
132 14 ASP A 29 ? ? 56.73   70.75   
133 14 GLU A 32 ? ? -53.78  -3.92   
134 14 GLU A 40 ? ? -38.78  -36.80  
135 14 ALA A 41 ? ? -73.39  -73.76  
136 14 ASP A 82 ? ? -66.68  84.98   
137 15 THR A 7  ? ? 62.95   -83.42  
138 15 LEU A 10 ? ? 56.15   -169.61 
139 15 ILE A 15 ? ? -170.15 124.32  
140 15 TYR A 16 ? ? 50.18   -157.83 
141 15 THR A 17 ? ? 65.00   93.10   
142 15 LEU A 21 ? ? -153.67 3.40    
143 15 PRO A 27 ? ? -69.76  8.54    
144 15 ASP A 29 ? ? 55.14   83.84   
145 15 GLU A 40 ? ? -38.64  -28.58  
146 15 ALA A 41 ? ? -69.05  -78.60  
147 15 ASP A 82 ? ? -69.46  83.51   
148 16 ASN A 20 ? ? -175.13 65.50   
149 16 GLN A 25 ? ? -78.50  -98.04  
150 16 ASP A 29 ? ? 179.46  95.24   
151 16 GLU A 40 ? ? -39.21  -29.82  
152 16 ALA A 41 ? ? -70.93  -81.60  
153 16 ASP A 82 ? ? -66.65  81.56   
154 17 ASN A 20 ? ? -178.82 50.71   
155 17 GLN A 25 ? ? 69.95   -13.79  
156 17 ARG A 39 ? ? -69.79  -70.38  
157 17 GLU A 40 ? ? -39.20  -31.05  
158 17 ALA A 41 ? ? -65.18  -85.49  
159 17 ASP A 46 ? ? -64.93  92.60   
160 18 THR A 7  ? ? 58.64   -86.29  
161 18 THR A 17 ? ? -145.63 -30.94  
162 18 GLN A 25 ? ? 61.43   -87.29  
163 18 PRO A 27 ? ? -81.52  32.45   
164 18 PRO A 31 ? ? -49.77  150.54  
165 18 GLU A 32 ? ? -47.66  -14.59  
166 18 GLU A 40 ? ? -38.97  -31.30  
167 18 ALA A 41 ? ? -65.01  -83.08  
168 18 ASP A 82 ? ? -64.11  87.88   
169 19 ALA A 9  ? ? -67.10  -70.07  
170 19 LEU A 10 ? ? -100.46 -79.32  
171 19 GLN A 25 ? ? 67.14   115.17  
172 19 ASP A 29 ? ? 60.20   -170.85 
173 19 GLU A 32 ? ? -48.60  -12.61  
174 19 GLU A 40 ? ? -38.45  -33.60  
175 19 ALA A 41 ? ? -66.45  -82.71  
176 20 THR A 7  ? ? -156.27 -62.59  
177 20 ALA A 9  ? ? -57.18  -70.03  
178 20 MET A 11 ? ? -111.14 -168.44 
179 20 ARG A 13 ? ? 55.66   79.01   
180 20 TYR A 16 ? ? 43.23   75.49   
181 20 GLN A 25 ? ? 58.48   -173.94 
182 20 ASP A 29 ? ? 61.22   -155.47 
183 20 ARG A 39 ? ? -68.27  -70.42  
184 20 GLU A 40 ? ? -39.10  -29.36  
185 20 ALA A 41 ? ? -66.05  -79.92  
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2LV7 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2LV7 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'0.2-1.0 mM [U-13C; U-15N] CaBP7 N-terminal Domain, 90% H2O/10% D2O'          1 '90% H2O/10% D2O' 
'0.2-1.0 mM [U-15N] CaBP7 N-terminal Domain, 90% H2O/10% D2O'                 2 '90% H2O/10% D2O' 
'0.4 mM [U-15N] CaBP7 N-terminal Domain, 100% D2O'                            3 '100% D2O'        
'0.4 mM [U-15N] CaBP7 N-terminal Domain, 20 mg/mL Pf1 phage, 90% H2O/10% D2O' 4 '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
'CaBP7 N-terminal Domain-1' ?   0.2-1.0 mM    '[U-13C; U-15N]' 1 
'CaBP7 N-terminal Domain-2' ?   0.2-1.0 mM    '[U-15N]'        2 
'CaBP7 N-terminal Domain-3' 0.4 ?       mM    '[U-15N]'        3 
'CaBP7 N-terminal Domain-4' 0.4 ?       mM    '[U-15N]'        4 
'Pf1 phage-5'               20  ?       mg/mL ?                4 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      50 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         303 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  2 '2D 1H-15N HSQC'           
1 2  1 '2D 1H-13C HSQC'           
1 3  1 '3D CBCA(CO)NH'            
1 4  1 '3D HNCO'                  
1 5  1 '3D HNCA'                  
1 6  1 '3D HNCACB'                
1 7  1 '3D HBHA(CO)NH'            
1 8  1 '3D HN(CO)CA'              
1 9  1 '3D HCCH-TOCSY'            
1 10 1 '3D 1H-15N NOESY'          
1 11 1 '3D 1H-13C NOESY'          
1 12 1 '3D 1H-13C NOESY aromatic' 
1 13 1 '2D 1H-13C HSQC aromatic'  
1 14 1 '3D HN(COCA)CB'            
1 15 3 '2D 1H-15N HSQC'           
1 16 4 '2D 1H-15N HSQC'           
# 
_pdbx_nmr_constraints.disulfide_bond_constraints_total_count        ? 
_pdbx_nmr_constraints.entry_id                                      2LV7 
_pdbx_nmr_constraints.hydrogen_bond_constraints_total_count         ? 
_pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_beta-angle_constraints_total_count         ? 
_pdbx_nmr_constraints.NA_chi-angle_constraints_total_count          ? 
_pdbx_nmr_constraints.NA_delta-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count      ? 
_pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_other-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count       ? 
_pdbx_nmr_constraints.NOE_constraints_total                         1965 
_pdbx_nmr_constraints.NOE_interentity_total_count                   ? 
_pdbx_nmr_constraints.NOE_interproton_distance_evaluation           ? 
_pdbx_nmr_constraints.NOE_intraresidue_total_count                  ? 
_pdbx_nmr_constraints.NOE_long_range_total_count                    ? 
_pdbx_nmr_constraints.NOE_medium_range_total_count                  ? 
_pdbx_nmr_constraints.NOE_motional_averaging_correction             ? 
_pdbx_nmr_constraints.NOE_pseudoatom_corrections                    ? 
_pdbx_nmr_constraints.NOE_sequential_total_count                    ? 
_pdbx_nmr_constraints.protein_chi_angle_constraints_total_count     ? 
_pdbx_nmr_constraints.protein_other_angle_constraints_total_count   ? 
_pdbx_nmr_constraints.protein_phi_angle_constraints_total_count     ? 
_pdbx_nmr_constraints.protein_psi_angle_constraints_total_count     ? 
# 
_pdbx_nmr_refine.entry_id           2LV7 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
CCPN                                'chemical shift assignment' CCPN_Analysis ? 1 
CCPN                                'peak picking'              CCPN_Analysis ? 2 
CCPN                                'data analysis'             CCPN_Analysis ? 3 
'Guntert, Mumenthaler and Wuthrich' 'chemical shift assignment' CYANA         ? 4 
;Linge, O'Donoghue and Nilges
;
'structure solution'        ARIA          ? 5 
;Linge, O'Donoghue and Nilges
;
refinement                  ARIA          ? 6 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CA  CA   CA N N 74  
GLN N    N  N N 75  
GLN CA   C  N S 76  
GLN C    C  N N 77  
GLN O    O  N N 78  
GLN CB   C  N N 79  
GLN CG   C  N N 80  
GLN CD   C  N N 81  
GLN OE1  O  N N 82  
GLN NE2  N  N N 83  
GLN OXT  O  N N 84  
GLN H    H  N N 85  
GLN H2   H  N N 86  
GLN HA   H  N N 87  
GLN HB2  H  N N 88  
GLN HB3  H  N N 89  
GLN HG2  H  N N 90  
GLN HG3  H  N N 91  
GLN HE21 H  N N 92  
GLN HE22 H  N N 93  
GLN HXT  H  N N 94  
GLU N    N  N N 95  
GLU CA   C  N S 96  
GLU C    C  N N 97  
GLU O    O  N N 98  
GLU CB   C  N N 99  
GLU CG   C  N N 100 
GLU CD   C  N N 101 
GLU OE1  O  N N 102 
GLU OE2  O  N N 103 
GLU OXT  O  N N 104 
GLU H    H  N N 105 
GLU H2   H  N N 106 
GLU HA   H  N N 107 
GLU HB2  H  N N 108 
GLU HB3  H  N N 109 
GLU HG2  H  N N 110 
GLU HG3  H  N N 111 
GLU HE2  H  N N 112 
GLU HXT  H  N N 113 
GLY N    N  N N 114 
GLY CA   C  N N 115 
GLY C    C  N N 116 
GLY O    O  N N 117 
GLY OXT  O  N N 118 
GLY H    H  N N 119 
GLY H2   H  N N 120 
GLY HA2  H  N N 121 
GLY HA3  H  N N 122 
GLY HXT  H  N N 123 
HIS N    N  N N 124 
HIS CA   C  N S 125 
HIS C    C  N N 126 
HIS O    O  N N 127 
HIS CB   C  N N 128 
HIS CG   C  Y N 129 
HIS ND1  N  Y N 130 
HIS CD2  C  Y N 131 
HIS CE1  C  Y N 132 
HIS NE2  N  Y N 133 
HIS OXT  O  N N 134 
HIS H    H  N N 135 
HIS H2   H  N N 136 
HIS HA   H  N N 137 
HIS HB2  H  N N 138 
HIS HB3  H  N N 139 
HIS HD1  H  N N 140 
HIS HD2  H  N N 141 
HIS HE1  H  N N 142 
HIS HE2  H  N N 143 
HIS HXT  H  N N 144 
ILE N    N  N N 145 
ILE CA   C  N S 146 
ILE C    C  N N 147 
ILE O    O  N N 148 
ILE CB   C  N S 149 
ILE CG1  C  N N 150 
ILE CG2  C  N N 151 
ILE CD1  C  N N 152 
ILE OXT  O  N N 153 
ILE H    H  N N 154 
ILE H2   H  N N 155 
ILE HA   H  N N 156 
ILE HB   H  N N 157 
ILE HG12 H  N N 158 
ILE HG13 H  N N 159 
ILE HG21 H  N N 160 
ILE HG22 H  N N 161 
ILE HG23 H  N N 162 
ILE HD11 H  N N 163 
ILE HD12 H  N N 164 
ILE HD13 H  N N 165 
ILE HXT  H  N N 166 
LEU N    N  N N 167 
LEU CA   C  N S 168 
LEU C    C  N N 169 
LEU O    O  N N 170 
LEU CB   C  N N 171 
LEU CG   C  N N 172 
LEU CD1  C  N N 173 
LEU CD2  C  N N 174 
LEU OXT  O  N N 175 
LEU H    H  N N 176 
LEU H2   H  N N 177 
LEU HA   H  N N 178 
LEU HB2  H  N N 179 
LEU HB3  H  N N 180 
LEU HG   H  N N 181 
LEU HD11 H  N N 182 
LEU HD12 H  N N 183 
LEU HD13 H  N N 184 
LEU HD21 H  N N 185 
LEU HD22 H  N N 186 
LEU HD23 H  N N 187 
LEU HXT  H  N N 188 
LYS N    N  N N 189 
LYS CA   C  N S 190 
LYS C    C  N N 191 
LYS O    O  N N 192 
LYS CB   C  N N 193 
LYS CG   C  N N 194 
LYS CD   C  N N 195 
LYS CE   C  N N 196 
LYS NZ   N  N N 197 
LYS OXT  O  N N 198 
LYS H    H  N N 199 
LYS H2   H  N N 200 
LYS HA   H  N N 201 
LYS HB2  H  N N 202 
LYS HB3  H  N N 203 
LYS HG2  H  N N 204 
LYS HG3  H  N N 205 
LYS HD2  H  N N 206 
LYS HD3  H  N N 207 
LYS HE2  H  N N 208 
LYS HE3  H  N N 209 
LYS HZ1  H  N N 210 
LYS HZ2  H  N N 211 
LYS HZ3  H  N N 212 
LYS HXT  H  N N 213 
MET N    N  N N 214 
MET CA   C  N S 215 
MET C    C  N N 216 
MET O    O  N N 217 
MET CB   C  N N 218 
MET CG   C  N N 219 
MET SD   S  N N 220 
MET CE   C  N N 221 
MET OXT  O  N N 222 
MET H    H  N N 223 
MET H2   H  N N 224 
MET HA   H  N N 225 
MET HB2  H  N N 226 
MET HB3  H  N N 227 
MET HG2  H  N N 228 
MET HG3  H  N N 229 
MET HE1  H  N N 230 
MET HE2  H  N N 231 
MET HE3  H  N N 232 
MET HXT  H  N N 233 
PHE N    N  N N 234 
PHE CA   C  N S 235 
PHE C    C  N N 236 
PHE O    O  N N 237 
PHE CB   C  N N 238 
PHE CG   C  Y N 239 
PHE CD1  C  Y N 240 
PHE CD2  C  Y N 241 
PHE CE1  C  Y N 242 
PHE CE2  C  Y N 243 
PHE CZ   C  Y N 244 
PHE OXT  O  N N 245 
PHE H    H  N N 246 
PHE H2   H  N N 247 
PHE HA   H  N N 248 
PHE HB2  H  N N 249 
PHE HB3  H  N N 250 
PHE HD1  H  N N 251 
PHE HD2  H  N N 252 
PHE HE1  H  N N 253 
PHE HE2  H  N N 254 
PHE HZ   H  N N 255 
PHE HXT  H  N N 256 
PRO N    N  N N 257 
PRO CA   C  N S 258 
PRO C    C  N N 259 
PRO O    O  N N 260 
PRO CB   C  N N 261 
PRO CG   C  N N 262 
PRO CD   C  N N 263 
PRO OXT  O  N N 264 
PRO H    H  N N 265 
PRO HA   H  N N 266 
PRO HB2  H  N N 267 
PRO HB3  H  N N 268 
PRO HG2  H  N N 269 
PRO HG3  H  N N 270 
PRO HD2  H  N N 271 
PRO HD3  H  N N 272 
PRO HXT  H  N N 273 
SER N    N  N N 274 
SER CA   C  N S 275 
SER C    C  N N 276 
SER O    O  N N 277 
SER CB   C  N N 278 
SER OG   O  N N 279 
SER OXT  O  N N 280 
SER H    H  N N 281 
SER H2   H  N N 282 
SER HA   H  N N 283 
SER HB2  H  N N 284 
SER HB3  H  N N 285 
SER HG   H  N N 286 
SER HXT  H  N N 287 
THR N    N  N N 288 
THR CA   C  N S 289 
THR C    C  N N 290 
THR O    O  N N 291 
THR CB   C  N R 292 
THR OG1  O  N N 293 
THR CG2  C  N N 294 
THR OXT  O  N N 295 
THR H    H  N N 296 
THR H2   H  N N 297 
THR HA   H  N N 298 
THR HB   H  N N 299 
THR HG1  H  N N 300 
THR HG21 H  N N 301 
THR HG22 H  N N 302 
THR HG23 H  N N 303 
THR HXT  H  N N 304 
TYR N    N  N N 305 
TYR CA   C  N S 306 
TYR C    C  N N 307 
TYR O    O  N N 308 
TYR CB   C  N N 309 
TYR CG   C  Y N 310 
TYR CD1  C  Y N 311 
TYR CD2  C  Y N 312 
TYR CE1  C  Y N 313 
TYR CE2  C  Y N 314 
TYR CZ   C  Y N 315 
TYR OH   O  N N 316 
TYR OXT  O  N N 317 
TYR H    H  N N 318 
TYR H2   H  N N 319 
TYR HA   H  N N 320 
TYR HB2  H  N N 321 
TYR HB3  H  N N 322 
TYR HD1  H  N N 323 
TYR HD2  H  N N 324 
TYR HE1  H  N N 325 
TYR HE2  H  N N 326 
TYR HH   H  N N 327 
TYR HXT  H  N N 328 
VAL N    N  N N 329 
VAL CA   C  N S 330 
VAL C    C  N N 331 
VAL O    O  N N 332 
VAL CB   C  N N 333 
VAL CG1  C  N N 334 
VAL CG2  C  N N 335 
VAL OXT  O  N N 336 
VAL H    H  N N 337 
VAL H2   H  N N 338 
VAL HA   H  N N 339 
VAL HB   H  N N 340 
VAL HG11 H  N N 341 
VAL HG12 H  N N 342 
VAL HG13 H  N N 343 
VAL HG21 H  N N 344 
VAL HG22 H  N N 345 
VAL HG23 H  N N 346 
VAL HXT  H  N N 347 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
GLN N   CA   sing N N 70  
GLN N   H    sing N N 71  
GLN N   H2   sing N N 72  
GLN CA  C    sing N N 73  
GLN CA  CB   sing N N 74  
GLN CA  HA   sing N N 75  
GLN C   O    doub N N 76  
GLN C   OXT  sing N N 77  
GLN CB  CG   sing N N 78  
GLN CB  HB2  sing N N 79  
GLN CB  HB3  sing N N 80  
GLN CG  CD   sing N N 81  
GLN CG  HG2  sing N N 82  
GLN CG  HG3  sing N N 83  
GLN CD  OE1  doub N N 84  
GLN CD  NE2  sing N N 85  
GLN NE2 HE21 sing N N 86  
GLN NE2 HE22 sing N N 87  
GLN OXT HXT  sing N N 88  
GLU N   CA   sing N N 89  
GLU N   H    sing N N 90  
GLU N   H2   sing N N 91  
GLU CA  C    sing N N 92  
GLU CA  CB   sing N N 93  
GLU CA  HA   sing N N 94  
GLU C   O    doub N N 95  
GLU C   OXT  sing N N 96  
GLU CB  CG   sing N N 97  
GLU CB  HB2  sing N N 98  
GLU CB  HB3  sing N N 99  
GLU CG  CD   sing N N 100 
GLU CG  HG2  sing N N 101 
GLU CG  HG3  sing N N 102 
GLU CD  OE1  doub N N 103 
GLU CD  OE2  sing N N 104 
GLU OE2 HE2  sing N N 105 
GLU OXT HXT  sing N N 106 
GLY N   CA   sing N N 107 
GLY N   H    sing N N 108 
GLY N   H2   sing N N 109 
GLY CA  C    sing N N 110 
GLY CA  HA2  sing N N 111 
GLY CA  HA3  sing N N 112 
GLY C   O    doub N N 113 
GLY C   OXT  sing N N 114 
GLY OXT HXT  sing N N 115 
HIS N   CA   sing N N 116 
HIS N   H    sing N N 117 
HIS N   H2   sing N N 118 
HIS CA  C    sing N N 119 
HIS CA  CB   sing N N 120 
HIS CA  HA   sing N N 121 
HIS C   O    doub N N 122 
HIS C   OXT  sing N N 123 
HIS CB  CG   sing N N 124 
HIS CB  HB2  sing N N 125 
HIS CB  HB3  sing N N 126 
HIS CG  ND1  sing Y N 127 
HIS CG  CD2  doub Y N 128 
HIS ND1 CE1  doub Y N 129 
HIS ND1 HD1  sing N N 130 
HIS CD2 NE2  sing Y N 131 
HIS CD2 HD2  sing N N 132 
HIS CE1 NE2  sing Y N 133 
HIS CE1 HE1  sing N N 134 
HIS NE2 HE2  sing N N 135 
HIS OXT HXT  sing N N 136 
ILE N   CA   sing N N 137 
ILE N   H    sing N N 138 
ILE N   H2   sing N N 139 
ILE CA  C    sing N N 140 
ILE CA  CB   sing N N 141 
ILE CA  HA   sing N N 142 
ILE C   O    doub N N 143 
ILE C   OXT  sing N N 144 
ILE CB  CG1  sing N N 145 
ILE CB  CG2  sing N N 146 
ILE CB  HB   sing N N 147 
ILE CG1 CD1  sing N N 148 
ILE CG1 HG12 sing N N 149 
ILE CG1 HG13 sing N N 150 
ILE CG2 HG21 sing N N 151 
ILE CG2 HG22 sing N N 152 
ILE CG2 HG23 sing N N 153 
ILE CD1 HD11 sing N N 154 
ILE CD1 HD12 sing N N 155 
ILE CD1 HD13 sing N N 156 
ILE OXT HXT  sing N N 157 
LEU N   CA   sing N N 158 
LEU N   H    sing N N 159 
LEU N   H2   sing N N 160 
LEU CA  C    sing N N 161 
LEU CA  CB   sing N N 162 
LEU CA  HA   sing N N 163 
LEU C   O    doub N N 164 
LEU C   OXT  sing N N 165 
LEU CB  CG   sing N N 166 
LEU CB  HB2  sing N N 167 
LEU CB  HB3  sing N N 168 
LEU CG  CD1  sing N N 169 
LEU CG  CD2  sing N N 170 
LEU CG  HG   sing N N 171 
LEU CD1 HD11 sing N N 172 
LEU CD1 HD12 sing N N 173 
LEU CD1 HD13 sing N N 174 
LEU CD2 HD21 sing N N 175 
LEU CD2 HD22 sing N N 176 
LEU CD2 HD23 sing N N 177 
LEU OXT HXT  sing N N 178 
LYS N   CA   sing N N 179 
LYS N   H    sing N N 180 
LYS N   H2   sing N N 181 
LYS CA  C    sing N N 182 
LYS CA  CB   sing N N 183 
LYS CA  HA   sing N N 184 
LYS C   O    doub N N 185 
LYS C   OXT  sing N N 186 
LYS CB  CG   sing N N 187 
LYS CB  HB2  sing N N 188 
LYS CB  HB3  sing N N 189 
LYS CG  CD   sing N N 190 
LYS CG  HG2  sing N N 191 
LYS CG  HG3  sing N N 192 
LYS CD  CE   sing N N 193 
LYS CD  HD2  sing N N 194 
LYS CD  HD3  sing N N 195 
LYS CE  NZ   sing N N 196 
LYS CE  HE2  sing N N 197 
LYS CE  HE3  sing N N 198 
LYS NZ  HZ1  sing N N 199 
LYS NZ  HZ2  sing N N 200 
LYS NZ  HZ3  sing N N 201 
LYS OXT HXT  sing N N 202 
MET N   CA   sing N N 203 
MET N   H    sing N N 204 
MET N   H2   sing N N 205 
MET CA  C    sing N N 206 
MET CA  CB   sing N N 207 
MET CA  HA   sing N N 208 
MET C   O    doub N N 209 
MET C   OXT  sing N N 210 
MET CB  CG   sing N N 211 
MET CB  HB2  sing N N 212 
MET CB  HB3  sing N N 213 
MET CG  SD   sing N N 214 
MET CG  HG2  sing N N 215 
MET CG  HG3  sing N N 216 
MET SD  CE   sing N N 217 
MET CE  HE1  sing N N 218 
MET CE  HE2  sing N N 219 
MET CE  HE3  sing N N 220 
MET OXT HXT  sing N N 221 
PHE N   CA   sing N N 222 
PHE N   H    sing N N 223 
PHE N   H2   sing N N 224 
PHE CA  C    sing N N 225 
PHE CA  CB   sing N N 226 
PHE CA  HA   sing N N 227 
PHE C   O    doub N N 228 
PHE C   OXT  sing N N 229 
PHE CB  CG   sing N N 230 
PHE CB  HB2  sing N N 231 
PHE CB  HB3  sing N N 232 
PHE CG  CD1  doub Y N 233 
PHE CG  CD2  sing Y N 234 
PHE CD1 CE1  sing Y N 235 
PHE CD1 HD1  sing N N 236 
PHE CD2 CE2  doub Y N 237 
PHE CD2 HD2  sing N N 238 
PHE CE1 CZ   doub Y N 239 
PHE CE1 HE1  sing N N 240 
PHE CE2 CZ   sing Y N 241 
PHE CE2 HE2  sing N N 242 
PHE CZ  HZ   sing N N 243 
PHE OXT HXT  sing N N 244 
PRO N   CA   sing N N 245 
PRO N   CD   sing N N 246 
PRO N   H    sing N N 247 
PRO CA  C    sing N N 248 
PRO CA  CB   sing N N 249 
PRO CA  HA   sing N N 250 
PRO C   O    doub N N 251 
PRO C   OXT  sing N N 252 
PRO CB  CG   sing N N 253 
PRO CB  HB2  sing N N 254 
PRO CB  HB3  sing N N 255 
PRO CG  CD   sing N N 256 
PRO CG  HG2  sing N N 257 
PRO CG  HG3  sing N N 258 
PRO CD  HD2  sing N N 259 
PRO CD  HD3  sing N N 260 
PRO OXT HXT  sing N N 261 
SER N   CA   sing N N 262 
SER N   H    sing N N 263 
SER N   H2   sing N N 264 
SER CA  C    sing N N 265 
SER CA  CB   sing N N 266 
SER CA  HA   sing N N 267 
SER C   O    doub N N 268 
SER C   OXT  sing N N 269 
SER CB  OG   sing N N 270 
SER CB  HB2  sing N N 271 
SER CB  HB3  sing N N 272 
SER OG  HG   sing N N 273 
SER OXT HXT  sing N N 274 
THR N   CA   sing N N 275 
THR N   H    sing N N 276 
THR N   H2   sing N N 277 
THR CA  C    sing N N 278 
THR CA  CB   sing N N 279 
THR CA  HA   sing N N 280 
THR C   O    doub N N 281 
THR C   OXT  sing N N 282 
THR CB  OG1  sing N N 283 
THR CB  CG2  sing N N 284 
THR CB  HB   sing N N 285 
THR OG1 HG1  sing N N 286 
THR CG2 HG21 sing N N 287 
THR CG2 HG22 sing N N 288 
THR CG2 HG23 sing N N 289 
THR OXT HXT  sing N N 290 
TYR N   CA   sing N N 291 
TYR N   H    sing N N 292 
TYR N   H2   sing N N 293 
TYR CA  C    sing N N 294 
TYR CA  CB   sing N N 295 
TYR CA  HA   sing N N 296 
TYR C   O    doub N N 297 
TYR C   OXT  sing N N 298 
TYR CB  CG   sing N N 299 
TYR CB  HB2  sing N N 300 
TYR CB  HB3  sing N N 301 
TYR CG  CD1  doub Y N 302 
TYR CG  CD2  sing Y N 303 
TYR CD1 CE1  sing Y N 304 
TYR CD1 HD1  sing N N 305 
TYR CD2 CE2  doub Y N 306 
TYR CD2 HD2  sing N N 307 
TYR CE1 CZ   doub Y N 308 
TYR CE1 HE1  sing N N 309 
TYR CE2 CZ   sing Y N 310 
TYR CE2 HE2  sing N N 311 
TYR CZ  OH   sing N N 312 
TYR OH  HH   sing N N 313 
TYR OXT HXT  sing N N 314 
VAL N   CA   sing N N 315 
VAL N   H    sing N N 316 
VAL N   H2   sing N N 317 
VAL CA  C    sing N N 318 
VAL CA  CB   sing N N 319 
VAL CA  HA   sing N N 320 
VAL C   O    doub N N 321 
VAL C   OXT  sing N N 322 
VAL CB  CG1  sing N N 323 
VAL CB  CG2  sing N N 324 
VAL CB  HB   sing N N 325 
VAL CG1 HG11 sing N N 326 
VAL CG1 HG12 sing N N 327 
VAL CG1 HG13 sing N N 328 
VAL CG2 HG21 sing N N 329 
VAL CG2 HG22 sing N N 330 
VAL CG2 HG23 sing N N 331 
VAL OXT HXT  sing N N 332 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
600 Bruker AVANCE 1 'Bruker Avance' 
800 Bruker AVANCE 2 'Bruker Avance' 
# 
_atom_sites.entry_id                    2LV7 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
H  
N  
O  
S  
# 
loop_