data_2LVR # _entry.id 2LVR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LVR pdb_00002lvr 10.2210/pdb2lvr/pdb RCSB RCSB102892 ? ? BMRB 18586 ? ? WWPDB D_1000102892 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 18586 BMRB unspecified . 2LVT PDB unspecified . 2LVU PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LVR _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-07-10 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bedard, M.' 1 'Maltais, L.' 2 'Beaulieu, M.' 3 'Bernard, D.' 4 'Lavigne, P.' 5 # _citation.id primary _citation.title 'NMR structure note: solution structure of human Miz-1 zinc fingers 8 to 10.' _citation.journal_abbrev J.Biomol.Nmr _citation.journal_volume 54 _citation.page_first 317 _citation.page_last 323 _citation.year 2012 _citation.journal_id_ASTM JBNME9 _citation.country NE _citation.journal_id_ISSN 0925-2738 _citation.journal_id_CSD 0800 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22986688 _citation.pdbx_database_id_DOI 10.1007/s10858-012-9670-1 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bedard, M.' 1 ? primary 'Maltais, L.' 2 ? primary 'Beaulieu, M.E.' 3 ? primary 'Bilodeau, J.' 4 ? primary 'Bernard, D.' 5 ? primary 'Lavigne, P.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger and BTB domain-containing protein 17' 9517.052 1 ? ? 'C2H2-type 8 Zinc finger residues 500-581' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Myc-interacting zinc finger protein 1, Miz-1, Zinc finger protein 151, Zinc finger protein 60' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIR HHD ; _entity_poly.pdbx_seq_one_letter_code_can ;MKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIR HHD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 PRO n 1 4 TYR n 1 5 VAL n 1 6 CYS n 1 7 ILE n 1 8 HIS n 1 9 CYS n 1 10 GLN n 1 11 ARG n 1 12 GLN n 1 13 PHE n 1 14 ALA n 1 15 ASP n 1 16 PRO n 1 17 GLY n 1 18 ALA n 1 19 LEU n 1 20 GLN n 1 21 ARG n 1 22 HIS n 1 23 VAL n 1 24 ARG n 1 25 ILE n 1 26 HIS n 1 27 THR n 1 28 GLY n 1 29 GLU n 1 30 LYS n 1 31 PRO n 1 32 CYS n 1 33 GLN n 1 34 CYS n 1 35 VAL n 1 36 MET n 1 37 CYS n 1 38 GLY n 1 39 LYS n 1 40 ALA n 1 41 PHE n 1 42 THR n 1 43 GLN n 1 44 ALA n 1 45 SER n 1 46 SER n 1 47 LEU n 1 48 ILE n 1 49 ALA n 1 50 HIS n 1 51 VAL n 1 52 ARG n 1 53 GLN n 1 54 HIS n 1 55 THR n 1 56 GLY n 1 57 GLU n 1 58 LYS n 1 59 PRO n 1 60 TYR n 1 61 VAL n 1 62 CYS n 1 63 GLU n 1 64 ARG n 1 65 CYS n 1 66 GLY n 1 67 LYS n 1 68 ARG n 1 69 PHE n 1 70 VAL n 1 71 GLN n 1 72 SER n 1 73 SER n 1 74 GLN n 1 75 LEU n 1 76 ALA n 1 77 ASN n 1 78 HIS n 1 79 ILE n 1 80 ARG n 1 81 HIS n 1 82 HIS n 1 83 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MIZ1, ZBTB17, ZHX1, ZNF151, ZNF60' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 star (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET-3a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZBT17_HUMAN _struct_ref.pdbx_db_accession Q13105 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRH HD ; _struct_ref.pdbx_align_begin 500 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LVR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 83 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13105 _struct_ref_seq.db_align_beg 500 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 581 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 83 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2LVR _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q13105 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCACB' 1 5 1 '3D HNCO' 1 6 1 '3D C(CO)NH' 1 7 1 '3D H(CCO)NH' 1 8 1 '3D HCCH-TOCSY' 1 9 1 '3D 1H-15N NOESY' 1 10 1 '3D 1H-13C NOESY aliphatic' 1 11 1 '3D 1H-13C NOESY aromatic' 1 12 1 '3D HNHA' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.05 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.75 - 1.00 mM [U-13C; U-15N] Miz8, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2LVR _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 300 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LVR _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LVR _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Nilges, Rieping, Habeck, Bardiaux, Bernard and Malliavin' 'structure calculation' ARIA 2.2 1 'Nilges, Rieping, Habeck, Bardiaux, Bernard and Malliavin' refinement ARIA 2.2 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure calculation' CNS 1.21 3 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.21 4 CCPN 'chemical shift assigment' 'CcpNmr Analysis' 2.1 5 CCPN 'data analysis' 'CcpNmr Analysis' 2.1 6 CCPN 'data analysis' DANGLE 1.1 7 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 7.4 8 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LVR _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LVR _struct.title 'Solution structure of Miz-1 zinc finger 8' _struct.pdbx_model_details 'lowest energy, model20' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LVR _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'C2H2 zinc finger, classical zinc finger, TRANSCRIPTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 15 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 28 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 15 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 28 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 6 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 6 A ZN 101 1_555 ? ? ? ? ? ? ? 2.307 ? ? metalc2 metalc ? ? A CYS 9 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 9 A ZN 101 1_555 ? ? ? ? ? ? ? 2.303 ? ? metalc3 metalc ? ? A HIS 22 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 22 A ZN 101 1_555 ? ? ? ? ? ? ? 2.151 ? ? metalc4 metalc ? ? A HIS 26 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 26 A ZN 101 1_555 ? ? ? ? ? ? ? 2.003 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 4 ? VAL A 5 ? TYR A 4 VAL A 5 A 2 GLN A 12 ? PHE A 13 ? GLN A 12 PHE A 13 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 4 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 4 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 13 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 13 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 101 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 6 ? CYS A 6 . ? 1_555 ? 2 AC1 4 CYS A 9 ? CYS A 9 . ? 1_555 ? 3 AC1 4 HIS A 22 ? HIS A 22 . ? 1_555 ? 4 AC1 4 HIS A 26 ? HIS A 26 . ? 1_555 ? # _atom_sites.entry_id 2LVR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 PRO 31 31 ? ? ? A . n A 1 32 CYS 32 32 ? ? ? A . n A 1 33 GLN 33 33 ? ? ? A . n A 1 34 CYS 34 34 ? ? ? A . n A 1 35 VAL 35 35 ? ? ? A . n A 1 36 MET 36 36 ? ? ? A . n A 1 37 CYS 37 37 ? ? ? A . n A 1 38 GLY 38 38 ? ? ? A . n A 1 39 LYS 39 39 ? ? ? A . n A 1 40 ALA 40 40 ? ? ? A . n A 1 41 PHE 41 41 ? ? ? A . n A 1 42 THR 42 42 ? ? ? A . n A 1 43 GLN 43 43 ? ? ? A . n A 1 44 ALA 44 44 ? ? ? A . n A 1 45 SER 45 45 ? ? ? A . n A 1 46 SER 46 46 ? ? ? A . n A 1 47 LEU 47 47 ? ? ? A . n A 1 48 ILE 48 48 ? ? ? A . n A 1 49 ALA 49 49 ? ? ? A . n A 1 50 HIS 50 50 ? ? ? A . n A 1 51 VAL 51 51 ? ? ? A . n A 1 52 ARG 52 52 ? ? ? A . n A 1 53 GLN 53 53 ? ? ? A . n A 1 54 HIS 54 54 ? ? ? A . n A 1 55 THR 55 55 ? ? ? A . n A 1 56 GLY 56 56 ? ? ? A . n A 1 57 GLU 57 57 ? ? ? A . n A 1 58 LYS 58 58 ? ? ? A . n A 1 59 PRO 59 59 ? ? ? A . n A 1 60 TYR 60 60 ? ? ? A . n A 1 61 VAL 61 61 ? ? ? A . n A 1 62 CYS 62 62 ? ? ? A . n A 1 63 GLU 63 63 ? ? ? A . n A 1 64 ARG 64 64 ? ? ? A . n A 1 65 CYS 65 65 ? ? ? A . n A 1 66 GLY 66 66 ? ? ? A . n A 1 67 LYS 67 67 ? ? ? A . n A 1 68 ARG 68 68 ? ? ? A . n A 1 69 PHE 69 69 ? ? ? A . n A 1 70 VAL 70 70 ? ? ? A . n A 1 71 GLN 71 71 ? ? ? A . n A 1 72 SER 72 72 ? ? ? A . n A 1 73 SER 73 73 ? ? ? A . n A 1 74 GLN 74 74 ? ? ? A . n A 1 75 LEU 75 75 ? ? ? A . n A 1 76 ALA 76 76 ? ? ? A . n A 1 77 ASN 77 77 ? ? ? A . n A 1 78 HIS 78 78 ? ? ? A . n A 1 79 ILE 79 79 ? ? ? A . n A 1 80 ARG 80 80 ? ? ? A . n A 1 81 HIS 81 81 ? ? ? A . n A 1 82 HIS 82 82 ? ? ? A . n A 1 83 ASP 83 83 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 101 _pdbx_nonpoly_scheme.auth_seq_num 31 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 6 ? A CYS 6 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 9 ? A CYS 9 ? 1_555 103.0 ? 2 SG ? A CYS 6 ? A CYS 6 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 91.8 ? 3 SG ? A CYS 9 ? A CYS 9 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 100.5 ? 4 SG ? A CYS 6 ? A CYS 6 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 26 ? A HIS 26 ? 1_555 104.1 ? 5 SG ? A CYS 9 ? A CYS 9 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 26 ? A HIS 26 ? 1_555 109.0 ? 6 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 26 ? A HIS 26 ? 1_555 141.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-07-25 2 'Structure model' 1 1 2012-10-03 3 'Structure model' 1 2 2012-11-14 4 'Structure model' 1 3 2016-04-27 5 'Structure model' 1 4 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Structure summary' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' 7 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' database_2 2 5 'Structure model' pdbx_database_status 3 5 'Structure model' pdbx_nmr_software 4 5 'Structure model' pdbx_struct_conn_angle 5 5 'Structure model' struct_conn 6 5 'Structure model' struct_ref_seq_dif 7 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 5 'Structure model' '_pdbx_nmr_software.name' 5 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 5 'Structure model' '_pdbx_struct_conn_angle.value' 16 5 'Structure model' '_struct_conn.pdbx_dist_value' 17 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 5 'Structure model' '_struct_ref_seq_dif.details' 23 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 24 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 25 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_nmr_exptl_sample.component Miz8-10-1 _pdbx_nmr_exptl_sample.concentration ? _pdbx_nmr_exptl_sample.concentration_range 0.75-1.00 _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-13C; U-15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LVR _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 611 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 319 _pdbx_nmr_constraints.NOE_long_range_total_count 56 _pdbx_nmr_constraints.NOE_medium_range_total_count 77 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 159 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 3 PRO A 3 ? ? -59.89 173.63 2 4 GLN A 10 ? ? 65.07 79.65 3 5 GLN A 10 ? ? 67.64 79.36 4 5 THR A 27 ? ? -85.49 49.57 5 6 GLN A 10 ? ? 69.80 67.77 6 7 PRO A 3 ? ? -59.85 178.19 7 7 GLN A 10 ? ? 67.01 60.66 8 8 THR A 27 ? ? -83.18 49.47 9 10 LYS A 2 ? ? 179.71 118.84 10 11 GLN A 10 ? ? 60.38 81.40 11 13 LYS A 2 ? ? -156.83 -53.20 12 13 THR A 27 ? ? -92.19 52.77 13 15 GLN A 10 ? ? 63.45 64.98 14 16 THR A 27 ? ? -84.28 49.85 15 18 GLN A 10 ? ? 67.99 79.40 16 18 THR A 27 ? ? -93.14 34.72 17 19 LYS A 2 ? ? 55.80 71.43 18 20 THR A 27 ? ? -84.73 46.22 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 4 TYR A 4 ? ? 0.057 'SIDE CHAIN' 2 5 TYR A 4 ? ? 0.050 'SIDE CHAIN' 3 16 TYR A 4 ? ? 0.062 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A PRO 31 ? A PRO 31 2 1 Y 1 A CYS 32 ? A CYS 32 3 1 Y 1 A GLN 33 ? A GLN 33 4 1 Y 1 A CYS 34 ? A CYS 34 5 1 Y 1 A VAL 35 ? A VAL 35 6 1 Y 1 A MET 36 ? A MET 36 7 1 Y 1 A CYS 37 ? A CYS 37 8 1 Y 1 A GLY 38 ? A GLY 38 9 1 Y 1 A LYS 39 ? A LYS 39 10 1 Y 1 A ALA 40 ? A ALA 40 11 1 Y 1 A PHE 41 ? A PHE 41 12 1 Y 1 A THR 42 ? A THR 42 13 1 Y 1 A GLN 43 ? A GLN 43 14 1 Y 1 A ALA 44 ? A ALA 44 15 1 Y 1 A SER 45 ? A SER 45 16 1 Y 1 A SER 46 ? A SER 46 17 1 Y 1 A LEU 47 ? A LEU 47 18 1 Y 1 A ILE 48 ? A ILE 48 19 1 Y 1 A ALA 49 ? A ALA 49 20 1 Y 1 A HIS 50 ? A HIS 50 21 1 Y 1 A VAL 51 ? A VAL 51 22 1 Y 1 A ARG 52 ? A ARG 52 23 1 Y 1 A GLN 53 ? A GLN 53 24 1 Y 1 A HIS 54 ? A HIS 54 25 1 Y 1 A THR 55 ? A THR 55 26 1 Y 1 A GLY 56 ? A GLY 56 27 1 Y 1 A GLU 57 ? A GLU 57 28 1 Y 1 A LYS 58 ? A LYS 58 29 1 Y 1 A PRO 59 ? A PRO 59 30 1 Y 1 A TYR 60 ? A TYR 60 31 1 Y 1 A VAL 61 ? A VAL 61 32 1 Y 1 A CYS 62 ? A CYS 62 33 1 Y 1 A GLU 63 ? A GLU 63 34 1 Y 1 A ARG 64 ? A ARG 64 35 1 Y 1 A CYS 65 ? A CYS 65 36 1 Y 1 A GLY 66 ? A GLY 66 37 1 Y 1 A LYS 67 ? A LYS 67 38 1 Y 1 A ARG 68 ? A ARG 68 39 1 Y 1 A PHE 69 ? A PHE 69 40 1 Y 1 A VAL 70 ? A VAL 70 41 1 Y 1 A GLN 71 ? A GLN 71 42 1 Y 1 A SER 72 ? A SER 72 43 1 Y 1 A SER 73 ? A SER 73 44 1 Y 1 A GLN 74 ? A GLN 74 45 1 Y 1 A LEU 75 ? A LEU 75 46 1 Y 1 A ALA 76 ? A ALA 76 47 1 Y 1 A ASN 77 ? A ASN 77 48 1 Y 1 A HIS 78 ? A HIS 78 49 1 Y 1 A ILE 79 ? A ILE 79 50 1 Y 1 A ARG 80 ? A ARG 80 51 1 Y 1 A HIS 81 ? A HIS 81 52 1 Y 1 A HIS 82 ? A HIS 82 53 1 Y 1 A ASP 83 ? A ASP 83 54 2 Y 1 A PRO 31 ? A PRO 31 55 2 Y 1 A CYS 32 ? A CYS 32 56 2 Y 1 A GLN 33 ? A GLN 33 57 2 Y 1 A CYS 34 ? A CYS 34 58 2 Y 1 A VAL 35 ? A VAL 35 59 2 Y 1 A MET 36 ? A MET 36 60 2 Y 1 A CYS 37 ? A CYS 37 61 2 Y 1 A GLY 38 ? A GLY 38 62 2 Y 1 A LYS 39 ? A LYS 39 63 2 Y 1 A ALA 40 ? A ALA 40 64 2 Y 1 A PHE 41 ? A PHE 41 65 2 Y 1 A THR 42 ? A THR 42 66 2 Y 1 A GLN 43 ? A GLN 43 67 2 Y 1 A ALA 44 ? A ALA 44 68 2 Y 1 A SER 45 ? A SER 45 69 2 Y 1 A SER 46 ? A SER 46 70 2 Y 1 A LEU 47 ? A LEU 47 71 2 Y 1 A ILE 48 ? A ILE 48 72 2 Y 1 A ALA 49 ? A ALA 49 73 2 Y 1 A HIS 50 ? A HIS 50 74 2 Y 1 A VAL 51 ? A VAL 51 75 2 Y 1 A ARG 52 ? A ARG 52 76 2 Y 1 A GLN 53 ? A GLN 53 77 2 Y 1 A HIS 54 ? A HIS 54 78 2 Y 1 A THR 55 ? A THR 55 79 2 Y 1 A GLY 56 ? A GLY 56 80 2 Y 1 A GLU 57 ? A GLU 57 81 2 Y 1 A LYS 58 ? A LYS 58 82 2 Y 1 A PRO 59 ? A PRO 59 83 2 Y 1 A TYR 60 ? A TYR 60 84 2 Y 1 A VAL 61 ? A VAL 61 85 2 Y 1 A CYS 62 ? A CYS 62 86 2 Y 1 A GLU 63 ? A GLU 63 87 2 Y 1 A ARG 64 ? A ARG 64 88 2 Y 1 A CYS 65 ? A CYS 65 89 2 Y 1 A GLY 66 ? A GLY 66 90 2 Y 1 A LYS 67 ? A LYS 67 91 2 Y 1 A ARG 68 ? A ARG 68 92 2 Y 1 A PHE 69 ? A PHE 69 93 2 Y 1 A VAL 70 ? A VAL 70 94 2 Y 1 A GLN 71 ? A GLN 71 95 2 Y 1 A SER 72 ? A SER 72 96 2 Y 1 A SER 73 ? A SER 73 97 2 Y 1 A GLN 74 ? A GLN 74 98 2 Y 1 A LEU 75 ? A LEU 75 99 2 Y 1 A ALA 76 ? A ALA 76 100 2 Y 1 A ASN 77 ? A ASN 77 101 2 Y 1 A HIS 78 ? A HIS 78 102 2 Y 1 A ILE 79 ? A ILE 79 103 2 Y 1 A ARG 80 ? A ARG 80 104 2 Y 1 A HIS 81 ? A HIS 81 105 2 Y 1 A HIS 82 ? A HIS 82 106 2 Y 1 A ASP 83 ? A ASP 83 107 3 Y 1 A PRO 31 ? A PRO 31 108 3 Y 1 A CYS 32 ? A CYS 32 109 3 Y 1 A GLN 33 ? A GLN 33 110 3 Y 1 A CYS 34 ? A CYS 34 111 3 Y 1 A VAL 35 ? A VAL 35 112 3 Y 1 A MET 36 ? A MET 36 113 3 Y 1 A CYS 37 ? A CYS 37 114 3 Y 1 A GLY 38 ? A GLY 38 115 3 Y 1 A LYS 39 ? A LYS 39 116 3 Y 1 A ALA 40 ? A ALA 40 117 3 Y 1 A PHE 41 ? A PHE 41 118 3 Y 1 A THR 42 ? A THR 42 119 3 Y 1 A GLN 43 ? A GLN 43 120 3 Y 1 A ALA 44 ? A ALA 44 121 3 Y 1 A SER 45 ? A SER 45 122 3 Y 1 A SER 46 ? A SER 46 123 3 Y 1 A LEU 47 ? A LEU 47 124 3 Y 1 A ILE 48 ? A ILE 48 125 3 Y 1 A ALA 49 ? A ALA 49 126 3 Y 1 A HIS 50 ? A HIS 50 127 3 Y 1 A VAL 51 ? A VAL 51 128 3 Y 1 A ARG 52 ? A ARG 52 129 3 Y 1 A GLN 53 ? A GLN 53 130 3 Y 1 A HIS 54 ? A HIS 54 131 3 Y 1 A THR 55 ? A THR 55 132 3 Y 1 A GLY 56 ? A GLY 56 133 3 Y 1 A GLU 57 ? A GLU 57 134 3 Y 1 A LYS 58 ? A LYS 58 135 3 Y 1 A PRO 59 ? A PRO 59 136 3 Y 1 A TYR 60 ? A TYR 60 137 3 Y 1 A VAL 61 ? A VAL 61 138 3 Y 1 A CYS 62 ? A CYS 62 139 3 Y 1 A GLU 63 ? A GLU 63 140 3 Y 1 A ARG 64 ? A ARG 64 141 3 Y 1 A CYS 65 ? A CYS 65 142 3 Y 1 A GLY 66 ? A GLY 66 143 3 Y 1 A LYS 67 ? A LYS 67 144 3 Y 1 A ARG 68 ? A ARG 68 145 3 Y 1 A PHE 69 ? A PHE 69 146 3 Y 1 A VAL 70 ? A VAL 70 147 3 Y 1 A GLN 71 ? A GLN 71 148 3 Y 1 A SER 72 ? A SER 72 149 3 Y 1 A SER 73 ? A SER 73 150 3 Y 1 A GLN 74 ? A GLN 74 151 3 Y 1 A LEU 75 ? A LEU 75 152 3 Y 1 A ALA 76 ? A ALA 76 153 3 Y 1 A ASN 77 ? A ASN 77 154 3 Y 1 A HIS 78 ? A HIS 78 155 3 Y 1 A ILE 79 ? A ILE 79 156 3 Y 1 A ARG 80 ? A ARG 80 157 3 Y 1 A HIS 81 ? A HIS 81 158 3 Y 1 A HIS 82 ? A HIS 82 159 3 Y 1 A ASP 83 ? A ASP 83 160 4 Y 1 A PRO 31 ? A PRO 31 161 4 Y 1 A CYS 32 ? A CYS 32 162 4 Y 1 A GLN 33 ? A GLN 33 163 4 Y 1 A CYS 34 ? A CYS 34 164 4 Y 1 A VAL 35 ? A VAL 35 165 4 Y 1 A MET 36 ? A MET 36 166 4 Y 1 A CYS 37 ? A CYS 37 167 4 Y 1 A GLY 38 ? A GLY 38 168 4 Y 1 A LYS 39 ? A LYS 39 169 4 Y 1 A ALA 40 ? A ALA 40 170 4 Y 1 A PHE 41 ? A PHE 41 171 4 Y 1 A THR 42 ? A THR 42 172 4 Y 1 A GLN 43 ? A GLN 43 173 4 Y 1 A ALA 44 ? A ALA 44 174 4 Y 1 A SER 45 ? A SER 45 175 4 Y 1 A SER 46 ? A SER 46 176 4 Y 1 A LEU 47 ? A LEU 47 177 4 Y 1 A ILE 48 ? A ILE 48 178 4 Y 1 A ALA 49 ? A ALA 49 179 4 Y 1 A HIS 50 ? A HIS 50 180 4 Y 1 A VAL 51 ? A VAL 51 181 4 Y 1 A ARG 52 ? A ARG 52 182 4 Y 1 A GLN 53 ? A GLN 53 183 4 Y 1 A HIS 54 ? A HIS 54 184 4 Y 1 A THR 55 ? A THR 55 185 4 Y 1 A GLY 56 ? A GLY 56 186 4 Y 1 A GLU 57 ? A GLU 57 187 4 Y 1 A LYS 58 ? A LYS 58 188 4 Y 1 A PRO 59 ? A PRO 59 189 4 Y 1 A TYR 60 ? A TYR 60 190 4 Y 1 A VAL 61 ? A VAL 61 191 4 Y 1 A CYS 62 ? A CYS 62 192 4 Y 1 A GLU 63 ? A GLU 63 193 4 Y 1 A ARG 64 ? A ARG 64 194 4 Y 1 A CYS 65 ? A CYS 65 195 4 Y 1 A GLY 66 ? A GLY 66 196 4 Y 1 A LYS 67 ? A LYS 67 197 4 Y 1 A ARG 68 ? A ARG 68 198 4 Y 1 A PHE 69 ? A PHE 69 199 4 Y 1 A VAL 70 ? A VAL 70 200 4 Y 1 A GLN 71 ? A GLN 71 201 4 Y 1 A SER 72 ? A SER 72 202 4 Y 1 A SER 73 ? A SER 73 203 4 Y 1 A GLN 74 ? A GLN 74 204 4 Y 1 A LEU 75 ? A LEU 75 205 4 Y 1 A ALA 76 ? A ALA 76 206 4 Y 1 A ASN 77 ? A ASN 77 207 4 Y 1 A HIS 78 ? A HIS 78 208 4 Y 1 A ILE 79 ? A ILE 79 209 4 Y 1 A ARG 80 ? A ARG 80 210 4 Y 1 A HIS 81 ? A HIS 81 211 4 Y 1 A HIS 82 ? A HIS 82 212 4 Y 1 A ASP 83 ? A ASP 83 213 5 Y 1 A PRO 31 ? A PRO 31 214 5 Y 1 A CYS 32 ? A CYS 32 215 5 Y 1 A GLN 33 ? A GLN 33 216 5 Y 1 A CYS 34 ? A CYS 34 217 5 Y 1 A VAL 35 ? A VAL 35 218 5 Y 1 A MET 36 ? A MET 36 219 5 Y 1 A CYS 37 ? A CYS 37 220 5 Y 1 A GLY 38 ? A GLY 38 221 5 Y 1 A LYS 39 ? A LYS 39 222 5 Y 1 A ALA 40 ? A ALA 40 223 5 Y 1 A PHE 41 ? A PHE 41 224 5 Y 1 A THR 42 ? A THR 42 225 5 Y 1 A GLN 43 ? A GLN 43 226 5 Y 1 A ALA 44 ? A ALA 44 227 5 Y 1 A SER 45 ? A SER 45 228 5 Y 1 A SER 46 ? A SER 46 229 5 Y 1 A LEU 47 ? A LEU 47 230 5 Y 1 A ILE 48 ? A ILE 48 231 5 Y 1 A ALA 49 ? A ALA 49 232 5 Y 1 A HIS 50 ? A HIS 50 233 5 Y 1 A VAL 51 ? A VAL 51 234 5 Y 1 A ARG 52 ? A ARG 52 235 5 Y 1 A GLN 53 ? A GLN 53 236 5 Y 1 A HIS 54 ? A HIS 54 237 5 Y 1 A THR 55 ? A THR 55 238 5 Y 1 A GLY 56 ? A GLY 56 239 5 Y 1 A GLU 57 ? A GLU 57 240 5 Y 1 A LYS 58 ? A LYS 58 241 5 Y 1 A PRO 59 ? A PRO 59 242 5 Y 1 A TYR 60 ? A TYR 60 243 5 Y 1 A VAL 61 ? A VAL 61 244 5 Y 1 A CYS 62 ? A CYS 62 245 5 Y 1 A GLU 63 ? A GLU 63 246 5 Y 1 A ARG 64 ? A ARG 64 247 5 Y 1 A CYS 65 ? A CYS 65 248 5 Y 1 A GLY 66 ? A GLY 66 249 5 Y 1 A LYS 67 ? A LYS 67 250 5 Y 1 A ARG 68 ? A ARG 68 251 5 Y 1 A PHE 69 ? A PHE 69 252 5 Y 1 A VAL 70 ? A VAL 70 253 5 Y 1 A GLN 71 ? A GLN 71 254 5 Y 1 A SER 72 ? A SER 72 255 5 Y 1 A SER 73 ? A SER 73 256 5 Y 1 A GLN 74 ? A GLN 74 257 5 Y 1 A LEU 75 ? A LEU 75 258 5 Y 1 A ALA 76 ? A ALA 76 259 5 Y 1 A ASN 77 ? A ASN 77 260 5 Y 1 A HIS 78 ? A HIS 78 261 5 Y 1 A ILE 79 ? A ILE 79 262 5 Y 1 A ARG 80 ? A ARG 80 263 5 Y 1 A HIS 81 ? A HIS 81 264 5 Y 1 A HIS 82 ? A HIS 82 265 5 Y 1 A ASP 83 ? A ASP 83 266 6 Y 1 A PRO 31 ? A PRO 31 267 6 Y 1 A CYS 32 ? A CYS 32 268 6 Y 1 A GLN 33 ? A GLN 33 269 6 Y 1 A CYS 34 ? A CYS 34 270 6 Y 1 A VAL 35 ? A VAL 35 271 6 Y 1 A MET 36 ? A MET 36 272 6 Y 1 A CYS 37 ? A CYS 37 273 6 Y 1 A GLY 38 ? A GLY 38 274 6 Y 1 A LYS 39 ? A LYS 39 275 6 Y 1 A ALA 40 ? A ALA 40 276 6 Y 1 A PHE 41 ? A PHE 41 277 6 Y 1 A THR 42 ? A THR 42 278 6 Y 1 A GLN 43 ? A GLN 43 279 6 Y 1 A ALA 44 ? A ALA 44 280 6 Y 1 A SER 45 ? A SER 45 281 6 Y 1 A SER 46 ? A SER 46 282 6 Y 1 A LEU 47 ? A LEU 47 283 6 Y 1 A ILE 48 ? A ILE 48 284 6 Y 1 A ALA 49 ? A ALA 49 285 6 Y 1 A HIS 50 ? A HIS 50 286 6 Y 1 A VAL 51 ? A VAL 51 287 6 Y 1 A ARG 52 ? A ARG 52 288 6 Y 1 A GLN 53 ? A GLN 53 289 6 Y 1 A HIS 54 ? A HIS 54 290 6 Y 1 A THR 55 ? A THR 55 291 6 Y 1 A GLY 56 ? A GLY 56 292 6 Y 1 A GLU 57 ? A GLU 57 293 6 Y 1 A LYS 58 ? A LYS 58 294 6 Y 1 A PRO 59 ? A PRO 59 295 6 Y 1 A TYR 60 ? A TYR 60 296 6 Y 1 A VAL 61 ? A VAL 61 297 6 Y 1 A CYS 62 ? A CYS 62 298 6 Y 1 A GLU 63 ? A GLU 63 299 6 Y 1 A ARG 64 ? A ARG 64 300 6 Y 1 A CYS 65 ? A CYS 65 301 6 Y 1 A GLY 66 ? A GLY 66 302 6 Y 1 A LYS 67 ? A LYS 67 303 6 Y 1 A ARG 68 ? A ARG 68 304 6 Y 1 A PHE 69 ? A PHE 69 305 6 Y 1 A VAL 70 ? A VAL 70 306 6 Y 1 A GLN 71 ? A GLN 71 307 6 Y 1 A SER 72 ? A SER 72 308 6 Y 1 A SER 73 ? A SER 73 309 6 Y 1 A GLN 74 ? A GLN 74 310 6 Y 1 A LEU 75 ? A LEU 75 311 6 Y 1 A ALA 76 ? A ALA 76 312 6 Y 1 A ASN 77 ? A ASN 77 313 6 Y 1 A HIS 78 ? A HIS 78 314 6 Y 1 A ILE 79 ? A ILE 79 315 6 Y 1 A ARG 80 ? A ARG 80 316 6 Y 1 A HIS 81 ? A HIS 81 317 6 Y 1 A HIS 82 ? A HIS 82 318 6 Y 1 A ASP 83 ? A ASP 83 319 7 Y 1 A PRO 31 ? A PRO 31 320 7 Y 1 A CYS 32 ? A CYS 32 321 7 Y 1 A GLN 33 ? A GLN 33 322 7 Y 1 A CYS 34 ? A CYS 34 323 7 Y 1 A VAL 35 ? A VAL 35 324 7 Y 1 A MET 36 ? A MET 36 325 7 Y 1 A CYS 37 ? A CYS 37 326 7 Y 1 A GLY 38 ? A GLY 38 327 7 Y 1 A LYS 39 ? A LYS 39 328 7 Y 1 A ALA 40 ? A ALA 40 329 7 Y 1 A PHE 41 ? A PHE 41 330 7 Y 1 A THR 42 ? A THR 42 331 7 Y 1 A GLN 43 ? A GLN 43 332 7 Y 1 A ALA 44 ? A ALA 44 333 7 Y 1 A SER 45 ? A SER 45 334 7 Y 1 A SER 46 ? A SER 46 335 7 Y 1 A LEU 47 ? A LEU 47 336 7 Y 1 A ILE 48 ? A ILE 48 337 7 Y 1 A ALA 49 ? A ALA 49 338 7 Y 1 A HIS 50 ? A HIS 50 339 7 Y 1 A VAL 51 ? A VAL 51 340 7 Y 1 A ARG 52 ? A ARG 52 341 7 Y 1 A GLN 53 ? A GLN 53 342 7 Y 1 A HIS 54 ? A HIS 54 343 7 Y 1 A THR 55 ? A THR 55 344 7 Y 1 A GLY 56 ? A GLY 56 345 7 Y 1 A GLU 57 ? A GLU 57 346 7 Y 1 A LYS 58 ? A LYS 58 347 7 Y 1 A PRO 59 ? A PRO 59 348 7 Y 1 A TYR 60 ? A TYR 60 349 7 Y 1 A VAL 61 ? A VAL 61 350 7 Y 1 A CYS 62 ? A CYS 62 351 7 Y 1 A GLU 63 ? A GLU 63 352 7 Y 1 A ARG 64 ? A ARG 64 353 7 Y 1 A CYS 65 ? A CYS 65 354 7 Y 1 A GLY 66 ? A GLY 66 355 7 Y 1 A LYS 67 ? A LYS 67 356 7 Y 1 A ARG 68 ? A ARG 68 357 7 Y 1 A PHE 69 ? A PHE 69 358 7 Y 1 A VAL 70 ? A VAL 70 359 7 Y 1 A GLN 71 ? A GLN 71 360 7 Y 1 A SER 72 ? A SER 72 361 7 Y 1 A SER 73 ? A SER 73 362 7 Y 1 A GLN 74 ? A GLN 74 363 7 Y 1 A LEU 75 ? A LEU 75 364 7 Y 1 A ALA 76 ? A ALA 76 365 7 Y 1 A ASN 77 ? A ASN 77 366 7 Y 1 A HIS 78 ? A HIS 78 367 7 Y 1 A ILE 79 ? A ILE 79 368 7 Y 1 A ARG 80 ? A ARG 80 369 7 Y 1 A HIS 81 ? A HIS 81 370 7 Y 1 A HIS 82 ? A HIS 82 371 7 Y 1 A ASP 83 ? A ASP 83 372 8 Y 1 A PRO 31 ? A PRO 31 373 8 Y 1 A CYS 32 ? A CYS 32 374 8 Y 1 A GLN 33 ? A GLN 33 375 8 Y 1 A CYS 34 ? A CYS 34 376 8 Y 1 A VAL 35 ? A VAL 35 377 8 Y 1 A MET 36 ? A MET 36 378 8 Y 1 A CYS 37 ? A CYS 37 379 8 Y 1 A GLY 38 ? A GLY 38 380 8 Y 1 A LYS 39 ? A LYS 39 381 8 Y 1 A ALA 40 ? A ALA 40 382 8 Y 1 A PHE 41 ? A PHE 41 383 8 Y 1 A THR 42 ? A THR 42 384 8 Y 1 A GLN 43 ? A GLN 43 385 8 Y 1 A ALA 44 ? A ALA 44 386 8 Y 1 A SER 45 ? A SER 45 387 8 Y 1 A SER 46 ? A SER 46 388 8 Y 1 A LEU 47 ? A LEU 47 389 8 Y 1 A ILE 48 ? A ILE 48 390 8 Y 1 A ALA 49 ? A ALA 49 391 8 Y 1 A HIS 50 ? A HIS 50 392 8 Y 1 A VAL 51 ? A VAL 51 393 8 Y 1 A ARG 52 ? A ARG 52 394 8 Y 1 A GLN 53 ? A GLN 53 395 8 Y 1 A HIS 54 ? A HIS 54 396 8 Y 1 A THR 55 ? A THR 55 397 8 Y 1 A GLY 56 ? A GLY 56 398 8 Y 1 A GLU 57 ? A GLU 57 399 8 Y 1 A LYS 58 ? A LYS 58 400 8 Y 1 A PRO 59 ? A PRO 59 401 8 Y 1 A TYR 60 ? A TYR 60 402 8 Y 1 A VAL 61 ? A VAL 61 403 8 Y 1 A CYS 62 ? A CYS 62 404 8 Y 1 A GLU 63 ? A GLU 63 405 8 Y 1 A ARG 64 ? A ARG 64 406 8 Y 1 A CYS 65 ? A CYS 65 407 8 Y 1 A GLY 66 ? A GLY 66 408 8 Y 1 A LYS 67 ? A LYS 67 409 8 Y 1 A ARG 68 ? A ARG 68 410 8 Y 1 A PHE 69 ? A PHE 69 411 8 Y 1 A VAL 70 ? A VAL 70 412 8 Y 1 A GLN 71 ? A GLN 71 413 8 Y 1 A SER 72 ? A SER 72 414 8 Y 1 A SER 73 ? A SER 73 415 8 Y 1 A GLN 74 ? A GLN 74 416 8 Y 1 A LEU 75 ? A LEU 75 417 8 Y 1 A ALA 76 ? A ALA 76 418 8 Y 1 A ASN 77 ? A ASN 77 419 8 Y 1 A HIS 78 ? A HIS 78 420 8 Y 1 A ILE 79 ? A ILE 79 421 8 Y 1 A ARG 80 ? A ARG 80 422 8 Y 1 A HIS 81 ? A HIS 81 423 8 Y 1 A HIS 82 ? A HIS 82 424 8 Y 1 A ASP 83 ? A ASP 83 425 9 Y 1 A PRO 31 ? A PRO 31 426 9 Y 1 A CYS 32 ? A CYS 32 427 9 Y 1 A GLN 33 ? A GLN 33 428 9 Y 1 A CYS 34 ? A CYS 34 429 9 Y 1 A VAL 35 ? A VAL 35 430 9 Y 1 A MET 36 ? A MET 36 431 9 Y 1 A CYS 37 ? A CYS 37 432 9 Y 1 A GLY 38 ? A GLY 38 433 9 Y 1 A LYS 39 ? A LYS 39 434 9 Y 1 A ALA 40 ? A ALA 40 435 9 Y 1 A PHE 41 ? A PHE 41 436 9 Y 1 A THR 42 ? A THR 42 437 9 Y 1 A GLN 43 ? A GLN 43 438 9 Y 1 A ALA 44 ? A ALA 44 439 9 Y 1 A SER 45 ? A SER 45 440 9 Y 1 A SER 46 ? A SER 46 441 9 Y 1 A LEU 47 ? A LEU 47 442 9 Y 1 A ILE 48 ? A ILE 48 443 9 Y 1 A ALA 49 ? A ALA 49 444 9 Y 1 A HIS 50 ? A HIS 50 445 9 Y 1 A VAL 51 ? A VAL 51 446 9 Y 1 A ARG 52 ? A ARG 52 447 9 Y 1 A GLN 53 ? A GLN 53 448 9 Y 1 A HIS 54 ? A HIS 54 449 9 Y 1 A THR 55 ? A THR 55 450 9 Y 1 A GLY 56 ? A GLY 56 451 9 Y 1 A GLU 57 ? A GLU 57 452 9 Y 1 A LYS 58 ? A LYS 58 453 9 Y 1 A PRO 59 ? A PRO 59 454 9 Y 1 A TYR 60 ? A TYR 60 455 9 Y 1 A VAL 61 ? A VAL 61 456 9 Y 1 A CYS 62 ? A CYS 62 457 9 Y 1 A GLU 63 ? A GLU 63 458 9 Y 1 A ARG 64 ? A ARG 64 459 9 Y 1 A CYS 65 ? A CYS 65 460 9 Y 1 A GLY 66 ? A GLY 66 461 9 Y 1 A LYS 67 ? A LYS 67 462 9 Y 1 A ARG 68 ? A ARG 68 463 9 Y 1 A PHE 69 ? A PHE 69 464 9 Y 1 A VAL 70 ? A VAL 70 465 9 Y 1 A GLN 71 ? A GLN 71 466 9 Y 1 A SER 72 ? A SER 72 467 9 Y 1 A SER 73 ? A SER 73 468 9 Y 1 A GLN 74 ? A GLN 74 469 9 Y 1 A LEU 75 ? A LEU 75 470 9 Y 1 A ALA 76 ? A ALA 76 471 9 Y 1 A ASN 77 ? A ASN 77 472 9 Y 1 A HIS 78 ? A HIS 78 473 9 Y 1 A ILE 79 ? A ILE 79 474 9 Y 1 A ARG 80 ? A ARG 80 475 9 Y 1 A HIS 81 ? A HIS 81 476 9 Y 1 A HIS 82 ? A HIS 82 477 9 Y 1 A ASP 83 ? A ASP 83 478 10 Y 1 A PRO 31 ? A PRO 31 479 10 Y 1 A CYS 32 ? A CYS 32 480 10 Y 1 A GLN 33 ? A GLN 33 481 10 Y 1 A CYS 34 ? A CYS 34 482 10 Y 1 A VAL 35 ? A VAL 35 483 10 Y 1 A MET 36 ? A MET 36 484 10 Y 1 A CYS 37 ? A CYS 37 485 10 Y 1 A GLY 38 ? A GLY 38 486 10 Y 1 A LYS 39 ? A LYS 39 487 10 Y 1 A ALA 40 ? A ALA 40 488 10 Y 1 A PHE 41 ? A PHE 41 489 10 Y 1 A THR 42 ? A THR 42 490 10 Y 1 A GLN 43 ? A GLN 43 491 10 Y 1 A ALA 44 ? A ALA 44 492 10 Y 1 A SER 45 ? A SER 45 493 10 Y 1 A SER 46 ? A SER 46 494 10 Y 1 A LEU 47 ? A LEU 47 495 10 Y 1 A ILE 48 ? A ILE 48 496 10 Y 1 A ALA 49 ? A ALA 49 497 10 Y 1 A HIS 50 ? A HIS 50 498 10 Y 1 A VAL 51 ? A VAL 51 499 10 Y 1 A ARG 52 ? A ARG 52 500 10 Y 1 A GLN 53 ? A GLN 53 501 10 Y 1 A HIS 54 ? A HIS 54 502 10 Y 1 A THR 55 ? A THR 55 503 10 Y 1 A GLY 56 ? A GLY 56 504 10 Y 1 A GLU 57 ? A GLU 57 505 10 Y 1 A LYS 58 ? A LYS 58 506 10 Y 1 A PRO 59 ? A PRO 59 507 10 Y 1 A TYR 60 ? A TYR 60 508 10 Y 1 A VAL 61 ? A VAL 61 509 10 Y 1 A CYS 62 ? A CYS 62 510 10 Y 1 A GLU 63 ? A GLU 63 511 10 Y 1 A ARG 64 ? A ARG 64 512 10 Y 1 A CYS 65 ? A CYS 65 513 10 Y 1 A GLY 66 ? A GLY 66 514 10 Y 1 A LYS 67 ? A LYS 67 515 10 Y 1 A ARG 68 ? A ARG 68 516 10 Y 1 A PHE 69 ? A PHE 69 517 10 Y 1 A VAL 70 ? A VAL 70 518 10 Y 1 A GLN 71 ? A GLN 71 519 10 Y 1 A SER 72 ? A SER 72 520 10 Y 1 A SER 73 ? A SER 73 521 10 Y 1 A GLN 74 ? A GLN 74 522 10 Y 1 A LEU 75 ? A LEU 75 523 10 Y 1 A ALA 76 ? A ALA 76 524 10 Y 1 A ASN 77 ? A ASN 77 525 10 Y 1 A HIS 78 ? A HIS 78 526 10 Y 1 A ILE 79 ? A ILE 79 527 10 Y 1 A ARG 80 ? A ARG 80 528 10 Y 1 A HIS 81 ? A HIS 81 529 10 Y 1 A HIS 82 ? A HIS 82 530 10 Y 1 A ASP 83 ? A ASP 83 531 11 Y 1 A PRO 31 ? A PRO 31 532 11 Y 1 A CYS 32 ? A CYS 32 533 11 Y 1 A GLN 33 ? A GLN 33 534 11 Y 1 A CYS 34 ? A CYS 34 535 11 Y 1 A VAL 35 ? A VAL 35 536 11 Y 1 A MET 36 ? A MET 36 537 11 Y 1 A CYS 37 ? A CYS 37 538 11 Y 1 A GLY 38 ? A GLY 38 539 11 Y 1 A LYS 39 ? A LYS 39 540 11 Y 1 A ALA 40 ? A ALA 40 541 11 Y 1 A PHE 41 ? A PHE 41 542 11 Y 1 A THR 42 ? A THR 42 543 11 Y 1 A GLN 43 ? A GLN 43 544 11 Y 1 A ALA 44 ? A ALA 44 545 11 Y 1 A SER 45 ? A SER 45 546 11 Y 1 A SER 46 ? A SER 46 547 11 Y 1 A LEU 47 ? A LEU 47 548 11 Y 1 A ILE 48 ? A ILE 48 549 11 Y 1 A ALA 49 ? A ALA 49 550 11 Y 1 A HIS 50 ? A HIS 50 551 11 Y 1 A VAL 51 ? A VAL 51 552 11 Y 1 A ARG 52 ? A ARG 52 553 11 Y 1 A GLN 53 ? A GLN 53 554 11 Y 1 A HIS 54 ? A HIS 54 555 11 Y 1 A THR 55 ? A THR 55 556 11 Y 1 A GLY 56 ? A GLY 56 557 11 Y 1 A GLU 57 ? A GLU 57 558 11 Y 1 A LYS 58 ? A LYS 58 559 11 Y 1 A PRO 59 ? A PRO 59 560 11 Y 1 A TYR 60 ? A TYR 60 561 11 Y 1 A VAL 61 ? A VAL 61 562 11 Y 1 A CYS 62 ? A CYS 62 563 11 Y 1 A GLU 63 ? A GLU 63 564 11 Y 1 A ARG 64 ? A ARG 64 565 11 Y 1 A CYS 65 ? A CYS 65 566 11 Y 1 A GLY 66 ? A GLY 66 567 11 Y 1 A LYS 67 ? A LYS 67 568 11 Y 1 A ARG 68 ? A ARG 68 569 11 Y 1 A PHE 69 ? A PHE 69 570 11 Y 1 A VAL 70 ? A VAL 70 571 11 Y 1 A GLN 71 ? A GLN 71 572 11 Y 1 A SER 72 ? A SER 72 573 11 Y 1 A SER 73 ? A SER 73 574 11 Y 1 A GLN 74 ? A GLN 74 575 11 Y 1 A LEU 75 ? A LEU 75 576 11 Y 1 A ALA 76 ? A ALA 76 577 11 Y 1 A ASN 77 ? A ASN 77 578 11 Y 1 A HIS 78 ? A HIS 78 579 11 Y 1 A ILE 79 ? A ILE 79 580 11 Y 1 A ARG 80 ? A ARG 80 581 11 Y 1 A HIS 81 ? A HIS 81 582 11 Y 1 A HIS 82 ? A HIS 82 583 11 Y 1 A ASP 83 ? A ASP 83 584 12 Y 1 A PRO 31 ? A PRO 31 585 12 Y 1 A CYS 32 ? A CYS 32 586 12 Y 1 A GLN 33 ? A GLN 33 587 12 Y 1 A CYS 34 ? A CYS 34 588 12 Y 1 A VAL 35 ? A VAL 35 589 12 Y 1 A MET 36 ? A MET 36 590 12 Y 1 A CYS 37 ? A CYS 37 591 12 Y 1 A GLY 38 ? A GLY 38 592 12 Y 1 A LYS 39 ? A LYS 39 593 12 Y 1 A ALA 40 ? A ALA 40 594 12 Y 1 A PHE 41 ? A PHE 41 595 12 Y 1 A THR 42 ? A THR 42 596 12 Y 1 A GLN 43 ? A GLN 43 597 12 Y 1 A ALA 44 ? A ALA 44 598 12 Y 1 A SER 45 ? A SER 45 599 12 Y 1 A SER 46 ? A SER 46 600 12 Y 1 A LEU 47 ? A LEU 47 601 12 Y 1 A ILE 48 ? A ILE 48 602 12 Y 1 A ALA 49 ? A ALA 49 603 12 Y 1 A HIS 50 ? A HIS 50 604 12 Y 1 A VAL 51 ? A VAL 51 605 12 Y 1 A ARG 52 ? A ARG 52 606 12 Y 1 A GLN 53 ? A GLN 53 607 12 Y 1 A HIS 54 ? A HIS 54 608 12 Y 1 A THR 55 ? A THR 55 609 12 Y 1 A GLY 56 ? A GLY 56 610 12 Y 1 A GLU 57 ? A GLU 57 611 12 Y 1 A LYS 58 ? A LYS 58 612 12 Y 1 A PRO 59 ? A PRO 59 613 12 Y 1 A TYR 60 ? A TYR 60 614 12 Y 1 A VAL 61 ? A VAL 61 615 12 Y 1 A CYS 62 ? A CYS 62 616 12 Y 1 A GLU 63 ? A GLU 63 617 12 Y 1 A ARG 64 ? A ARG 64 618 12 Y 1 A CYS 65 ? A CYS 65 619 12 Y 1 A GLY 66 ? A GLY 66 620 12 Y 1 A LYS 67 ? A LYS 67 621 12 Y 1 A ARG 68 ? A ARG 68 622 12 Y 1 A PHE 69 ? A PHE 69 623 12 Y 1 A VAL 70 ? A VAL 70 624 12 Y 1 A GLN 71 ? A GLN 71 625 12 Y 1 A SER 72 ? A SER 72 626 12 Y 1 A SER 73 ? A SER 73 627 12 Y 1 A GLN 74 ? A GLN 74 628 12 Y 1 A LEU 75 ? A LEU 75 629 12 Y 1 A ALA 76 ? A ALA 76 630 12 Y 1 A ASN 77 ? A ASN 77 631 12 Y 1 A HIS 78 ? A HIS 78 632 12 Y 1 A ILE 79 ? A ILE 79 633 12 Y 1 A ARG 80 ? A ARG 80 634 12 Y 1 A HIS 81 ? A HIS 81 635 12 Y 1 A HIS 82 ? A HIS 82 636 12 Y 1 A ASP 83 ? A ASP 83 637 13 Y 1 A PRO 31 ? A PRO 31 638 13 Y 1 A CYS 32 ? A CYS 32 639 13 Y 1 A GLN 33 ? A GLN 33 640 13 Y 1 A CYS 34 ? A CYS 34 641 13 Y 1 A VAL 35 ? A VAL 35 642 13 Y 1 A MET 36 ? A MET 36 643 13 Y 1 A CYS 37 ? A CYS 37 644 13 Y 1 A GLY 38 ? A GLY 38 645 13 Y 1 A LYS 39 ? A LYS 39 646 13 Y 1 A ALA 40 ? A ALA 40 647 13 Y 1 A PHE 41 ? A PHE 41 648 13 Y 1 A THR 42 ? A THR 42 649 13 Y 1 A GLN 43 ? A GLN 43 650 13 Y 1 A ALA 44 ? A ALA 44 651 13 Y 1 A SER 45 ? A SER 45 652 13 Y 1 A SER 46 ? A SER 46 653 13 Y 1 A LEU 47 ? A LEU 47 654 13 Y 1 A ILE 48 ? A ILE 48 655 13 Y 1 A ALA 49 ? A ALA 49 656 13 Y 1 A HIS 50 ? A HIS 50 657 13 Y 1 A VAL 51 ? A VAL 51 658 13 Y 1 A ARG 52 ? A ARG 52 659 13 Y 1 A GLN 53 ? A GLN 53 660 13 Y 1 A HIS 54 ? A HIS 54 661 13 Y 1 A THR 55 ? A THR 55 662 13 Y 1 A GLY 56 ? A GLY 56 663 13 Y 1 A GLU 57 ? A GLU 57 664 13 Y 1 A LYS 58 ? A LYS 58 665 13 Y 1 A PRO 59 ? A PRO 59 666 13 Y 1 A TYR 60 ? A TYR 60 667 13 Y 1 A VAL 61 ? A VAL 61 668 13 Y 1 A CYS 62 ? A CYS 62 669 13 Y 1 A GLU 63 ? A GLU 63 670 13 Y 1 A ARG 64 ? A ARG 64 671 13 Y 1 A CYS 65 ? A CYS 65 672 13 Y 1 A GLY 66 ? A GLY 66 673 13 Y 1 A LYS 67 ? A LYS 67 674 13 Y 1 A ARG 68 ? A ARG 68 675 13 Y 1 A PHE 69 ? A PHE 69 676 13 Y 1 A VAL 70 ? A VAL 70 677 13 Y 1 A GLN 71 ? A GLN 71 678 13 Y 1 A SER 72 ? A SER 72 679 13 Y 1 A SER 73 ? A SER 73 680 13 Y 1 A GLN 74 ? A GLN 74 681 13 Y 1 A LEU 75 ? A LEU 75 682 13 Y 1 A ALA 76 ? A ALA 76 683 13 Y 1 A ASN 77 ? A ASN 77 684 13 Y 1 A HIS 78 ? A HIS 78 685 13 Y 1 A ILE 79 ? A ILE 79 686 13 Y 1 A ARG 80 ? A ARG 80 687 13 Y 1 A HIS 81 ? A HIS 81 688 13 Y 1 A HIS 82 ? A HIS 82 689 13 Y 1 A ASP 83 ? A ASP 83 690 14 Y 1 A PRO 31 ? A PRO 31 691 14 Y 1 A CYS 32 ? A CYS 32 692 14 Y 1 A GLN 33 ? A GLN 33 693 14 Y 1 A CYS 34 ? A CYS 34 694 14 Y 1 A VAL 35 ? A VAL 35 695 14 Y 1 A MET 36 ? A MET 36 696 14 Y 1 A CYS 37 ? A CYS 37 697 14 Y 1 A GLY 38 ? A GLY 38 698 14 Y 1 A LYS 39 ? A LYS 39 699 14 Y 1 A ALA 40 ? A ALA 40 700 14 Y 1 A PHE 41 ? A PHE 41 701 14 Y 1 A THR 42 ? A THR 42 702 14 Y 1 A GLN 43 ? A GLN 43 703 14 Y 1 A ALA 44 ? A ALA 44 704 14 Y 1 A SER 45 ? A SER 45 705 14 Y 1 A SER 46 ? A SER 46 706 14 Y 1 A LEU 47 ? A LEU 47 707 14 Y 1 A ILE 48 ? A ILE 48 708 14 Y 1 A ALA 49 ? A ALA 49 709 14 Y 1 A HIS 50 ? A HIS 50 710 14 Y 1 A VAL 51 ? A VAL 51 711 14 Y 1 A ARG 52 ? A ARG 52 712 14 Y 1 A GLN 53 ? A GLN 53 713 14 Y 1 A HIS 54 ? A HIS 54 714 14 Y 1 A THR 55 ? A THR 55 715 14 Y 1 A GLY 56 ? A GLY 56 716 14 Y 1 A GLU 57 ? A GLU 57 717 14 Y 1 A LYS 58 ? A LYS 58 718 14 Y 1 A PRO 59 ? A PRO 59 719 14 Y 1 A TYR 60 ? A TYR 60 720 14 Y 1 A VAL 61 ? A VAL 61 721 14 Y 1 A CYS 62 ? A CYS 62 722 14 Y 1 A GLU 63 ? A GLU 63 723 14 Y 1 A ARG 64 ? A ARG 64 724 14 Y 1 A CYS 65 ? A CYS 65 725 14 Y 1 A GLY 66 ? A GLY 66 726 14 Y 1 A LYS 67 ? A LYS 67 727 14 Y 1 A ARG 68 ? A ARG 68 728 14 Y 1 A PHE 69 ? A PHE 69 729 14 Y 1 A VAL 70 ? A VAL 70 730 14 Y 1 A GLN 71 ? A GLN 71 731 14 Y 1 A SER 72 ? A SER 72 732 14 Y 1 A SER 73 ? A SER 73 733 14 Y 1 A GLN 74 ? A GLN 74 734 14 Y 1 A LEU 75 ? A LEU 75 735 14 Y 1 A ALA 76 ? A ALA 76 736 14 Y 1 A ASN 77 ? A ASN 77 737 14 Y 1 A HIS 78 ? A HIS 78 738 14 Y 1 A ILE 79 ? A ILE 79 739 14 Y 1 A ARG 80 ? A ARG 80 740 14 Y 1 A HIS 81 ? A HIS 81 741 14 Y 1 A HIS 82 ? A HIS 82 742 14 Y 1 A ASP 83 ? A ASP 83 743 15 Y 1 A PRO 31 ? A PRO 31 744 15 Y 1 A CYS 32 ? A CYS 32 745 15 Y 1 A GLN 33 ? A GLN 33 746 15 Y 1 A CYS 34 ? A CYS 34 747 15 Y 1 A VAL 35 ? A VAL 35 748 15 Y 1 A MET 36 ? A MET 36 749 15 Y 1 A CYS 37 ? A CYS 37 750 15 Y 1 A GLY 38 ? A GLY 38 751 15 Y 1 A LYS 39 ? A LYS 39 752 15 Y 1 A ALA 40 ? A ALA 40 753 15 Y 1 A PHE 41 ? A PHE 41 754 15 Y 1 A THR 42 ? A THR 42 755 15 Y 1 A GLN 43 ? A GLN 43 756 15 Y 1 A ALA 44 ? A ALA 44 757 15 Y 1 A SER 45 ? A SER 45 758 15 Y 1 A SER 46 ? A SER 46 759 15 Y 1 A LEU 47 ? A LEU 47 760 15 Y 1 A ILE 48 ? A ILE 48 761 15 Y 1 A ALA 49 ? A ALA 49 762 15 Y 1 A HIS 50 ? A HIS 50 763 15 Y 1 A VAL 51 ? A VAL 51 764 15 Y 1 A ARG 52 ? A ARG 52 765 15 Y 1 A GLN 53 ? A GLN 53 766 15 Y 1 A HIS 54 ? A HIS 54 767 15 Y 1 A THR 55 ? A THR 55 768 15 Y 1 A GLY 56 ? A GLY 56 769 15 Y 1 A GLU 57 ? A GLU 57 770 15 Y 1 A LYS 58 ? A LYS 58 771 15 Y 1 A PRO 59 ? A PRO 59 772 15 Y 1 A TYR 60 ? A TYR 60 773 15 Y 1 A VAL 61 ? A VAL 61 774 15 Y 1 A CYS 62 ? A CYS 62 775 15 Y 1 A GLU 63 ? A GLU 63 776 15 Y 1 A ARG 64 ? A ARG 64 777 15 Y 1 A CYS 65 ? A CYS 65 778 15 Y 1 A GLY 66 ? A GLY 66 779 15 Y 1 A LYS 67 ? A LYS 67 780 15 Y 1 A ARG 68 ? A ARG 68 781 15 Y 1 A PHE 69 ? A PHE 69 782 15 Y 1 A VAL 70 ? A VAL 70 783 15 Y 1 A GLN 71 ? A GLN 71 784 15 Y 1 A SER 72 ? A SER 72 785 15 Y 1 A SER 73 ? A SER 73 786 15 Y 1 A GLN 74 ? A GLN 74 787 15 Y 1 A LEU 75 ? A LEU 75 788 15 Y 1 A ALA 76 ? A ALA 76 789 15 Y 1 A ASN 77 ? A ASN 77 790 15 Y 1 A HIS 78 ? A HIS 78 791 15 Y 1 A ILE 79 ? A ILE 79 792 15 Y 1 A ARG 80 ? A ARG 80 793 15 Y 1 A HIS 81 ? A HIS 81 794 15 Y 1 A HIS 82 ? A HIS 82 795 15 Y 1 A ASP 83 ? A ASP 83 796 16 Y 1 A PRO 31 ? A PRO 31 797 16 Y 1 A CYS 32 ? A CYS 32 798 16 Y 1 A GLN 33 ? A GLN 33 799 16 Y 1 A CYS 34 ? A CYS 34 800 16 Y 1 A VAL 35 ? A VAL 35 801 16 Y 1 A MET 36 ? A MET 36 802 16 Y 1 A CYS 37 ? A CYS 37 803 16 Y 1 A GLY 38 ? A GLY 38 804 16 Y 1 A LYS 39 ? A LYS 39 805 16 Y 1 A ALA 40 ? A ALA 40 806 16 Y 1 A PHE 41 ? A PHE 41 807 16 Y 1 A THR 42 ? A THR 42 808 16 Y 1 A GLN 43 ? A GLN 43 809 16 Y 1 A ALA 44 ? A ALA 44 810 16 Y 1 A SER 45 ? A SER 45 811 16 Y 1 A SER 46 ? A SER 46 812 16 Y 1 A LEU 47 ? A LEU 47 813 16 Y 1 A ILE 48 ? A ILE 48 814 16 Y 1 A ALA 49 ? A ALA 49 815 16 Y 1 A HIS 50 ? A HIS 50 816 16 Y 1 A VAL 51 ? A VAL 51 817 16 Y 1 A ARG 52 ? A ARG 52 818 16 Y 1 A GLN 53 ? A GLN 53 819 16 Y 1 A HIS 54 ? A HIS 54 820 16 Y 1 A THR 55 ? A THR 55 821 16 Y 1 A GLY 56 ? A GLY 56 822 16 Y 1 A GLU 57 ? A GLU 57 823 16 Y 1 A LYS 58 ? A LYS 58 824 16 Y 1 A PRO 59 ? A PRO 59 825 16 Y 1 A TYR 60 ? A TYR 60 826 16 Y 1 A VAL 61 ? A VAL 61 827 16 Y 1 A CYS 62 ? A CYS 62 828 16 Y 1 A GLU 63 ? A GLU 63 829 16 Y 1 A ARG 64 ? A ARG 64 830 16 Y 1 A CYS 65 ? A CYS 65 831 16 Y 1 A GLY 66 ? A GLY 66 832 16 Y 1 A LYS 67 ? A LYS 67 833 16 Y 1 A ARG 68 ? A ARG 68 834 16 Y 1 A PHE 69 ? A PHE 69 835 16 Y 1 A VAL 70 ? A VAL 70 836 16 Y 1 A GLN 71 ? A GLN 71 837 16 Y 1 A SER 72 ? A SER 72 838 16 Y 1 A SER 73 ? A SER 73 839 16 Y 1 A GLN 74 ? A GLN 74 840 16 Y 1 A LEU 75 ? A LEU 75 841 16 Y 1 A ALA 76 ? A ALA 76 842 16 Y 1 A ASN 77 ? A ASN 77 843 16 Y 1 A HIS 78 ? A HIS 78 844 16 Y 1 A ILE 79 ? A ILE 79 845 16 Y 1 A ARG 80 ? A ARG 80 846 16 Y 1 A HIS 81 ? A HIS 81 847 16 Y 1 A HIS 82 ? A HIS 82 848 16 Y 1 A ASP 83 ? A ASP 83 849 17 Y 1 A PRO 31 ? A PRO 31 850 17 Y 1 A CYS 32 ? A CYS 32 851 17 Y 1 A GLN 33 ? A GLN 33 852 17 Y 1 A CYS 34 ? A CYS 34 853 17 Y 1 A VAL 35 ? A VAL 35 854 17 Y 1 A MET 36 ? A MET 36 855 17 Y 1 A CYS 37 ? A CYS 37 856 17 Y 1 A GLY 38 ? A GLY 38 857 17 Y 1 A LYS 39 ? A LYS 39 858 17 Y 1 A ALA 40 ? A ALA 40 859 17 Y 1 A PHE 41 ? A PHE 41 860 17 Y 1 A THR 42 ? A THR 42 861 17 Y 1 A GLN 43 ? A GLN 43 862 17 Y 1 A ALA 44 ? A ALA 44 863 17 Y 1 A SER 45 ? A SER 45 864 17 Y 1 A SER 46 ? A SER 46 865 17 Y 1 A LEU 47 ? A LEU 47 866 17 Y 1 A ILE 48 ? A ILE 48 867 17 Y 1 A ALA 49 ? A ALA 49 868 17 Y 1 A HIS 50 ? A HIS 50 869 17 Y 1 A VAL 51 ? A VAL 51 870 17 Y 1 A ARG 52 ? A ARG 52 871 17 Y 1 A GLN 53 ? A GLN 53 872 17 Y 1 A HIS 54 ? A HIS 54 873 17 Y 1 A THR 55 ? A THR 55 874 17 Y 1 A GLY 56 ? A GLY 56 875 17 Y 1 A GLU 57 ? A GLU 57 876 17 Y 1 A LYS 58 ? A LYS 58 877 17 Y 1 A PRO 59 ? A PRO 59 878 17 Y 1 A TYR 60 ? A TYR 60 879 17 Y 1 A VAL 61 ? A VAL 61 880 17 Y 1 A CYS 62 ? A CYS 62 881 17 Y 1 A GLU 63 ? A GLU 63 882 17 Y 1 A ARG 64 ? A ARG 64 883 17 Y 1 A CYS 65 ? A CYS 65 884 17 Y 1 A GLY 66 ? A GLY 66 885 17 Y 1 A LYS 67 ? A LYS 67 886 17 Y 1 A ARG 68 ? A ARG 68 887 17 Y 1 A PHE 69 ? A PHE 69 888 17 Y 1 A VAL 70 ? A VAL 70 889 17 Y 1 A GLN 71 ? A GLN 71 890 17 Y 1 A SER 72 ? A SER 72 891 17 Y 1 A SER 73 ? A SER 73 892 17 Y 1 A GLN 74 ? A GLN 74 893 17 Y 1 A LEU 75 ? A LEU 75 894 17 Y 1 A ALA 76 ? A ALA 76 895 17 Y 1 A ASN 77 ? A ASN 77 896 17 Y 1 A HIS 78 ? A HIS 78 897 17 Y 1 A ILE 79 ? A ILE 79 898 17 Y 1 A ARG 80 ? A ARG 80 899 17 Y 1 A HIS 81 ? A HIS 81 900 17 Y 1 A HIS 82 ? A HIS 82 901 17 Y 1 A ASP 83 ? A ASP 83 902 18 Y 1 A PRO 31 ? A PRO 31 903 18 Y 1 A CYS 32 ? A CYS 32 904 18 Y 1 A GLN 33 ? A GLN 33 905 18 Y 1 A CYS 34 ? A CYS 34 906 18 Y 1 A VAL 35 ? A VAL 35 907 18 Y 1 A MET 36 ? A MET 36 908 18 Y 1 A CYS 37 ? A CYS 37 909 18 Y 1 A GLY 38 ? A GLY 38 910 18 Y 1 A LYS 39 ? A LYS 39 911 18 Y 1 A ALA 40 ? A ALA 40 912 18 Y 1 A PHE 41 ? A PHE 41 913 18 Y 1 A THR 42 ? A THR 42 914 18 Y 1 A GLN 43 ? A GLN 43 915 18 Y 1 A ALA 44 ? A ALA 44 916 18 Y 1 A SER 45 ? A SER 45 917 18 Y 1 A SER 46 ? A SER 46 918 18 Y 1 A LEU 47 ? A LEU 47 919 18 Y 1 A ILE 48 ? A ILE 48 920 18 Y 1 A ALA 49 ? A ALA 49 921 18 Y 1 A HIS 50 ? A HIS 50 922 18 Y 1 A VAL 51 ? A VAL 51 923 18 Y 1 A ARG 52 ? A ARG 52 924 18 Y 1 A GLN 53 ? A GLN 53 925 18 Y 1 A HIS 54 ? A HIS 54 926 18 Y 1 A THR 55 ? A THR 55 927 18 Y 1 A GLY 56 ? A GLY 56 928 18 Y 1 A GLU 57 ? A GLU 57 929 18 Y 1 A LYS 58 ? A LYS 58 930 18 Y 1 A PRO 59 ? A PRO 59 931 18 Y 1 A TYR 60 ? A TYR 60 932 18 Y 1 A VAL 61 ? A VAL 61 933 18 Y 1 A CYS 62 ? A CYS 62 934 18 Y 1 A GLU 63 ? A GLU 63 935 18 Y 1 A ARG 64 ? A ARG 64 936 18 Y 1 A CYS 65 ? A CYS 65 937 18 Y 1 A GLY 66 ? A GLY 66 938 18 Y 1 A LYS 67 ? A LYS 67 939 18 Y 1 A ARG 68 ? A ARG 68 940 18 Y 1 A PHE 69 ? A PHE 69 941 18 Y 1 A VAL 70 ? A VAL 70 942 18 Y 1 A GLN 71 ? A GLN 71 943 18 Y 1 A SER 72 ? A SER 72 944 18 Y 1 A SER 73 ? A SER 73 945 18 Y 1 A GLN 74 ? A GLN 74 946 18 Y 1 A LEU 75 ? A LEU 75 947 18 Y 1 A ALA 76 ? A ALA 76 948 18 Y 1 A ASN 77 ? A ASN 77 949 18 Y 1 A HIS 78 ? A HIS 78 950 18 Y 1 A ILE 79 ? A ILE 79 951 18 Y 1 A ARG 80 ? A ARG 80 952 18 Y 1 A HIS 81 ? A HIS 81 953 18 Y 1 A HIS 82 ? A HIS 82 954 18 Y 1 A ASP 83 ? A ASP 83 955 19 Y 1 A PRO 31 ? A PRO 31 956 19 Y 1 A CYS 32 ? A CYS 32 957 19 Y 1 A GLN 33 ? A GLN 33 958 19 Y 1 A CYS 34 ? A CYS 34 959 19 Y 1 A VAL 35 ? A VAL 35 960 19 Y 1 A MET 36 ? A MET 36 961 19 Y 1 A CYS 37 ? A CYS 37 962 19 Y 1 A GLY 38 ? A GLY 38 963 19 Y 1 A LYS 39 ? A LYS 39 964 19 Y 1 A ALA 40 ? A ALA 40 965 19 Y 1 A PHE 41 ? A PHE 41 966 19 Y 1 A THR 42 ? A THR 42 967 19 Y 1 A GLN 43 ? A GLN 43 968 19 Y 1 A ALA 44 ? A ALA 44 969 19 Y 1 A SER 45 ? A SER 45 970 19 Y 1 A SER 46 ? A SER 46 971 19 Y 1 A LEU 47 ? A LEU 47 972 19 Y 1 A ILE 48 ? A ILE 48 973 19 Y 1 A ALA 49 ? A ALA 49 974 19 Y 1 A HIS 50 ? A HIS 50 975 19 Y 1 A VAL 51 ? A VAL 51 976 19 Y 1 A ARG 52 ? A ARG 52 977 19 Y 1 A GLN 53 ? A GLN 53 978 19 Y 1 A HIS 54 ? A HIS 54 979 19 Y 1 A THR 55 ? A THR 55 980 19 Y 1 A GLY 56 ? A GLY 56 981 19 Y 1 A GLU 57 ? A GLU 57 982 19 Y 1 A LYS 58 ? A LYS 58 983 19 Y 1 A PRO 59 ? A PRO 59 984 19 Y 1 A TYR 60 ? A TYR 60 985 19 Y 1 A VAL 61 ? A VAL 61 986 19 Y 1 A CYS 62 ? A CYS 62 987 19 Y 1 A GLU 63 ? A GLU 63 988 19 Y 1 A ARG 64 ? A ARG 64 989 19 Y 1 A CYS 65 ? A CYS 65 990 19 Y 1 A GLY 66 ? A GLY 66 991 19 Y 1 A LYS 67 ? A LYS 67 992 19 Y 1 A ARG 68 ? A ARG 68 993 19 Y 1 A PHE 69 ? A PHE 69 994 19 Y 1 A VAL 70 ? A VAL 70 995 19 Y 1 A GLN 71 ? A GLN 71 996 19 Y 1 A SER 72 ? A SER 72 997 19 Y 1 A SER 73 ? A SER 73 998 19 Y 1 A GLN 74 ? A GLN 74 999 19 Y 1 A LEU 75 ? A LEU 75 1000 19 Y 1 A ALA 76 ? A ALA 76 1001 19 Y 1 A ASN 77 ? A ASN 77 1002 19 Y 1 A HIS 78 ? A HIS 78 1003 19 Y 1 A ILE 79 ? A ILE 79 1004 19 Y 1 A ARG 80 ? A ARG 80 1005 19 Y 1 A HIS 81 ? A HIS 81 1006 19 Y 1 A HIS 82 ? A HIS 82 1007 19 Y 1 A ASP 83 ? A ASP 83 1008 20 Y 1 A PRO 31 ? A PRO 31 1009 20 Y 1 A CYS 32 ? A CYS 32 1010 20 Y 1 A GLN 33 ? A GLN 33 1011 20 Y 1 A CYS 34 ? A CYS 34 1012 20 Y 1 A VAL 35 ? A VAL 35 1013 20 Y 1 A MET 36 ? A MET 36 1014 20 Y 1 A CYS 37 ? A CYS 37 1015 20 Y 1 A GLY 38 ? A GLY 38 1016 20 Y 1 A LYS 39 ? A LYS 39 1017 20 Y 1 A ALA 40 ? A ALA 40 1018 20 Y 1 A PHE 41 ? A PHE 41 1019 20 Y 1 A THR 42 ? A THR 42 1020 20 Y 1 A GLN 43 ? A GLN 43 1021 20 Y 1 A ALA 44 ? A ALA 44 1022 20 Y 1 A SER 45 ? A SER 45 1023 20 Y 1 A SER 46 ? A SER 46 1024 20 Y 1 A LEU 47 ? A LEU 47 1025 20 Y 1 A ILE 48 ? A ILE 48 1026 20 Y 1 A ALA 49 ? A ALA 49 1027 20 Y 1 A HIS 50 ? A HIS 50 1028 20 Y 1 A VAL 51 ? A VAL 51 1029 20 Y 1 A ARG 52 ? A ARG 52 1030 20 Y 1 A GLN 53 ? A GLN 53 1031 20 Y 1 A HIS 54 ? A HIS 54 1032 20 Y 1 A THR 55 ? A THR 55 1033 20 Y 1 A GLY 56 ? A GLY 56 1034 20 Y 1 A GLU 57 ? A GLU 57 1035 20 Y 1 A LYS 58 ? A LYS 58 1036 20 Y 1 A PRO 59 ? A PRO 59 1037 20 Y 1 A TYR 60 ? A TYR 60 1038 20 Y 1 A VAL 61 ? A VAL 61 1039 20 Y 1 A CYS 62 ? A CYS 62 1040 20 Y 1 A GLU 63 ? A GLU 63 1041 20 Y 1 A ARG 64 ? A ARG 64 1042 20 Y 1 A CYS 65 ? A CYS 65 1043 20 Y 1 A GLY 66 ? A GLY 66 1044 20 Y 1 A LYS 67 ? A LYS 67 1045 20 Y 1 A ARG 68 ? A ARG 68 1046 20 Y 1 A PHE 69 ? A PHE 69 1047 20 Y 1 A VAL 70 ? A VAL 70 1048 20 Y 1 A GLN 71 ? A GLN 71 1049 20 Y 1 A SER 72 ? A SER 72 1050 20 Y 1 A SER 73 ? A SER 73 1051 20 Y 1 A GLN 74 ? A GLN 74 1052 20 Y 1 A LEU 75 ? A LEU 75 1053 20 Y 1 A ALA 76 ? A ALA 76 1054 20 Y 1 A ASN 77 ? A ASN 77 1055 20 Y 1 A HIS 78 ? A HIS 78 1056 20 Y 1 A ILE 79 ? A ILE 79 1057 20 Y 1 A ARG 80 ? A ARG 80 1058 20 Y 1 A HIS 81 ? A HIS 81 1059 20 Y 1 A HIS 82 ? A HIS 82 1060 20 Y 1 A ASP 83 ? A ASP 83 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #