data_2LVT # _entry.id 2LVT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LVT pdb_00002lvt 10.2210/pdb2lvt/pdb RCSB RCSB102894 ? ? BMRB 18586 ? ? WWPDB D_1000102894 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 18586 BMRB unspecified . 2LVR PDB unspecified . 2LVU PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LVT _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-07-11 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bedard, M.' 1 'Maltais, L.' 2 'Beaulieu, M.' 3 'Bernard, D.' 4 'Lavigne, P.' 5 # _citation.id primary _citation.title 'NMR structure note: solution structure of human Miz-1 zinc fingers 8 to 10.' _citation.journal_abbrev J.Biomol.Nmr _citation.journal_volume 54 _citation.page_first 317 _citation.page_last 323 _citation.year 2012 _citation.journal_id_ASTM JBNME9 _citation.country NE _citation.journal_id_ISSN 0925-2738 _citation.journal_id_CSD 0800 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22986688 _citation.pdbx_database_id_DOI 10.1007/s10858-012-9670-1 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bedard, M.' 1 ? primary 'Maltais, L.' 2 ? primary 'Beaulieu, M.E.' 3 ? primary 'Bilodeau, J.' 4 ? primary 'Bernard, D.' 5 ? primary 'Lavigne, P.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger and BTB domain-containing protein 17' 9517.052 1 ? ? 'C2H2-TYPE 8-10, ZINC FINGER RESIDUES 500-581' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Myc-interacting zinc finger protein 1, Miz-1, Zinc finger protein 151, Zinc finger protein 60' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIR HHD ; _entity_poly.pdbx_seq_one_letter_code_can ;MKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIR HHD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 PRO n 1 4 TYR n 1 5 VAL n 1 6 CYS n 1 7 ILE n 1 8 HIS n 1 9 CYS n 1 10 GLN n 1 11 ARG n 1 12 GLN n 1 13 PHE n 1 14 ALA n 1 15 ASP n 1 16 PRO n 1 17 GLY n 1 18 ALA n 1 19 LEU n 1 20 GLN n 1 21 ARG n 1 22 HIS n 1 23 VAL n 1 24 ARG n 1 25 ILE n 1 26 HIS n 1 27 THR n 1 28 GLY n 1 29 GLU n 1 30 LYS n 1 31 PRO n 1 32 CYS n 1 33 GLN n 1 34 CYS n 1 35 VAL n 1 36 MET n 1 37 CYS n 1 38 GLY n 1 39 LYS n 1 40 ALA n 1 41 PHE n 1 42 THR n 1 43 GLN n 1 44 ALA n 1 45 SER n 1 46 SER n 1 47 LEU n 1 48 ILE n 1 49 ALA n 1 50 HIS n 1 51 VAL n 1 52 ARG n 1 53 GLN n 1 54 HIS n 1 55 THR n 1 56 GLY n 1 57 GLU n 1 58 LYS n 1 59 PRO n 1 60 TYR n 1 61 VAL n 1 62 CYS n 1 63 GLU n 1 64 ARG n 1 65 CYS n 1 66 GLY n 1 67 LYS n 1 68 ARG n 1 69 PHE n 1 70 VAL n 1 71 GLN n 1 72 SER n 1 73 SER n 1 74 GLN n 1 75 LEU n 1 76 ALA n 1 77 ASN n 1 78 HIS n 1 79 ILE n 1 80 ARG n 1 81 HIS n 1 82 HIS n 1 83 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MIZ1, ZBTB17, ZNF151, ZNF60' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 star (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET-3a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZBT17_HUMAN _struct_ref.pdbx_db_accession Q13105 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRH HD ; _struct_ref.pdbx_align_begin 500 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LVT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 83 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13105 _struct_ref_seq.db_align_beg 500 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 581 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 83 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2LVT _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q13105 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCACB' 1 5 1 '3D HNCO' 1 6 1 '3D C(CO)NH' 1 7 1 '3D H(CCO)NH' 1 8 1 '3D HCCH-TOCSY' 1 9 1 '3D 1H-15N NOESY' 1 10 1 '3D 1H-13C NOESY aliphatic' 1 11 1 '3D 1H-13C NOESY aromatic' 1 12 1 '3D HNHA' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.05 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.75 - 1.00 mM [U-13C; U-15N] Miz8, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2LVT _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 300 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LVT _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LVT _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Nilges, Rieping, Habeck, Bardiaux, Bernard and Malliavin' 'structure calculation' ARIA 2.2 1 'Nilges, Rieping, Habeck, Bardiaux, Bernard and Malliavin' refinement ARIA 2.2 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure calculation' CNS 1.21 3 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.21 4 CCPN 'chemical shift assigment' 'CcpNmr Analysis' 2.1 5 CCPN 'data analysis' 'CcpNmr Analysis' 2.1 6 CCPN 'data analysis' DANGLE 1.1 7 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 7.4 8 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LVT _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LVT _struct.title 'Solution structure of Miz-1 zinc finger 9' _struct.pdbx_model_details 'lowest energy, model20' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LVT _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'C2H2 zinc finger, TRANSCRIPTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 43 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 56 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 43 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 56 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 34 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 34 A ZN 101 1_555 ? ? ? ? ? ? ? 2.315 ? ? metalc2 metalc ? ? A CYS 37 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 37 A ZN 101 1_555 ? ? ? ? ? ? ? 2.314 ? ? metalc3 metalc ? ? A HIS 50 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 50 A ZN 101 1_555 ? ? ? ? ? ? ? 2.147 ? ? metalc4 metalc ? ? A HIS 54 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 54 A ZN 101 1_555 ? ? ? ? ? ? ? 2.011 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 32 ? GLN A 33 ? CYS A 32 GLN A 33 A 2 ALA A 40 ? PHE A 41 ? ALA A 40 PHE A 41 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id CYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 32 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id CYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 32 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 41 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 41 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 101 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 34 ? CYS A 34 . ? 1_555 ? 2 AC1 4 CYS A 37 ? CYS A 37 . ? 1_555 ? 3 AC1 4 HIS A 50 ? HIS A 50 . ? 1_555 ? 4 AC1 4 HIS A 54 ? HIS A 54 . ? 1_555 ? # _atom_sites.entry_id 2LVT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 LYS 2 2 ? ? ? A . n A 1 3 PRO 3 3 ? ? ? A . n A 1 4 TYR 4 4 ? ? ? A . n A 1 5 VAL 5 5 ? ? ? A . n A 1 6 CYS 6 6 ? ? ? A . n A 1 7 ILE 7 7 ? ? ? A . n A 1 8 HIS 8 8 ? ? ? A . n A 1 9 CYS 9 9 ? ? ? A . n A 1 10 GLN 10 10 ? ? ? A . n A 1 11 ARG 11 11 ? ? ? A . n A 1 12 GLN 12 12 ? ? ? A . n A 1 13 PHE 13 13 ? ? ? A . n A 1 14 ALA 14 14 ? ? ? A . n A 1 15 ASP 15 15 ? ? ? A . n A 1 16 PRO 16 16 ? ? ? A . n A 1 17 GLY 17 17 ? ? ? A . n A 1 18 ALA 18 18 ? ? ? A . n A 1 19 LEU 19 19 ? ? ? A . n A 1 20 GLN 20 20 ? ? ? A . n A 1 21 ARG 21 21 ? ? ? A . n A 1 22 HIS 22 22 ? ? ? A . n A 1 23 VAL 23 23 ? ? ? A . n A 1 24 ARG 24 24 ? ? ? A . n A 1 25 ILE 25 25 ? ? ? A . n A 1 26 HIS 26 26 ? ? ? A . n A 1 27 THR 27 27 ? ? ? A . n A 1 28 GLY 28 28 ? ? ? A . n A 1 29 GLU 29 29 ? ? ? A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 PRO 59 59 ? ? ? A . n A 1 60 TYR 60 60 ? ? ? A . n A 1 61 VAL 61 61 ? ? ? A . n A 1 62 CYS 62 62 ? ? ? A . n A 1 63 GLU 63 63 ? ? ? A . n A 1 64 ARG 64 64 ? ? ? A . n A 1 65 CYS 65 65 ? ? ? A . n A 1 66 GLY 66 66 ? ? ? A . n A 1 67 LYS 67 67 ? ? ? A . n A 1 68 ARG 68 68 ? ? ? A . n A 1 69 PHE 69 69 ? ? ? A . n A 1 70 VAL 70 70 ? ? ? A . n A 1 71 GLN 71 71 ? ? ? A . n A 1 72 SER 72 72 ? ? ? A . n A 1 73 SER 73 73 ? ? ? A . n A 1 74 GLN 74 74 ? ? ? A . n A 1 75 LEU 75 75 ? ? ? A . n A 1 76 ALA 76 76 ? ? ? A . n A 1 77 ASN 77 77 ? ? ? A . n A 1 78 HIS 78 78 ? ? ? A . n A 1 79 ILE 79 79 ? ? ? A . n A 1 80 ARG 80 80 ? ? ? A . n A 1 81 HIS 81 81 ? ? ? A . n A 1 82 HIS 82 82 ? ? ? A . n A 1 83 ASP 83 83 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 101 _pdbx_nonpoly_scheme.auth_seq_num 59 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 37 ? A CYS 37 ? 1_555 104.3 ? 2 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 50 ? A HIS 50 ? 1_555 96.2 ? 3 SG ? A CYS 37 ? A CYS 37 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 50 ? A HIS 50 ? 1_555 99.9 ? 4 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 54 ? A HIS 54 ? 1_555 105.9 ? 5 SG ? A CYS 37 ? A CYS 37 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 54 ? A HIS 54 ? 1_555 112.1 ? 6 NE2 ? A HIS 50 ? A HIS 50 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 54 ? A HIS 54 ? 1_555 134.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-07-25 2 'Structure model' 1 1 2012-10-03 3 'Structure model' 1 2 2012-11-14 4 'Structure model' 1 3 2016-04-27 5 'Structure model' 1 4 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Structure summary' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' 7 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' database_2 2 5 'Structure model' pdbx_database_status 3 5 'Structure model' pdbx_nmr_software 4 5 'Structure model' pdbx_struct_conn_angle 5 5 'Structure model' struct_conn 6 5 'Structure model' struct_ref_seq_dif 7 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 5 'Structure model' '_pdbx_nmr_software.name' 5 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 5 'Structure model' '_pdbx_struct_conn_angle.value' 16 5 'Structure model' '_struct_conn.pdbx_dist_value' 17 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 5 'Structure model' '_struct_ref_seq_dif.details' 23 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 24 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 25 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_nmr_exptl_sample.component Miz8-10-1 _pdbx_nmr_exptl_sample.concentration ? _pdbx_nmr_exptl_sample.concentration_range 0.75-1.00 _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-13C; U-15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LVT _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 458 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 246 _pdbx_nmr_constraints.NOE_long_range_total_count 36 _pdbx_nmr_constraints.NOE_medium_range_total_count 54 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 122 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 3 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 LEU _pdbx_validate_close_contact.auth_seq_id_1 47 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 VAL _pdbx_validate_close_contact.auth_seq_id_2 51 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 34 ? ? -61.55 97.36 2 2 CYS A 34 ? ? -59.63 97.21 3 3 CYS A 34 ? ? -63.53 93.00 4 4 CYS A 34 ? ? -64.70 89.34 5 5 CYS A 34 ? ? -57.36 104.54 6 6 CYS A 34 ? ? -64.36 93.74 7 7 CYS A 34 ? ? -65.47 92.76 8 8 CYS A 34 ? ? -57.33 106.61 9 9 CYS A 34 ? ? -67.35 93.54 10 10 CYS A 34 ? ? -67.06 93.69 11 11 CYS A 34 ? ? -63.26 92.25 12 12 CYS A 34 ? ? -61.62 94.93 13 13 CYS A 34 ? ? -63.44 94.71 14 15 CYS A 34 ? ? -69.86 90.10 15 18 CYS A 34 ? ? -59.07 107.55 16 19 CYS A 34 ? ? -69.42 95.82 17 20 CYS A 34 ? ? -55.59 106.84 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A LYS 2 ? A LYS 2 3 1 Y 1 A PRO 3 ? A PRO 3 4 1 Y 1 A TYR 4 ? A TYR 4 5 1 Y 1 A VAL 5 ? A VAL 5 6 1 Y 1 A CYS 6 ? A CYS 6 7 1 Y 1 A ILE 7 ? A ILE 7 8 1 Y 1 A HIS 8 ? A HIS 8 9 1 Y 1 A CYS 9 ? A CYS 9 10 1 Y 1 A GLN 10 ? A GLN 10 11 1 Y 1 A ARG 11 ? A ARG 11 12 1 Y 1 A GLN 12 ? A GLN 12 13 1 Y 1 A PHE 13 ? A PHE 13 14 1 Y 1 A ALA 14 ? A ALA 14 15 1 Y 1 A ASP 15 ? A ASP 15 16 1 Y 1 A PRO 16 ? A PRO 16 17 1 Y 1 A GLY 17 ? A GLY 17 18 1 Y 1 A ALA 18 ? A ALA 18 19 1 Y 1 A LEU 19 ? A LEU 19 20 1 Y 1 A GLN 20 ? A GLN 20 21 1 Y 1 A ARG 21 ? A ARG 21 22 1 Y 1 A HIS 22 ? A HIS 22 23 1 Y 1 A VAL 23 ? A VAL 23 24 1 Y 1 A ARG 24 ? A ARG 24 25 1 Y 1 A ILE 25 ? A ILE 25 26 1 Y 1 A HIS 26 ? A HIS 26 27 1 Y 1 A THR 27 ? A THR 27 28 1 Y 1 A GLY 28 ? A GLY 28 29 1 Y 1 A GLU 29 ? A GLU 29 30 1 Y 1 A PRO 59 ? A PRO 59 31 1 Y 1 A TYR 60 ? A TYR 60 32 1 Y 1 A VAL 61 ? A VAL 61 33 1 Y 1 A CYS 62 ? A CYS 62 34 1 Y 1 A GLU 63 ? A GLU 63 35 1 Y 1 A ARG 64 ? A ARG 64 36 1 Y 1 A CYS 65 ? A CYS 65 37 1 Y 1 A GLY 66 ? A GLY 66 38 1 Y 1 A LYS 67 ? A LYS 67 39 1 Y 1 A ARG 68 ? A ARG 68 40 1 Y 1 A PHE 69 ? A PHE 69 41 1 Y 1 A VAL 70 ? A VAL 70 42 1 Y 1 A GLN 71 ? A GLN 71 43 1 Y 1 A SER 72 ? A SER 72 44 1 Y 1 A SER 73 ? A SER 73 45 1 Y 1 A GLN 74 ? A GLN 74 46 1 Y 1 A LEU 75 ? A LEU 75 47 1 Y 1 A ALA 76 ? A ALA 76 48 1 Y 1 A ASN 77 ? A ASN 77 49 1 Y 1 A HIS 78 ? A HIS 78 50 1 Y 1 A ILE 79 ? A ILE 79 51 1 Y 1 A ARG 80 ? A ARG 80 52 1 Y 1 A HIS 81 ? A HIS 81 53 1 Y 1 A HIS 82 ? A HIS 82 54 1 Y 1 A ASP 83 ? A ASP 83 55 2 Y 1 A MET 1 ? A MET 1 56 2 Y 1 A LYS 2 ? A LYS 2 57 2 Y 1 A PRO 3 ? A PRO 3 58 2 Y 1 A TYR 4 ? A TYR 4 59 2 Y 1 A VAL 5 ? A VAL 5 60 2 Y 1 A CYS 6 ? A CYS 6 61 2 Y 1 A ILE 7 ? A ILE 7 62 2 Y 1 A HIS 8 ? A HIS 8 63 2 Y 1 A CYS 9 ? A CYS 9 64 2 Y 1 A GLN 10 ? A GLN 10 65 2 Y 1 A ARG 11 ? A ARG 11 66 2 Y 1 A GLN 12 ? A GLN 12 67 2 Y 1 A PHE 13 ? A PHE 13 68 2 Y 1 A ALA 14 ? A ALA 14 69 2 Y 1 A ASP 15 ? A ASP 15 70 2 Y 1 A PRO 16 ? A PRO 16 71 2 Y 1 A GLY 17 ? A GLY 17 72 2 Y 1 A ALA 18 ? A ALA 18 73 2 Y 1 A LEU 19 ? A LEU 19 74 2 Y 1 A GLN 20 ? A GLN 20 75 2 Y 1 A ARG 21 ? A ARG 21 76 2 Y 1 A HIS 22 ? A HIS 22 77 2 Y 1 A VAL 23 ? A VAL 23 78 2 Y 1 A ARG 24 ? A ARG 24 79 2 Y 1 A ILE 25 ? A ILE 25 80 2 Y 1 A HIS 26 ? A HIS 26 81 2 Y 1 A THR 27 ? A THR 27 82 2 Y 1 A GLY 28 ? A GLY 28 83 2 Y 1 A GLU 29 ? A GLU 29 84 2 Y 1 A PRO 59 ? A PRO 59 85 2 Y 1 A TYR 60 ? A TYR 60 86 2 Y 1 A VAL 61 ? A VAL 61 87 2 Y 1 A CYS 62 ? A CYS 62 88 2 Y 1 A GLU 63 ? A GLU 63 89 2 Y 1 A ARG 64 ? A ARG 64 90 2 Y 1 A CYS 65 ? A CYS 65 91 2 Y 1 A GLY 66 ? A GLY 66 92 2 Y 1 A LYS 67 ? A LYS 67 93 2 Y 1 A ARG 68 ? A ARG 68 94 2 Y 1 A PHE 69 ? A PHE 69 95 2 Y 1 A VAL 70 ? A VAL 70 96 2 Y 1 A GLN 71 ? A GLN 71 97 2 Y 1 A SER 72 ? A SER 72 98 2 Y 1 A SER 73 ? A SER 73 99 2 Y 1 A GLN 74 ? A GLN 74 100 2 Y 1 A LEU 75 ? A LEU 75 101 2 Y 1 A ALA 76 ? A ALA 76 102 2 Y 1 A ASN 77 ? A ASN 77 103 2 Y 1 A HIS 78 ? A HIS 78 104 2 Y 1 A ILE 79 ? A ILE 79 105 2 Y 1 A ARG 80 ? A ARG 80 106 2 Y 1 A HIS 81 ? A HIS 81 107 2 Y 1 A HIS 82 ? A HIS 82 108 2 Y 1 A ASP 83 ? A ASP 83 109 3 Y 1 A MET 1 ? A MET 1 110 3 Y 1 A LYS 2 ? A LYS 2 111 3 Y 1 A PRO 3 ? A PRO 3 112 3 Y 1 A TYR 4 ? A TYR 4 113 3 Y 1 A VAL 5 ? A VAL 5 114 3 Y 1 A CYS 6 ? A CYS 6 115 3 Y 1 A ILE 7 ? A ILE 7 116 3 Y 1 A HIS 8 ? A HIS 8 117 3 Y 1 A CYS 9 ? A CYS 9 118 3 Y 1 A GLN 10 ? A GLN 10 119 3 Y 1 A ARG 11 ? A ARG 11 120 3 Y 1 A GLN 12 ? A GLN 12 121 3 Y 1 A PHE 13 ? A PHE 13 122 3 Y 1 A ALA 14 ? A ALA 14 123 3 Y 1 A ASP 15 ? A ASP 15 124 3 Y 1 A PRO 16 ? A PRO 16 125 3 Y 1 A GLY 17 ? A GLY 17 126 3 Y 1 A ALA 18 ? A ALA 18 127 3 Y 1 A LEU 19 ? A LEU 19 128 3 Y 1 A GLN 20 ? A GLN 20 129 3 Y 1 A ARG 21 ? A ARG 21 130 3 Y 1 A HIS 22 ? A HIS 22 131 3 Y 1 A VAL 23 ? A VAL 23 132 3 Y 1 A ARG 24 ? A ARG 24 133 3 Y 1 A ILE 25 ? A ILE 25 134 3 Y 1 A HIS 26 ? A HIS 26 135 3 Y 1 A THR 27 ? A THR 27 136 3 Y 1 A GLY 28 ? A GLY 28 137 3 Y 1 A GLU 29 ? A GLU 29 138 3 Y 1 A PRO 59 ? A PRO 59 139 3 Y 1 A TYR 60 ? A TYR 60 140 3 Y 1 A VAL 61 ? A VAL 61 141 3 Y 1 A CYS 62 ? A CYS 62 142 3 Y 1 A GLU 63 ? A GLU 63 143 3 Y 1 A ARG 64 ? A ARG 64 144 3 Y 1 A CYS 65 ? A CYS 65 145 3 Y 1 A GLY 66 ? A GLY 66 146 3 Y 1 A LYS 67 ? A LYS 67 147 3 Y 1 A ARG 68 ? A ARG 68 148 3 Y 1 A PHE 69 ? A PHE 69 149 3 Y 1 A VAL 70 ? A VAL 70 150 3 Y 1 A GLN 71 ? A GLN 71 151 3 Y 1 A SER 72 ? A SER 72 152 3 Y 1 A SER 73 ? A SER 73 153 3 Y 1 A GLN 74 ? A GLN 74 154 3 Y 1 A LEU 75 ? A LEU 75 155 3 Y 1 A ALA 76 ? A ALA 76 156 3 Y 1 A ASN 77 ? A ASN 77 157 3 Y 1 A HIS 78 ? A HIS 78 158 3 Y 1 A ILE 79 ? A ILE 79 159 3 Y 1 A ARG 80 ? A ARG 80 160 3 Y 1 A HIS 81 ? A HIS 81 161 3 Y 1 A HIS 82 ? A HIS 82 162 3 Y 1 A ASP 83 ? A ASP 83 163 4 Y 1 A MET 1 ? A MET 1 164 4 Y 1 A LYS 2 ? A LYS 2 165 4 Y 1 A PRO 3 ? A PRO 3 166 4 Y 1 A TYR 4 ? A TYR 4 167 4 Y 1 A VAL 5 ? A VAL 5 168 4 Y 1 A CYS 6 ? A CYS 6 169 4 Y 1 A ILE 7 ? A ILE 7 170 4 Y 1 A HIS 8 ? A HIS 8 171 4 Y 1 A CYS 9 ? A CYS 9 172 4 Y 1 A GLN 10 ? A GLN 10 173 4 Y 1 A ARG 11 ? A ARG 11 174 4 Y 1 A GLN 12 ? A GLN 12 175 4 Y 1 A PHE 13 ? A PHE 13 176 4 Y 1 A ALA 14 ? A ALA 14 177 4 Y 1 A ASP 15 ? A ASP 15 178 4 Y 1 A PRO 16 ? A PRO 16 179 4 Y 1 A GLY 17 ? A GLY 17 180 4 Y 1 A ALA 18 ? A ALA 18 181 4 Y 1 A LEU 19 ? A LEU 19 182 4 Y 1 A GLN 20 ? A GLN 20 183 4 Y 1 A ARG 21 ? A ARG 21 184 4 Y 1 A HIS 22 ? A HIS 22 185 4 Y 1 A VAL 23 ? A VAL 23 186 4 Y 1 A ARG 24 ? A ARG 24 187 4 Y 1 A ILE 25 ? A ILE 25 188 4 Y 1 A HIS 26 ? A HIS 26 189 4 Y 1 A THR 27 ? A THR 27 190 4 Y 1 A GLY 28 ? A GLY 28 191 4 Y 1 A GLU 29 ? A GLU 29 192 4 Y 1 A PRO 59 ? A PRO 59 193 4 Y 1 A TYR 60 ? A TYR 60 194 4 Y 1 A VAL 61 ? A VAL 61 195 4 Y 1 A CYS 62 ? A CYS 62 196 4 Y 1 A GLU 63 ? A GLU 63 197 4 Y 1 A ARG 64 ? A ARG 64 198 4 Y 1 A CYS 65 ? A CYS 65 199 4 Y 1 A GLY 66 ? A GLY 66 200 4 Y 1 A LYS 67 ? A LYS 67 201 4 Y 1 A ARG 68 ? A ARG 68 202 4 Y 1 A PHE 69 ? A PHE 69 203 4 Y 1 A VAL 70 ? A VAL 70 204 4 Y 1 A GLN 71 ? A GLN 71 205 4 Y 1 A SER 72 ? A SER 72 206 4 Y 1 A SER 73 ? A SER 73 207 4 Y 1 A GLN 74 ? A GLN 74 208 4 Y 1 A LEU 75 ? A LEU 75 209 4 Y 1 A ALA 76 ? A ALA 76 210 4 Y 1 A ASN 77 ? A ASN 77 211 4 Y 1 A HIS 78 ? A HIS 78 212 4 Y 1 A ILE 79 ? A ILE 79 213 4 Y 1 A ARG 80 ? A ARG 80 214 4 Y 1 A HIS 81 ? A HIS 81 215 4 Y 1 A HIS 82 ? A HIS 82 216 4 Y 1 A ASP 83 ? A ASP 83 217 5 Y 1 A MET 1 ? A MET 1 218 5 Y 1 A LYS 2 ? A LYS 2 219 5 Y 1 A PRO 3 ? A PRO 3 220 5 Y 1 A TYR 4 ? A TYR 4 221 5 Y 1 A VAL 5 ? A VAL 5 222 5 Y 1 A CYS 6 ? A CYS 6 223 5 Y 1 A ILE 7 ? A ILE 7 224 5 Y 1 A HIS 8 ? A HIS 8 225 5 Y 1 A CYS 9 ? A CYS 9 226 5 Y 1 A GLN 10 ? A GLN 10 227 5 Y 1 A ARG 11 ? A ARG 11 228 5 Y 1 A GLN 12 ? A GLN 12 229 5 Y 1 A PHE 13 ? A PHE 13 230 5 Y 1 A ALA 14 ? A ALA 14 231 5 Y 1 A ASP 15 ? A ASP 15 232 5 Y 1 A PRO 16 ? A PRO 16 233 5 Y 1 A GLY 17 ? A GLY 17 234 5 Y 1 A ALA 18 ? A ALA 18 235 5 Y 1 A LEU 19 ? A LEU 19 236 5 Y 1 A GLN 20 ? A GLN 20 237 5 Y 1 A ARG 21 ? A ARG 21 238 5 Y 1 A HIS 22 ? A HIS 22 239 5 Y 1 A VAL 23 ? A VAL 23 240 5 Y 1 A ARG 24 ? A ARG 24 241 5 Y 1 A ILE 25 ? A ILE 25 242 5 Y 1 A HIS 26 ? A HIS 26 243 5 Y 1 A THR 27 ? A THR 27 244 5 Y 1 A GLY 28 ? A GLY 28 245 5 Y 1 A GLU 29 ? A GLU 29 246 5 Y 1 A PRO 59 ? A PRO 59 247 5 Y 1 A TYR 60 ? A TYR 60 248 5 Y 1 A VAL 61 ? A VAL 61 249 5 Y 1 A CYS 62 ? A CYS 62 250 5 Y 1 A GLU 63 ? A GLU 63 251 5 Y 1 A ARG 64 ? A ARG 64 252 5 Y 1 A CYS 65 ? A CYS 65 253 5 Y 1 A GLY 66 ? A GLY 66 254 5 Y 1 A LYS 67 ? A LYS 67 255 5 Y 1 A ARG 68 ? A ARG 68 256 5 Y 1 A PHE 69 ? A PHE 69 257 5 Y 1 A VAL 70 ? A VAL 70 258 5 Y 1 A GLN 71 ? A GLN 71 259 5 Y 1 A SER 72 ? A SER 72 260 5 Y 1 A SER 73 ? A SER 73 261 5 Y 1 A GLN 74 ? A GLN 74 262 5 Y 1 A LEU 75 ? A LEU 75 263 5 Y 1 A ALA 76 ? A ALA 76 264 5 Y 1 A ASN 77 ? A ASN 77 265 5 Y 1 A HIS 78 ? A HIS 78 266 5 Y 1 A ILE 79 ? A ILE 79 267 5 Y 1 A ARG 80 ? A ARG 80 268 5 Y 1 A HIS 81 ? A HIS 81 269 5 Y 1 A HIS 82 ? A HIS 82 270 5 Y 1 A ASP 83 ? A ASP 83 271 6 Y 1 A MET 1 ? A MET 1 272 6 Y 1 A LYS 2 ? A LYS 2 273 6 Y 1 A PRO 3 ? A PRO 3 274 6 Y 1 A TYR 4 ? A TYR 4 275 6 Y 1 A VAL 5 ? A VAL 5 276 6 Y 1 A CYS 6 ? A CYS 6 277 6 Y 1 A ILE 7 ? A ILE 7 278 6 Y 1 A HIS 8 ? A HIS 8 279 6 Y 1 A CYS 9 ? A CYS 9 280 6 Y 1 A GLN 10 ? A GLN 10 281 6 Y 1 A ARG 11 ? A ARG 11 282 6 Y 1 A GLN 12 ? A GLN 12 283 6 Y 1 A PHE 13 ? A PHE 13 284 6 Y 1 A ALA 14 ? A ALA 14 285 6 Y 1 A ASP 15 ? A ASP 15 286 6 Y 1 A PRO 16 ? A PRO 16 287 6 Y 1 A GLY 17 ? A GLY 17 288 6 Y 1 A ALA 18 ? A ALA 18 289 6 Y 1 A LEU 19 ? A LEU 19 290 6 Y 1 A GLN 20 ? A GLN 20 291 6 Y 1 A ARG 21 ? A ARG 21 292 6 Y 1 A HIS 22 ? A HIS 22 293 6 Y 1 A VAL 23 ? A VAL 23 294 6 Y 1 A ARG 24 ? A ARG 24 295 6 Y 1 A ILE 25 ? A ILE 25 296 6 Y 1 A HIS 26 ? A HIS 26 297 6 Y 1 A THR 27 ? A THR 27 298 6 Y 1 A GLY 28 ? A GLY 28 299 6 Y 1 A GLU 29 ? A GLU 29 300 6 Y 1 A PRO 59 ? A PRO 59 301 6 Y 1 A TYR 60 ? A TYR 60 302 6 Y 1 A VAL 61 ? A VAL 61 303 6 Y 1 A CYS 62 ? A CYS 62 304 6 Y 1 A GLU 63 ? A GLU 63 305 6 Y 1 A ARG 64 ? A ARG 64 306 6 Y 1 A CYS 65 ? A CYS 65 307 6 Y 1 A GLY 66 ? A GLY 66 308 6 Y 1 A LYS 67 ? A LYS 67 309 6 Y 1 A ARG 68 ? A ARG 68 310 6 Y 1 A PHE 69 ? A PHE 69 311 6 Y 1 A VAL 70 ? A VAL 70 312 6 Y 1 A GLN 71 ? A GLN 71 313 6 Y 1 A SER 72 ? A SER 72 314 6 Y 1 A SER 73 ? A SER 73 315 6 Y 1 A GLN 74 ? A GLN 74 316 6 Y 1 A LEU 75 ? A LEU 75 317 6 Y 1 A ALA 76 ? A ALA 76 318 6 Y 1 A ASN 77 ? A ASN 77 319 6 Y 1 A HIS 78 ? A HIS 78 320 6 Y 1 A ILE 79 ? A ILE 79 321 6 Y 1 A ARG 80 ? A ARG 80 322 6 Y 1 A HIS 81 ? A HIS 81 323 6 Y 1 A HIS 82 ? A HIS 82 324 6 Y 1 A ASP 83 ? A ASP 83 325 7 Y 1 A MET 1 ? A MET 1 326 7 Y 1 A LYS 2 ? A LYS 2 327 7 Y 1 A PRO 3 ? A PRO 3 328 7 Y 1 A TYR 4 ? A TYR 4 329 7 Y 1 A VAL 5 ? A VAL 5 330 7 Y 1 A CYS 6 ? A CYS 6 331 7 Y 1 A ILE 7 ? A ILE 7 332 7 Y 1 A HIS 8 ? A HIS 8 333 7 Y 1 A CYS 9 ? A CYS 9 334 7 Y 1 A GLN 10 ? A GLN 10 335 7 Y 1 A ARG 11 ? A ARG 11 336 7 Y 1 A GLN 12 ? A GLN 12 337 7 Y 1 A PHE 13 ? A PHE 13 338 7 Y 1 A ALA 14 ? A ALA 14 339 7 Y 1 A ASP 15 ? A ASP 15 340 7 Y 1 A PRO 16 ? A PRO 16 341 7 Y 1 A GLY 17 ? A GLY 17 342 7 Y 1 A ALA 18 ? A ALA 18 343 7 Y 1 A LEU 19 ? A LEU 19 344 7 Y 1 A GLN 20 ? A GLN 20 345 7 Y 1 A ARG 21 ? A ARG 21 346 7 Y 1 A HIS 22 ? A HIS 22 347 7 Y 1 A VAL 23 ? A VAL 23 348 7 Y 1 A ARG 24 ? A ARG 24 349 7 Y 1 A ILE 25 ? A ILE 25 350 7 Y 1 A HIS 26 ? A HIS 26 351 7 Y 1 A THR 27 ? A THR 27 352 7 Y 1 A GLY 28 ? A GLY 28 353 7 Y 1 A GLU 29 ? A GLU 29 354 7 Y 1 A PRO 59 ? A PRO 59 355 7 Y 1 A TYR 60 ? A TYR 60 356 7 Y 1 A VAL 61 ? A VAL 61 357 7 Y 1 A CYS 62 ? A CYS 62 358 7 Y 1 A GLU 63 ? A GLU 63 359 7 Y 1 A ARG 64 ? A ARG 64 360 7 Y 1 A CYS 65 ? A CYS 65 361 7 Y 1 A GLY 66 ? A GLY 66 362 7 Y 1 A LYS 67 ? A LYS 67 363 7 Y 1 A ARG 68 ? A ARG 68 364 7 Y 1 A PHE 69 ? A PHE 69 365 7 Y 1 A VAL 70 ? A VAL 70 366 7 Y 1 A GLN 71 ? A GLN 71 367 7 Y 1 A SER 72 ? A SER 72 368 7 Y 1 A SER 73 ? A SER 73 369 7 Y 1 A GLN 74 ? A GLN 74 370 7 Y 1 A LEU 75 ? A LEU 75 371 7 Y 1 A ALA 76 ? A ALA 76 372 7 Y 1 A ASN 77 ? A ASN 77 373 7 Y 1 A HIS 78 ? A HIS 78 374 7 Y 1 A ILE 79 ? A ILE 79 375 7 Y 1 A ARG 80 ? A ARG 80 376 7 Y 1 A HIS 81 ? A HIS 81 377 7 Y 1 A HIS 82 ? A HIS 82 378 7 Y 1 A ASP 83 ? A ASP 83 379 8 Y 1 A MET 1 ? A MET 1 380 8 Y 1 A LYS 2 ? A LYS 2 381 8 Y 1 A PRO 3 ? A PRO 3 382 8 Y 1 A TYR 4 ? A TYR 4 383 8 Y 1 A VAL 5 ? A VAL 5 384 8 Y 1 A CYS 6 ? A CYS 6 385 8 Y 1 A ILE 7 ? A ILE 7 386 8 Y 1 A HIS 8 ? A HIS 8 387 8 Y 1 A CYS 9 ? A CYS 9 388 8 Y 1 A GLN 10 ? A GLN 10 389 8 Y 1 A ARG 11 ? A ARG 11 390 8 Y 1 A GLN 12 ? A GLN 12 391 8 Y 1 A PHE 13 ? A PHE 13 392 8 Y 1 A ALA 14 ? A ALA 14 393 8 Y 1 A ASP 15 ? A ASP 15 394 8 Y 1 A PRO 16 ? A PRO 16 395 8 Y 1 A GLY 17 ? A GLY 17 396 8 Y 1 A ALA 18 ? A ALA 18 397 8 Y 1 A LEU 19 ? A LEU 19 398 8 Y 1 A GLN 20 ? A GLN 20 399 8 Y 1 A ARG 21 ? A ARG 21 400 8 Y 1 A HIS 22 ? A HIS 22 401 8 Y 1 A VAL 23 ? A VAL 23 402 8 Y 1 A ARG 24 ? A ARG 24 403 8 Y 1 A ILE 25 ? A ILE 25 404 8 Y 1 A HIS 26 ? A HIS 26 405 8 Y 1 A THR 27 ? A THR 27 406 8 Y 1 A GLY 28 ? A GLY 28 407 8 Y 1 A GLU 29 ? A GLU 29 408 8 Y 1 A PRO 59 ? A PRO 59 409 8 Y 1 A TYR 60 ? A TYR 60 410 8 Y 1 A VAL 61 ? A VAL 61 411 8 Y 1 A CYS 62 ? A CYS 62 412 8 Y 1 A GLU 63 ? A GLU 63 413 8 Y 1 A ARG 64 ? A ARG 64 414 8 Y 1 A CYS 65 ? A CYS 65 415 8 Y 1 A GLY 66 ? A GLY 66 416 8 Y 1 A LYS 67 ? A LYS 67 417 8 Y 1 A ARG 68 ? A ARG 68 418 8 Y 1 A PHE 69 ? A PHE 69 419 8 Y 1 A VAL 70 ? A VAL 70 420 8 Y 1 A GLN 71 ? A GLN 71 421 8 Y 1 A SER 72 ? A SER 72 422 8 Y 1 A SER 73 ? A SER 73 423 8 Y 1 A GLN 74 ? A GLN 74 424 8 Y 1 A LEU 75 ? A LEU 75 425 8 Y 1 A ALA 76 ? A ALA 76 426 8 Y 1 A ASN 77 ? A ASN 77 427 8 Y 1 A HIS 78 ? A HIS 78 428 8 Y 1 A ILE 79 ? A ILE 79 429 8 Y 1 A ARG 80 ? A ARG 80 430 8 Y 1 A HIS 81 ? A HIS 81 431 8 Y 1 A HIS 82 ? A HIS 82 432 8 Y 1 A ASP 83 ? A ASP 83 433 9 Y 1 A MET 1 ? A MET 1 434 9 Y 1 A LYS 2 ? A LYS 2 435 9 Y 1 A PRO 3 ? A PRO 3 436 9 Y 1 A TYR 4 ? A TYR 4 437 9 Y 1 A VAL 5 ? A VAL 5 438 9 Y 1 A CYS 6 ? A CYS 6 439 9 Y 1 A ILE 7 ? A ILE 7 440 9 Y 1 A HIS 8 ? A HIS 8 441 9 Y 1 A CYS 9 ? A CYS 9 442 9 Y 1 A GLN 10 ? A GLN 10 443 9 Y 1 A ARG 11 ? A ARG 11 444 9 Y 1 A GLN 12 ? A GLN 12 445 9 Y 1 A PHE 13 ? A PHE 13 446 9 Y 1 A ALA 14 ? A ALA 14 447 9 Y 1 A ASP 15 ? A ASP 15 448 9 Y 1 A PRO 16 ? A PRO 16 449 9 Y 1 A GLY 17 ? A GLY 17 450 9 Y 1 A ALA 18 ? A ALA 18 451 9 Y 1 A LEU 19 ? A LEU 19 452 9 Y 1 A GLN 20 ? A GLN 20 453 9 Y 1 A ARG 21 ? A ARG 21 454 9 Y 1 A HIS 22 ? A HIS 22 455 9 Y 1 A VAL 23 ? A VAL 23 456 9 Y 1 A ARG 24 ? A ARG 24 457 9 Y 1 A ILE 25 ? A ILE 25 458 9 Y 1 A HIS 26 ? A HIS 26 459 9 Y 1 A THR 27 ? A THR 27 460 9 Y 1 A GLY 28 ? A GLY 28 461 9 Y 1 A GLU 29 ? A GLU 29 462 9 Y 1 A PRO 59 ? A PRO 59 463 9 Y 1 A TYR 60 ? A TYR 60 464 9 Y 1 A VAL 61 ? A VAL 61 465 9 Y 1 A CYS 62 ? A CYS 62 466 9 Y 1 A GLU 63 ? A GLU 63 467 9 Y 1 A ARG 64 ? A ARG 64 468 9 Y 1 A CYS 65 ? A CYS 65 469 9 Y 1 A GLY 66 ? A GLY 66 470 9 Y 1 A LYS 67 ? A LYS 67 471 9 Y 1 A ARG 68 ? A ARG 68 472 9 Y 1 A PHE 69 ? A PHE 69 473 9 Y 1 A VAL 70 ? A VAL 70 474 9 Y 1 A GLN 71 ? A GLN 71 475 9 Y 1 A SER 72 ? A SER 72 476 9 Y 1 A SER 73 ? A SER 73 477 9 Y 1 A GLN 74 ? A GLN 74 478 9 Y 1 A LEU 75 ? A LEU 75 479 9 Y 1 A ALA 76 ? A ALA 76 480 9 Y 1 A ASN 77 ? A ASN 77 481 9 Y 1 A HIS 78 ? A HIS 78 482 9 Y 1 A ILE 79 ? A ILE 79 483 9 Y 1 A ARG 80 ? A ARG 80 484 9 Y 1 A HIS 81 ? A HIS 81 485 9 Y 1 A HIS 82 ? A HIS 82 486 9 Y 1 A ASP 83 ? A ASP 83 487 10 Y 1 A MET 1 ? A MET 1 488 10 Y 1 A LYS 2 ? A LYS 2 489 10 Y 1 A PRO 3 ? A PRO 3 490 10 Y 1 A TYR 4 ? A TYR 4 491 10 Y 1 A VAL 5 ? A VAL 5 492 10 Y 1 A CYS 6 ? A CYS 6 493 10 Y 1 A ILE 7 ? A ILE 7 494 10 Y 1 A HIS 8 ? A HIS 8 495 10 Y 1 A CYS 9 ? A CYS 9 496 10 Y 1 A GLN 10 ? A GLN 10 497 10 Y 1 A ARG 11 ? A ARG 11 498 10 Y 1 A GLN 12 ? A GLN 12 499 10 Y 1 A PHE 13 ? A PHE 13 500 10 Y 1 A ALA 14 ? A ALA 14 501 10 Y 1 A ASP 15 ? A ASP 15 502 10 Y 1 A PRO 16 ? A PRO 16 503 10 Y 1 A GLY 17 ? A GLY 17 504 10 Y 1 A ALA 18 ? A ALA 18 505 10 Y 1 A LEU 19 ? A LEU 19 506 10 Y 1 A GLN 20 ? A GLN 20 507 10 Y 1 A ARG 21 ? A ARG 21 508 10 Y 1 A HIS 22 ? A HIS 22 509 10 Y 1 A VAL 23 ? A VAL 23 510 10 Y 1 A ARG 24 ? A ARG 24 511 10 Y 1 A ILE 25 ? A ILE 25 512 10 Y 1 A HIS 26 ? A HIS 26 513 10 Y 1 A THR 27 ? A THR 27 514 10 Y 1 A GLY 28 ? A GLY 28 515 10 Y 1 A GLU 29 ? A GLU 29 516 10 Y 1 A PRO 59 ? A PRO 59 517 10 Y 1 A TYR 60 ? A TYR 60 518 10 Y 1 A VAL 61 ? A VAL 61 519 10 Y 1 A CYS 62 ? A CYS 62 520 10 Y 1 A GLU 63 ? A GLU 63 521 10 Y 1 A ARG 64 ? A ARG 64 522 10 Y 1 A CYS 65 ? A CYS 65 523 10 Y 1 A GLY 66 ? A GLY 66 524 10 Y 1 A LYS 67 ? A LYS 67 525 10 Y 1 A ARG 68 ? A ARG 68 526 10 Y 1 A PHE 69 ? A PHE 69 527 10 Y 1 A VAL 70 ? A VAL 70 528 10 Y 1 A GLN 71 ? A GLN 71 529 10 Y 1 A SER 72 ? A SER 72 530 10 Y 1 A SER 73 ? A SER 73 531 10 Y 1 A GLN 74 ? A GLN 74 532 10 Y 1 A LEU 75 ? A LEU 75 533 10 Y 1 A ALA 76 ? A ALA 76 534 10 Y 1 A ASN 77 ? A ASN 77 535 10 Y 1 A HIS 78 ? A HIS 78 536 10 Y 1 A ILE 79 ? A ILE 79 537 10 Y 1 A ARG 80 ? A ARG 80 538 10 Y 1 A HIS 81 ? A HIS 81 539 10 Y 1 A HIS 82 ? A HIS 82 540 10 Y 1 A ASP 83 ? A ASP 83 541 11 Y 1 A MET 1 ? A MET 1 542 11 Y 1 A LYS 2 ? A LYS 2 543 11 Y 1 A PRO 3 ? A PRO 3 544 11 Y 1 A TYR 4 ? A TYR 4 545 11 Y 1 A VAL 5 ? A VAL 5 546 11 Y 1 A CYS 6 ? A CYS 6 547 11 Y 1 A ILE 7 ? A ILE 7 548 11 Y 1 A HIS 8 ? A HIS 8 549 11 Y 1 A CYS 9 ? A CYS 9 550 11 Y 1 A GLN 10 ? A GLN 10 551 11 Y 1 A ARG 11 ? A ARG 11 552 11 Y 1 A GLN 12 ? A GLN 12 553 11 Y 1 A PHE 13 ? A PHE 13 554 11 Y 1 A ALA 14 ? A ALA 14 555 11 Y 1 A ASP 15 ? A ASP 15 556 11 Y 1 A PRO 16 ? A PRO 16 557 11 Y 1 A GLY 17 ? A GLY 17 558 11 Y 1 A ALA 18 ? A ALA 18 559 11 Y 1 A LEU 19 ? A LEU 19 560 11 Y 1 A GLN 20 ? A GLN 20 561 11 Y 1 A ARG 21 ? A ARG 21 562 11 Y 1 A HIS 22 ? A HIS 22 563 11 Y 1 A VAL 23 ? A VAL 23 564 11 Y 1 A ARG 24 ? A ARG 24 565 11 Y 1 A ILE 25 ? A ILE 25 566 11 Y 1 A HIS 26 ? A HIS 26 567 11 Y 1 A THR 27 ? A THR 27 568 11 Y 1 A GLY 28 ? A GLY 28 569 11 Y 1 A GLU 29 ? A GLU 29 570 11 Y 1 A PRO 59 ? A PRO 59 571 11 Y 1 A TYR 60 ? A TYR 60 572 11 Y 1 A VAL 61 ? A VAL 61 573 11 Y 1 A CYS 62 ? A CYS 62 574 11 Y 1 A GLU 63 ? A GLU 63 575 11 Y 1 A ARG 64 ? A ARG 64 576 11 Y 1 A CYS 65 ? A CYS 65 577 11 Y 1 A GLY 66 ? A GLY 66 578 11 Y 1 A LYS 67 ? A LYS 67 579 11 Y 1 A ARG 68 ? A ARG 68 580 11 Y 1 A PHE 69 ? A PHE 69 581 11 Y 1 A VAL 70 ? A VAL 70 582 11 Y 1 A GLN 71 ? A GLN 71 583 11 Y 1 A SER 72 ? A SER 72 584 11 Y 1 A SER 73 ? A SER 73 585 11 Y 1 A GLN 74 ? A GLN 74 586 11 Y 1 A LEU 75 ? A LEU 75 587 11 Y 1 A ALA 76 ? A ALA 76 588 11 Y 1 A ASN 77 ? A ASN 77 589 11 Y 1 A HIS 78 ? A HIS 78 590 11 Y 1 A ILE 79 ? A ILE 79 591 11 Y 1 A ARG 80 ? A ARG 80 592 11 Y 1 A HIS 81 ? A HIS 81 593 11 Y 1 A HIS 82 ? A HIS 82 594 11 Y 1 A ASP 83 ? A ASP 83 595 12 Y 1 A MET 1 ? A MET 1 596 12 Y 1 A LYS 2 ? A LYS 2 597 12 Y 1 A PRO 3 ? A PRO 3 598 12 Y 1 A TYR 4 ? A TYR 4 599 12 Y 1 A VAL 5 ? A VAL 5 600 12 Y 1 A CYS 6 ? A CYS 6 601 12 Y 1 A ILE 7 ? A ILE 7 602 12 Y 1 A HIS 8 ? A HIS 8 603 12 Y 1 A CYS 9 ? A CYS 9 604 12 Y 1 A GLN 10 ? A GLN 10 605 12 Y 1 A ARG 11 ? A ARG 11 606 12 Y 1 A GLN 12 ? A GLN 12 607 12 Y 1 A PHE 13 ? A PHE 13 608 12 Y 1 A ALA 14 ? A ALA 14 609 12 Y 1 A ASP 15 ? A ASP 15 610 12 Y 1 A PRO 16 ? A PRO 16 611 12 Y 1 A GLY 17 ? A GLY 17 612 12 Y 1 A ALA 18 ? A ALA 18 613 12 Y 1 A LEU 19 ? A LEU 19 614 12 Y 1 A GLN 20 ? A GLN 20 615 12 Y 1 A ARG 21 ? A ARG 21 616 12 Y 1 A HIS 22 ? A HIS 22 617 12 Y 1 A VAL 23 ? A VAL 23 618 12 Y 1 A ARG 24 ? A ARG 24 619 12 Y 1 A ILE 25 ? A ILE 25 620 12 Y 1 A HIS 26 ? A HIS 26 621 12 Y 1 A THR 27 ? A THR 27 622 12 Y 1 A GLY 28 ? A GLY 28 623 12 Y 1 A GLU 29 ? A GLU 29 624 12 Y 1 A PRO 59 ? A PRO 59 625 12 Y 1 A TYR 60 ? A TYR 60 626 12 Y 1 A VAL 61 ? A VAL 61 627 12 Y 1 A CYS 62 ? A CYS 62 628 12 Y 1 A GLU 63 ? A GLU 63 629 12 Y 1 A ARG 64 ? A ARG 64 630 12 Y 1 A CYS 65 ? A CYS 65 631 12 Y 1 A GLY 66 ? A GLY 66 632 12 Y 1 A LYS 67 ? A LYS 67 633 12 Y 1 A ARG 68 ? A ARG 68 634 12 Y 1 A PHE 69 ? A PHE 69 635 12 Y 1 A VAL 70 ? A VAL 70 636 12 Y 1 A GLN 71 ? A GLN 71 637 12 Y 1 A SER 72 ? A SER 72 638 12 Y 1 A SER 73 ? A SER 73 639 12 Y 1 A GLN 74 ? A GLN 74 640 12 Y 1 A LEU 75 ? A LEU 75 641 12 Y 1 A ALA 76 ? A ALA 76 642 12 Y 1 A ASN 77 ? A ASN 77 643 12 Y 1 A HIS 78 ? A HIS 78 644 12 Y 1 A ILE 79 ? A ILE 79 645 12 Y 1 A ARG 80 ? A ARG 80 646 12 Y 1 A HIS 81 ? A HIS 81 647 12 Y 1 A HIS 82 ? A HIS 82 648 12 Y 1 A ASP 83 ? A ASP 83 649 13 Y 1 A MET 1 ? A MET 1 650 13 Y 1 A LYS 2 ? A LYS 2 651 13 Y 1 A PRO 3 ? A PRO 3 652 13 Y 1 A TYR 4 ? A TYR 4 653 13 Y 1 A VAL 5 ? A VAL 5 654 13 Y 1 A CYS 6 ? A CYS 6 655 13 Y 1 A ILE 7 ? A ILE 7 656 13 Y 1 A HIS 8 ? A HIS 8 657 13 Y 1 A CYS 9 ? A CYS 9 658 13 Y 1 A GLN 10 ? A GLN 10 659 13 Y 1 A ARG 11 ? A ARG 11 660 13 Y 1 A GLN 12 ? A GLN 12 661 13 Y 1 A PHE 13 ? A PHE 13 662 13 Y 1 A ALA 14 ? A ALA 14 663 13 Y 1 A ASP 15 ? A ASP 15 664 13 Y 1 A PRO 16 ? A PRO 16 665 13 Y 1 A GLY 17 ? A GLY 17 666 13 Y 1 A ALA 18 ? A ALA 18 667 13 Y 1 A LEU 19 ? A LEU 19 668 13 Y 1 A GLN 20 ? A GLN 20 669 13 Y 1 A ARG 21 ? A ARG 21 670 13 Y 1 A HIS 22 ? A HIS 22 671 13 Y 1 A VAL 23 ? A VAL 23 672 13 Y 1 A ARG 24 ? A ARG 24 673 13 Y 1 A ILE 25 ? A ILE 25 674 13 Y 1 A HIS 26 ? A HIS 26 675 13 Y 1 A THR 27 ? A THR 27 676 13 Y 1 A GLY 28 ? A GLY 28 677 13 Y 1 A GLU 29 ? A GLU 29 678 13 Y 1 A PRO 59 ? A PRO 59 679 13 Y 1 A TYR 60 ? A TYR 60 680 13 Y 1 A VAL 61 ? A VAL 61 681 13 Y 1 A CYS 62 ? A CYS 62 682 13 Y 1 A GLU 63 ? A GLU 63 683 13 Y 1 A ARG 64 ? A ARG 64 684 13 Y 1 A CYS 65 ? A CYS 65 685 13 Y 1 A GLY 66 ? A GLY 66 686 13 Y 1 A LYS 67 ? A LYS 67 687 13 Y 1 A ARG 68 ? A ARG 68 688 13 Y 1 A PHE 69 ? A PHE 69 689 13 Y 1 A VAL 70 ? A VAL 70 690 13 Y 1 A GLN 71 ? A GLN 71 691 13 Y 1 A SER 72 ? A SER 72 692 13 Y 1 A SER 73 ? A SER 73 693 13 Y 1 A GLN 74 ? A GLN 74 694 13 Y 1 A LEU 75 ? A LEU 75 695 13 Y 1 A ALA 76 ? A ALA 76 696 13 Y 1 A ASN 77 ? A ASN 77 697 13 Y 1 A HIS 78 ? A HIS 78 698 13 Y 1 A ILE 79 ? A ILE 79 699 13 Y 1 A ARG 80 ? A ARG 80 700 13 Y 1 A HIS 81 ? A HIS 81 701 13 Y 1 A HIS 82 ? A HIS 82 702 13 Y 1 A ASP 83 ? A ASP 83 703 14 Y 1 A MET 1 ? A MET 1 704 14 Y 1 A LYS 2 ? A LYS 2 705 14 Y 1 A PRO 3 ? A PRO 3 706 14 Y 1 A TYR 4 ? A TYR 4 707 14 Y 1 A VAL 5 ? A VAL 5 708 14 Y 1 A CYS 6 ? A CYS 6 709 14 Y 1 A ILE 7 ? A ILE 7 710 14 Y 1 A HIS 8 ? A HIS 8 711 14 Y 1 A CYS 9 ? A CYS 9 712 14 Y 1 A GLN 10 ? A GLN 10 713 14 Y 1 A ARG 11 ? A ARG 11 714 14 Y 1 A GLN 12 ? A GLN 12 715 14 Y 1 A PHE 13 ? A PHE 13 716 14 Y 1 A ALA 14 ? A ALA 14 717 14 Y 1 A ASP 15 ? A ASP 15 718 14 Y 1 A PRO 16 ? A PRO 16 719 14 Y 1 A GLY 17 ? A GLY 17 720 14 Y 1 A ALA 18 ? A ALA 18 721 14 Y 1 A LEU 19 ? A LEU 19 722 14 Y 1 A GLN 20 ? A GLN 20 723 14 Y 1 A ARG 21 ? A ARG 21 724 14 Y 1 A HIS 22 ? A HIS 22 725 14 Y 1 A VAL 23 ? A VAL 23 726 14 Y 1 A ARG 24 ? A ARG 24 727 14 Y 1 A ILE 25 ? A ILE 25 728 14 Y 1 A HIS 26 ? A HIS 26 729 14 Y 1 A THR 27 ? A THR 27 730 14 Y 1 A GLY 28 ? A GLY 28 731 14 Y 1 A GLU 29 ? A GLU 29 732 14 Y 1 A PRO 59 ? A PRO 59 733 14 Y 1 A TYR 60 ? A TYR 60 734 14 Y 1 A VAL 61 ? A VAL 61 735 14 Y 1 A CYS 62 ? A CYS 62 736 14 Y 1 A GLU 63 ? A GLU 63 737 14 Y 1 A ARG 64 ? A ARG 64 738 14 Y 1 A CYS 65 ? A CYS 65 739 14 Y 1 A GLY 66 ? A GLY 66 740 14 Y 1 A LYS 67 ? A LYS 67 741 14 Y 1 A ARG 68 ? A ARG 68 742 14 Y 1 A PHE 69 ? A PHE 69 743 14 Y 1 A VAL 70 ? A VAL 70 744 14 Y 1 A GLN 71 ? A GLN 71 745 14 Y 1 A SER 72 ? A SER 72 746 14 Y 1 A SER 73 ? A SER 73 747 14 Y 1 A GLN 74 ? A GLN 74 748 14 Y 1 A LEU 75 ? A LEU 75 749 14 Y 1 A ALA 76 ? A ALA 76 750 14 Y 1 A ASN 77 ? A ASN 77 751 14 Y 1 A HIS 78 ? A HIS 78 752 14 Y 1 A ILE 79 ? A ILE 79 753 14 Y 1 A ARG 80 ? A ARG 80 754 14 Y 1 A HIS 81 ? A HIS 81 755 14 Y 1 A HIS 82 ? A HIS 82 756 14 Y 1 A ASP 83 ? A ASP 83 757 15 Y 1 A MET 1 ? A MET 1 758 15 Y 1 A LYS 2 ? A LYS 2 759 15 Y 1 A PRO 3 ? A PRO 3 760 15 Y 1 A TYR 4 ? A TYR 4 761 15 Y 1 A VAL 5 ? A VAL 5 762 15 Y 1 A CYS 6 ? A CYS 6 763 15 Y 1 A ILE 7 ? A ILE 7 764 15 Y 1 A HIS 8 ? A HIS 8 765 15 Y 1 A CYS 9 ? A CYS 9 766 15 Y 1 A GLN 10 ? A GLN 10 767 15 Y 1 A ARG 11 ? A ARG 11 768 15 Y 1 A GLN 12 ? A GLN 12 769 15 Y 1 A PHE 13 ? A PHE 13 770 15 Y 1 A ALA 14 ? A ALA 14 771 15 Y 1 A ASP 15 ? A ASP 15 772 15 Y 1 A PRO 16 ? A PRO 16 773 15 Y 1 A GLY 17 ? A GLY 17 774 15 Y 1 A ALA 18 ? A ALA 18 775 15 Y 1 A LEU 19 ? A LEU 19 776 15 Y 1 A GLN 20 ? A GLN 20 777 15 Y 1 A ARG 21 ? A ARG 21 778 15 Y 1 A HIS 22 ? A HIS 22 779 15 Y 1 A VAL 23 ? A VAL 23 780 15 Y 1 A ARG 24 ? A ARG 24 781 15 Y 1 A ILE 25 ? A ILE 25 782 15 Y 1 A HIS 26 ? A HIS 26 783 15 Y 1 A THR 27 ? A THR 27 784 15 Y 1 A GLY 28 ? A GLY 28 785 15 Y 1 A GLU 29 ? A GLU 29 786 15 Y 1 A PRO 59 ? A PRO 59 787 15 Y 1 A TYR 60 ? A TYR 60 788 15 Y 1 A VAL 61 ? A VAL 61 789 15 Y 1 A CYS 62 ? A CYS 62 790 15 Y 1 A GLU 63 ? A GLU 63 791 15 Y 1 A ARG 64 ? A ARG 64 792 15 Y 1 A CYS 65 ? A CYS 65 793 15 Y 1 A GLY 66 ? A GLY 66 794 15 Y 1 A LYS 67 ? A LYS 67 795 15 Y 1 A ARG 68 ? A ARG 68 796 15 Y 1 A PHE 69 ? A PHE 69 797 15 Y 1 A VAL 70 ? A VAL 70 798 15 Y 1 A GLN 71 ? A GLN 71 799 15 Y 1 A SER 72 ? A SER 72 800 15 Y 1 A SER 73 ? A SER 73 801 15 Y 1 A GLN 74 ? A GLN 74 802 15 Y 1 A LEU 75 ? A LEU 75 803 15 Y 1 A ALA 76 ? A ALA 76 804 15 Y 1 A ASN 77 ? A ASN 77 805 15 Y 1 A HIS 78 ? A HIS 78 806 15 Y 1 A ILE 79 ? A ILE 79 807 15 Y 1 A ARG 80 ? A ARG 80 808 15 Y 1 A HIS 81 ? A HIS 81 809 15 Y 1 A HIS 82 ? A HIS 82 810 15 Y 1 A ASP 83 ? A ASP 83 811 16 Y 1 A MET 1 ? A MET 1 812 16 Y 1 A LYS 2 ? A LYS 2 813 16 Y 1 A PRO 3 ? A PRO 3 814 16 Y 1 A TYR 4 ? A TYR 4 815 16 Y 1 A VAL 5 ? A VAL 5 816 16 Y 1 A CYS 6 ? A CYS 6 817 16 Y 1 A ILE 7 ? A ILE 7 818 16 Y 1 A HIS 8 ? A HIS 8 819 16 Y 1 A CYS 9 ? A CYS 9 820 16 Y 1 A GLN 10 ? A GLN 10 821 16 Y 1 A ARG 11 ? A ARG 11 822 16 Y 1 A GLN 12 ? A GLN 12 823 16 Y 1 A PHE 13 ? A PHE 13 824 16 Y 1 A ALA 14 ? A ALA 14 825 16 Y 1 A ASP 15 ? A ASP 15 826 16 Y 1 A PRO 16 ? A PRO 16 827 16 Y 1 A GLY 17 ? A GLY 17 828 16 Y 1 A ALA 18 ? A ALA 18 829 16 Y 1 A LEU 19 ? A LEU 19 830 16 Y 1 A GLN 20 ? A GLN 20 831 16 Y 1 A ARG 21 ? A ARG 21 832 16 Y 1 A HIS 22 ? A HIS 22 833 16 Y 1 A VAL 23 ? A VAL 23 834 16 Y 1 A ARG 24 ? A ARG 24 835 16 Y 1 A ILE 25 ? A ILE 25 836 16 Y 1 A HIS 26 ? A HIS 26 837 16 Y 1 A THR 27 ? A THR 27 838 16 Y 1 A GLY 28 ? A GLY 28 839 16 Y 1 A GLU 29 ? A GLU 29 840 16 Y 1 A PRO 59 ? A PRO 59 841 16 Y 1 A TYR 60 ? A TYR 60 842 16 Y 1 A VAL 61 ? A VAL 61 843 16 Y 1 A CYS 62 ? A CYS 62 844 16 Y 1 A GLU 63 ? A GLU 63 845 16 Y 1 A ARG 64 ? A ARG 64 846 16 Y 1 A CYS 65 ? A CYS 65 847 16 Y 1 A GLY 66 ? A GLY 66 848 16 Y 1 A LYS 67 ? A LYS 67 849 16 Y 1 A ARG 68 ? A ARG 68 850 16 Y 1 A PHE 69 ? A PHE 69 851 16 Y 1 A VAL 70 ? A VAL 70 852 16 Y 1 A GLN 71 ? A GLN 71 853 16 Y 1 A SER 72 ? A SER 72 854 16 Y 1 A SER 73 ? A SER 73 855 16 Y 1 A GLN 74 ? A GLN 74 856 16 Y 1 A LEU 75 ? A LEU 75 857 16 Y 1 A ALA 76 ? A ALA 76 858 16 Y 1 A ASN 77 ? A ASN 77 859 16 Y 1 A HIS 78 ? A HIS 78 860 16 Y 1 A ILE 79 ? A ILE 79 861 16 Y 1 A ARG 80 ? A ARG 80 862 16 Y 1 A HIS 81 ? A HIS 81 863 16 Y 1 A HIS 82 ? A HIS 82 864 16 Y 1 A ASP 83 ? A ASP 83 865 17 Y 1 A MET 1 ? A MET 1 866 17 Y 1 A LYS 2 ? A LYS 2 867 17 Y 1 A PRO 3 ? A PRO 3 868 17 Y 1 A TYR 4 ? A TYR 4 869 17 Y 1 A VAL 5 ? A VAL 5 870 17 Y 1 A CYS 6 ? A CYS 6 871 17 Y 1 A ILE 7 ? A ILE 7 872 17 Y 1 A HIS 8 ? A HIS 8 873 17 Y 1 A CYS 9 ? A CYS 9 874 17 Y 1 A GLN 10 ? A GLN 10 875 17 Y 1 A ARG 11 ? A ARG 11 876 17 Y 1 A GLN 12 ? A GLN 12 877 17 Y 1 A PHE 13 ? A PHE 13 878 17 Y 1 A ALA 14 ? A ALA 14 879 17 Y 1 A ASP 15 ? A ASP 15 880 17 Y 1 A PRO 16 ? A PRO 16 881 17 Y 1 A GLY 17 ? A GLY 17 882 17 Y 1 A ALA 18 ? A ALA 18 883 17 Y 1 A LEU 19 ? A LEU 19 884 17 Y 1 A GLN 20 ? A GLN 20 885 17 Y 1 A ARG 21 ? A ARG 21 886 17 Y 1 A HIS 22 ? A HIS 22 887 17 Y 1 A VAL 23 ? A VAL 23 888 17 Y 1 A ARG 24 ? A ARG 24 889 17 Y 1 A ILE 25 ? A ILE 25 890 17 Y 1 A HIS 26 ? A HIS 26 891 17 Y 1 A THR 27 ? A THR 27 892 17 Y 1 A GLY 28 ? A GLY 28 893 17 Y 1 A GLU 29 ? A GLU 29 894 17 Y 1 A PRO 59 ? A PRO 59 895 17 Y 1 A TYR 60 ? A TYR 60 896 17 Y 1 A VAL 61 ? A VAL 61 897 17 Y 1 A CYS 62 ? A CYS 62 898 17 Y 1 A GLU 63 ? A GLU 63 899 17 Y 1 A ARG 64 ? A ARG 64 900 17 Y 1 A CYS 65 ? A CYS 65 901 17 Y 1 A GLY 66 ? A GLY 66 902 17 Y 1 A LYS 67 ? A LYS 67 903 17 Y 1 A ARG 68 ? A ARG 68 904 17 Y 1 A PHE 69 ? A PHE 69 905 17 Y 1 A VAL 70 ? A VAL 70 906 17 Y 1 A GLN 71 ? A GLN 71 907 17 Y 1 A SER 72 ? A SER 72 908 17 Y 1 A SER 73 ? A SER 73 909 17 Y 1 A GLN 74 ? A GLN 74 910 17 Y 1 A LEU 75 ? A LEU 75 911 17 Y 1 A ALA 76 ? A ALA 76 912 17 Y 1 A ASN 77 ? A ASN 77 913 17 Y 1 A HIS 78 ? A HIS 78 914 17 Y 1 A ILE 79 ? A ILE 79 915 17 Y 1 A ARG 80 ? A ARG 80 916 17 Y 1 A HIS 81 ? A HIS 81 917 17 Y 1 A HIS 82 ? A HIS 82 918 17 Y 1 A ASP 83 ? A ASP 83 919 18 Y 1 A MET 1 ? A MET 1 920 18 Y 1 A LYS 2 ? A LYS 2 921 18 Y 1 A PRO 3 ? A PRO 3 922 18 Y 1 A TYR 4 ? A TYR 4 923 18 Y 1 A VAL 5 ? A VAL 5 924 18 Y 1 A CYS 6 ? A CYS 6 925 18 Y 1 A ILE 7 ? A ILE 7 926 18 Y 1 A HIS 8 ? A HIS 8 927 18 Y 1 A CYS 9 ? A CYS 9 928 18 Y 1 A GLN 10 ? A GLN 10 929 18 Y 1 A ARG 11 ? A ARG 11 930 18 Y 1 A GLN 12 ? A GLN 12 931 18 Y 1 A PHE 13 ? A PHE 13 932 18 Y 1 A ALA 14 ? A ALA 14 933 18 Y 1 A ASP 15 ? A ASP 15 934 18 Y 1 A PRO 16 ? A PRO 16 935 18 Y 1 A GLY 17 ? A GLY 17 936 18 Y 1 A ALA 18 ? A ALA 18 937 18 Y 1 A LEU 19 ? A LEU 19 938 18 Y 1 A GLN 20 ? A GLN 20 939 18 Y 1 A ARG 21 ? A ARG 21 940 18 Y 1 A HIS 22 ? A HIS 22 941 18 Y 1 A VAL 23 ? A VAL 23 942 18 Y 1 A ARG 24 ? A ARG 24 943 18 Y 1 A ILE 25 ? A ILE 25 944 18 Y 1 A HIS 26 ? A HIS 26 945 18 Y 1 A THR 27 ? A THR 27 946 18 Y 1 A GLY 28 ? A GLY 28 947 18 Y 1 A GLU 29 ? A GLU 29 948 18 Y 1 A PRO 59 ? A PRO 59 949 18 Y 1 A TYR 60 ? A TYR 60 950 18 Y 1 A VAL 61 ? A VAL 61 951 18 Y 1 A CYS 62 ? A CYS 62 952 18 Y 1 A GLU 63 ? A GLU 63 953 18 Y 1 A ARG 64 ? A ARG 64 954 18 Y 1 A CYS 65 ? A CYS 65 955 18 Y 1 A GLY 66 ? A GLY 66 956 18 Y 1 A LYS 67 ? A LYS 67 957 18 Y 1 A ARG 68 ? A ARG 68 958 18 Y 1 A PHE 69 ? A PHE 69 959 18 Y 1 A VAL 70 ? A VAL 70 960 18 Y 1 A GLN 71 ? A GLN 71 961 18 Y 1 A SER 72 ? A SER 72 962 18 Y 1 A SER 73 ? A SER 73 963 18 Y 1 A GLN 74 ? A GLN 74 964 18 Y 1 A LEU 75 ? A LEU 75 965 18 Y 1 A ALA 76 ? A ALA 76 966 18 Y 1 A ASN 77 ? A ASN 77 967 18 Y 1 A HIS 78 ? A HIS 78 968 18 Y 1 A ILE 79 ? A ILE 79 969 18 Y 1 A ARG 80 ? A ARG 80 970 18 Y 1 A HIS 81 ? A HIS 81 971 18 Y 1 A HIS 82 ? A HIS 82 972 18 Y 1 A ASP 83 ? A ASP 83 973 19 Y 1 A MET 1 ? A MET 1 974 19 Y 1 A LYS 2 ? A LYS 2 975 19 Y 1 A PRO 3 ? A PRO 3 976 19 Y 1 A TYR 4 ? A TYR 4 977 19 Y 1 A VAL 5 ? A VAL 5 978 19 Y 1 A CYS 6 ? A CYS 6 979 19 Y 1 A ILE 7 ? A ILE 7 980 19 Y 1 A HIS 8 ? A HIS 8 981 19 Y 1 A CYS 9 ? A CYS 9 982 19 Y 1 A GLN 10 ? A GLN 10 983 19 Y 1 A ARG 11 ? A ARG 11 984 19 Y 1 A GLN 12 ? A GLN 12 985 19 Y 1 A PHE 13 ? A PHE 13 986 19 Y 1 A ALA 14 ? A ALA 14 987 19 Y 1 A ASP 15 ? A ASP 15 988 19 Y 1 A PRO 16 ? A PRO 16 989 19 Y 1 A GLY 17 ? A GLY 17 990 19 Y 1 A ALA 18 ? A ALA 18 991 19 Y 1 A LEU 19 ? A LEU 19 992 19 Y 1 A GLN 20 ? A GLN 20 993 19 Y 1 A ARG 21 ? A ARG 21 994 19 Y 1 A HIS 22 ? A HIS 22 995 19 Y 1 A VAL 23 ? A VAL 23 996 19 Y 1 A ARG 24 ? A ARG 24 997 19 Y 1 A ILE 25 ? A ILE 25 998 19 Y 1 A HIS 26 ? A HIS 26 999 19 Y 1 A THR 27 ? A THR 27 1000 19 Y 1 A GLY 28 ? A GLY 28 1001 19 Y 1 A GLU 29 ? A GLU 29 1002 19 Y 1 A PRO 59 ? A PRO 59 1003 19 Y 1 A TYR 60 ? A TYR 60 1004 19 Y 1 A VAL 61 ? A VAL 61 1005 19 Y 1 A CYS 62 ? A CYS 62 1006 19 Y 1 A GLU 63 ? A GLU 63 1007 19 Y 1 A ARG 64 ? A ARG 64 1008 19 Y 1 A CYS 65 ? A CYS 65 1009 19 Y 1 A GLY 66 ? A GLY 66 1010 19 Y 1 A LYS 67 ? A LYS 67 1011 19 Y 1 A ARG 68 ? A ARG 68 1012 19 Y 1 A PHE 69 ? A PHE 69 1013 19 Y 1 A VAL 70 ? A VAL 70 1014 19 Y 1 A GLN 71 ? A GLN 71 1015 19 Y 1 A SER 72 ? A SER 72 1016 19 Y 1 A SER 73 ? A SER 73 1017 19 Y 1 A GLN 74 ? A GLN 74 1018 19 Y 1 A LEU 75 ? A LEU 75 1019 19 Y 1 A ALA 76 ? A ALA 76 1020 19 Y 1 A ASN 77 ? A ASN 77 1021 19 Y 1 A HIS 78 ? A HIS 78 1022 19 Y 1 A ILE 79 ? A ILE 79 1023 19 Y 1 A ARG 80 ? A ARG 80 1024 19 Y 1 A HIS 81 ? A HIS 81 1025 19 Y 1 A HIS 82 ? A HIS 82 1026 19 Y 1 A ASP 83 ? A ASP 83 1027 20 Y 1 A MET 1 ? A MET 1 1028 20 Y 1 A LYS 2 ? A LYS 2 1029 20 Y 1 A PRO 3 ? A PRO 3 1030 20 Y 1 A TYR 4 ? A TYR 4 1031 20 Y 1 A VAL 5 ? A VAL 5 1032 20 Y 1 A CYS 6 ? A CYS 6 1033 20 Y 1 A ILE 7 ? A ILE 7 1034 20 Y 1 A HIS 8 ? A HIS 8 1035 20 Y 1 A CYS 9 ? A CYS 9 1036 20 Y 1 A GLN 10 ? A GLN 10 1037 20 Y 1 A ARG 11 ? A ARG 11 1038 20 Y 1 A GLN 12 ? A GLN 12 1039 20 Y 1 A PHE 13 ? A PHE 13 1040 20 Y 1 A ALA 14 ? A ALA 14 1041 20 Y 1 A ASP 15 ? A ASP 15 1042 20 Y 1 A PRO 16 ? A PRO 16 1043 20 Y 1 A GLY 17 ? A GLY 17 1044 20 Y 1 A ALA 18 ? A ALA 18 1045 20 Y 1 A LEU 19 ? A LEU 19 1046 20 Y 1 A GLN 20 ? A GLN 20 1047 20 Y 1 A ARG 21 ? A ARG 21 1048 20 Y 1 A HIS 22 ? A HIS 22 1049 20 Y 1 A VAL 23 ? A VAL 23 1050 20 Y 1 A ARG 24 ? A ARG 24 1051 20 Y 1 A ILE 25 ? A ILE 25 1052 20 Y 1 A HIS 26 ? A HIS 26 1053 20 Y 1 A THR 27 ? A THR 27 1054 20 Y 1 A GLY 28 ? A GLY 28 1055 20 Y 1 A GLU 29 ? A GLU 29 1056 20 Y 1 A PRO 59 ? A PRO 59 1057 20 Y 1 A TYR 60 ? A TYR 60 1058 20 Y 1 A VAL 61 ? A VAL 61 1059 20 Y 1 A CYS 62 ? A CYS 62 1060 20 Y 1 A GLU 63 ? A GLU 63 1061 20 Y 1 A ARG 64 ? A ARG 64 1062 20 Y 1 A CYS 65 ? A CYS 65 1063 20 Y 1 A GLY 66 ? A GLY 66 1064 20 Y 1 A LYS 67 ? A LYS 67 1065 20 Y 1 A ARG 68 ? A ARG 68 1066 20 Y 1 A PHE 69 ? A PHE 69 1067 20 Y 1 A VAL 70 ? A VAL 70 1068 20 Y 1 A GLN 71 ? A GLN 71 1069 20 Y 1 A SER 72 ? A SER 72 1070 20 Y 1 A SER 73 ? A SER 73 1071 20 Y 1 A GLN 74 ? A GLN 74 1072 20 Y 1 A LEU 75 ? A LEU 75 1073 20 Y 1 A ALA 76 ? A ALA 76 1074 20 Y 1 A ASN 77 ? A ASN 77 1075 20 Y 1 A HIS 78 ? A HIS 78 1076 20 Y 1 A ILE 79 ? A ILE 79 1077 20 Y 1 A ARG 80 ? A ARG 80 1078 20 Y 1 A HIS 81 ? A HIS 81 1079 20 Y 1 A HIS 82 ? A HIS 82 1080 20 Y 1 A ASP 83 ? A ASP 83 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #