data_2LWF
# 
_entry.id   2LWF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.392 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2LWF         pdb_00002lwf 10.2210/pdb2lwf/pdb 
RCSB  RCSB102916   ?            ?                   
BMRB  18624        ?            10.13018/BMR18624   
WWPDB D_1000102916 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-05-22 
2 'Structure model' 1 1 2013-06-05 
3 'Structure model' 1 2 2013-06-19 
4 'Structure model' 1 3 2013-06-26 
5 'Structure model' 1 4 2023-06-14 
6 'Structure model' 1 5 2024-05-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
3 4 'Structure model' 'Database references' 
4 5 'Structure model' 'Data collection'     
5 5 'Structure model' 'Database references' 
6 5 'Structure model' Other                 
7 6 'Structure model' 'Data collection'     
8 6 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 5 'Structure model' database_2           
2 5 'Structure model' pdbx_database_status 
3 5 'Structure model' pdbx_nmr_software    
4 5 'Structure model' struct_ref_seq_dif   
5 6 'Structure model' chem_comp_atom       
6 6 'Structure model' chem_comp_bond       
7 6 'Structure model' database_2           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_database_2.pdbx_DOI'                       
2 5 'Structure model' '_database_2.pdbx_database_accession'        
3 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 
4 5 'Structure model' '_pdbx_nmr_software.name'                    
5 5 'Structure model' '_struct_ref_seq_dif.details'                
6 6 'Structure model' '_database_2.pdbx_DOI'                       
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2LWF 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-07-28 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            REL 
# 
_pdbx_database_related.db_id          18624 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
_audit_author.name           'Feng, Y.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Structural insights into the N-terminal GIY-YIG endonuclease activity of Arabidopsis glutaredoxin AtGRXS16 in chloroplasts.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            110 
_citation.page_first                9565 
_citation.page_last                 9570 
_citation.year                      2013 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23690600 
_citation.pdbx_database_id_DOI      10.1073/pnas.1306899110 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Liu, X.'       1  ? 
primary 'Liu, S.'       2  ? 
primary 'Feng, Y.'      3  ? 
primary 'Liu, J.Z.'     4  ? 
primary 'Chen, Y.'      5  ? 
primary 'Pham, K.'      6  ? 
primary 'Deng, H.'      7  ? 
primary 'Hirschi, K.D.' 8  ? 
primary 'Wang, X.'      9  ? 
primary 'Cheng, N.'     10 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Monothiol glutaredoxin-S16, chloroplastic' 
_entity.formula_weight             12907.639 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'N-terminal domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'AtGrxS16, CAXIP1-like protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MASAVKSLTETELLPITEADSIPSASGVYAVYDKSDELQFVGISRNIAASVSAHLKSVPELCGSVKVGIVEEPDKAVLTQ
AWKLWIEEHIKVTGKVPPGNKSGNNTFVKVTLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MASAVKSLTETELLPITEADSIPSASGVYAVYDKSDELQFVGISRNIAASVSAHLKSVPELCGSVKVGIVEEPDKAVLTQ
AWKLWIEEHIKVTGKVPPGNKSGNNTFVKVTLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   SER n 
1 4   ALA n 
1 5   VAL n 
1 6   LYS n 
1 7   SER n 
1 8   LEU n 
1 9   THR n 
1 10  GLU n 
1 11  THR n 
1 12  GLU n 
1 13  LEU n 
1 14  LEU n 
1 15  PRO n 
1 16  ILE n 
1 17  THR n 
1 18  GLU n 
1 19  ALA n 
1 20  ASP n 
1 21  SER n 
1 22  ILE n 
1 23  PRO n 
1 24  SER n 
1 25  ALA n 
1 26  SER n 
1 27  GLY n 
1 28  VAL n 
1 29  TYR n 
1 30  ALA n 
1 31  VAL n 
1 32  TYR n 
1 33  ASP n 
1 34  LYS n 
1 35  SER n 
1 36  ASP n 
1 37  GLU n 
1 38  LEU n 
1 39  GLN n 
1 40  PHE n 
1 41  VAL n 
1 42  GLY n 
1 43  ILE n 
1 44  SER n 
1 45  ARG n 
1 46  ASN n 
1 47  ILE n 
1 48  ALA n 
1 49  ALA n 
1 50  SER n 
1 51  VAL n 
1 52  SER n 
1 53  ALA n 
1 54  HIS n 
1 55  LEU n 
1 56  LYS n 
1 57  SER n 
1 58  VAL n 
1 59  PRO n 
1 60  GLU n 
1 61  LEU n 
1 62  CYS n 
1 63  GLY n 
1 64  SER n 
1 65  VAL n 
1 66  LYS n 
1 67  VAL n 
1 68  GLY n 
1 69  ILE n 
1 70  VAL n 
1 71  GLU n 
1 72  GLU n 
1 73  PRO n 
1 74  ASP n 
1 75  LYS n 
1 76  ALA n 
1 77  VAL n 
1 78  LEU n 
1 79  THR n 
1 80  GLN n 
1 81  ALA n 
1 82  TRP n 
1 83  LYS n 
1 84  LEU n 
1 85  TRP n 
1 86  ILE n 
1 87  GLU n 
1 88  GLU n 
1 89  HIS n 
1 90  ILE n 
1 91  LYS n 
1 92  VAL n 
1 93  THR n 
1 94  GLY n 
1 95  LYS n 
1 96  VAL n 
1 97  PRO n 
1 98  PRO n 
1 99  GLY n 
1 100 ASN n 
1 101 LYS n 
1 102 SER n 
1 103 GLY n 
1 104 ASN n 
1 105 ASN n 
1 106 THR n 
1 107 PHE n 
1 108 VAL n 
1 109 LYS n 
1 110 VAL n 
1 111 THR n 
1 112 LEU n 
1 113 GLU n 
1 114 HIS n 
1 115 HIS n 
1 116 HIS n 
1 117 HIS n 
1 118 HIS n 
1 119 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'mouse-ear cress,thale-cress' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'GRXS16, At2g38270, F16M14.20' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Arabidopsis thaliana' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     3702 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   62  62  MET MET A . n 
A 1 2   ALA 2   63  63  ALA ALA A . n 
A 1 3   SER 3   64  64  SER SER A . n 
A 1 4   ALA 4   65  65  ALA ALA A . n 
A 1 5   VAL 5   66  66  VAL VAL A . n 
A 1 6   LYS 6   67  67  LYS LYS A . n 
A 1 7   SER 7   68  68  SER SER A . n 
A 1 8   LEU 8   69  69  LEU LEU A . n 
A 1 9   THR 9   70  70  THR THR A . n 
A 1 10  GLU 10  71  71  GLU GLU A . n 
A 1 11  THR 11  72  72  THR THR A . n 
A 1 12  GLU 12  73  73  GLU GLU A . n 
A 1 13  LEU 13  74  74  LEU LEU A . n 
A 1 14  LEU 14  75  75  LEU LEU A . n 
A 1 15  PRO 15  76  76  PRO PRO A . n 
A 1 16  ILE 16  77  77  ILE ILE A . n 
A 1 17  THR 17  78  78  THR THR A . n 
A 1 18  GLU 18  79  79  GLU GLU A . n 
A 1 19  ALA 19  80  80  ALA ALA A . n 
A 1 20  ASP 20  81  81  ASP ASP A . n 
A 1 21  SER 21  82  82  SER SER A . n 
A 1 22  ILE 22  83  83  ILE ILE A . n 
A 1 23  PRO 23  84  84  PRO PRO A . n 
A 1 24  SER 24  85  85  SER SER A . n 
A 1 25  ALA 25  86  86  ALA ALA A . n 
A 1 26  SER 26  87  87  SER SER A . n 
A 1 27  GLY 27  88  88  GLY GLY A . n 
A 1 28  VAL 28  89  89  VAL VAL A . n 
A 1 29  TYR 29  90  90  TYR TYR A . n 
A 1 30  ALA 30  91  91  ALA ALA A . n 
A 1 31  VAL 31  92  92  VAL VAL A . n 
A 1 32  TYR 32  93  93  TYR TYR A . n 
A 1 33  ASP 33  94  94  ASP ASP A . n 
A 1 34  LYS 34  95  95  LYS LYS A . n 
A 1 35  SER 35  96  96  SER SER A . n 
A 1 36  ASP 36  97  97  ASP ASP A . n 
A 1 37  GLU 37  98  98  GLU GLU A . n 
A 1 38  LEU 38  99  99  LEU LEU A . n 
A 1 39  GLN 39  100 100 GLN GLN A . n 
A 1 40  PHE 40  101 101 PHE PHE A . n 
A 1 41  VAL 41  102 102 VAL VAL A . n 
A 1 42  GLY 42  103 103 GLY GLY A . n 
A 1 43  ILE 43  104 104 ILE ILE A . n 
A 1 44  SER 44  105 105 SER SER A . n 
A 1 45  ARG 45  106 106 ARG ARG A . n 
A 1 46  ASN 46  107 107 ASN ASN A . n 
A 1 47  ILE 47  108 108 ILE ILE A . n 
A 1 48  ALA 48  109 109 ALA ALA A . n 
A 1 49  ALA 49  110 110 ALA ALA A . n 
A 1 50  SER 50  111 111 SER SER A . n 
A 1 51  VAL 51  112 112 VAL VAL A . n 
A 1 52  SER 52  113 113 SER SER A . n 
A 1 53  ALA 53  114 114 ALA ALA A . n 
A 1 54  HIS 54  115 115 HIS HIS A . n 
A 1 55  LEU 55  116 116 LEU LEU A . n 
A 1 56  LYS 56  117 117 LYS LYS A . n 
A 1 57  SER 57  118 118 SER SER A . n 
A 1 58  VAL 58  119 119 VAL VAL A . n 
A 1 59  PRO 59  120 120 PRO PRO A . n 
A 1 60  GLU 60  121 121 GLU GLU A . n 
A 1 61  LEU 61  122 122 LEU LEU A . n 
A 1 62  CYS 62  123 123 CYS CYS A . n 
A 1 63  GLY 63  124 124 GLY GLY A . n 
A 1 64  SER 64  125 125 SER SER A . n 
A 1 65  VAL 65  126 126 VAL VAL A . n 
A 1 66  LYS 66  127 127 LYS LYS A . n 
A 1 67  VAL 67  128 128 VAL VAL A . n 
A 1 68  GLY 68  129 129 GLY GLY A . n 
A 1 69  ILE 69  130 130 ILE ILE A . n 
A 1 70  VAL 70  131 131 VAL VAL A . n 
A 1 71  GLU 71  132 132 GLU GLU A . n 
A 1 72  GLU 72  133 133 GLU GLU A . n 
A 1 73  PRO 73  134 134 PRO PRO A . n 
A 1 74  ASP 74  135 135 ASP ASP A . n 
A 1 75  LYS 75  136 136 LYS LYS A . n 
A 1 76  ALA 76  137 137 ALA ALA A . n 
A 1 77  VAL 77  138 138 VAL VAL A . n 
A 1 78  LEU 78  139 139 LEU LEU A . n 
A 1 79  THR 79  140 140 THR THR A . n 
A 1 80  GLN 80  141 141 GLN GLN A . n 
A 1 81  ALA 81  142 142 ALA ALA A . n 
A 1 82  TRP 82  143 143 TRP TRP A . n 
A 1 83  LYS 83  144 144 LYS LYS A . n 
A 1 84  LEU 84  145 145 LEU LEU A . n 
A 1 85  TRP 85  146 146 TRP TRP A . n 
A 1 86  ILE 86  147 147 ILE ILE A . n 
A 1 87  GLU 87  148 148 GLU GLU A . n 
A 1 88  GLU 88  149 149 GLU GLU A . n 
A 1 89  HIS 89  150 150 HIS HIS A . n 
A 1 90  ILE 90  151 151 ILE ILE A . n 
A 1 91  LYS 91  152 152 LYS LYS A . n 
A 1 92  VAL 92  153 153 VAL VAL A . n 
A 1 93  THR 93  154 154 THR THR A . n 
A 1 94  GLY 94  155 155 GLY GLY A . n 
A 1 95  LYS 95  156 156 LYS LYS A . n 
A 1 96  VAL 96  157 157 VAL VAL A . n 
A 1 97  PRO 97  158 158 PRO PRO A . n 
A 1 98  PRO 98  159 159 PRO PRO A . n 
A 1 99  GLY 99  160 160 GLY GLY A . n 
A 1 100 ASN 100 161 161 ASN ASN A . n 
A 1 101 LYS 101 162 162 LYS LYS A . n 
A 1 102 SER 102 163 163 SER SER A . n 
A 1 103 GLY 103 164 164 GLY GLY A . n 
A 1 104 ASN 104 165 165 ASN ASN A . n 
A 1 105 ASN 105 166 166 ASN ASN A . n 
A 1 106 THR 106 167 167 THR THR A . n 
A 1 107 PHE 107 168 168 PHE PHE A . n 
A 1 108 VAL 108 169 169 VAL VAL A . n 
A 1 109 LYS 109 170 170 LYS LYS A . n 
A 1 110 VAL 110 171 171 VAL VAL A . n 
A 1 111 THR 111 172 172 THR THR A . n 
A 1 112 LEU 112 173 173 LEU LEU A . n 
A 1 113 GLU 113 174 174 GLU GLU A . n 
A 1 114 HIS 114 175 175 HIS HIS A . n 
A 1 115 HIS 115 176 176 HIS HIS A . n 
A 1 116 HIS 116 177 177 HIS HIS A . n 
A 1 117 HIS 117 178 178 HIS HIS A . n 
A 1 118 HIS 118 179 179 HIS HIS A . n 
A 1 119 HIS 119 180 180 HIS HIS A . n 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2LWF 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2LWF 
_struct.title                     'Structure of N-terminal domain of a plant Grx' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2LWF 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'Nuclease, Glutaredoxin, HYDROLASE' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GRS16_ARATH 
_struct_ref.pdbx_db_accession          Q8H7F6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;ASAVKSLTETELLPITEADSIPSASGVYAVYDKSDELQFVGISRNIAASVSAHLKSVPELCGSVKVGIVEEPDKAVLTQA
WKLWIEEHIKVTGKVPPGNKSGNNTFVK
;
_struct_ref.pdbx_align_begin           63 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2LWF 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 109 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8H7F6 
_struct_ref_seq.db_align_beg                  63 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  170 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       63 
_struct_ref_seq.pdbx_auth_seq_align_end       170 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2LWF MET A 1   ? UNP Q8H7F6 ? ? 'initiating methionine' 62  1  
1 2LWF VAL A 110 ? UNP Q8H7F6 ? ? 'expression tag'        171 2  
1 2LWF THR A 111 ? UNP Q8H7F6 ? ? 'expression tag'        172 3  
1 2LWF LEU A 112 ? UNP Q8H7F6 ? ? 'expression tag'        173 4  
1 2LWF GLU A 113 ? UNP Q8H7F6 ? ? 'expression tag'        174 5  
1 2LWF HIS A 114 ? UNP Q8H7F6 ? ? 'expression tag'        175 6  
1 2LWF HIS A 115 ? UNP Q8H7F6 ? ? 'expression tag'        176 7  
1 2LWF HIS A 116 ? UNP Q8H7F6 ? ? 'expression tag'        177 8  
1 2LWF HIS A 117 ? UNP Q8H7F6 ? ? 'expression tag'        178 9  
1 2LWF HIS A 118 ? UNP Q8H7F6 ? ? 'expression tag'        179 10 
1 2LWF HIS A 119 ? UNP Q8H7F6 ? ? 'expression tag'        180 11 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 7  ? THR A 11 ? SER A 68  THR A 72  5 ? 5  
HELX_P HELX_P2 2 GLU A 18 ? ILE A 22 ? GLU A 79  ILE A 83  5 ? 5  
HELX_P HELX_P3 3 ASN A 46 ? VAL A 58 ? ASN A 107 VAL A 119 1 ? 13 
HELX_P HELX_P4 4 PRO A 59 ? CYS A 62 ? PRO A 120 CYS A 123 5 ? 4  
HELX_P HELX_P5 5 ASP A 74 ? THR A 93 ? ASP A 135 THR A 154 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 12 ? PRO A 15 ? GLU A 73  PRO A 76  
A 2 SER A 64 ? ILE A 69 ? SER A 125 ILE A 130 
A 3 GLY A 27 ? TYR A 32 ? GLY A 88  TYR A 93  
A 4 LEU A 38 ? SER A 44 ? LEU A 99  SER A 105 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 14 ? N LEU A 75  O VAL A 65 ? O VAL A 126 
A 2 3 O GLY A 68 ? O GLY A 129 N VAL A 28 ? N VAL A 89  
A 3 4 N VAL A 31 ? N VAL A 92  O PHE A 40 ? O PHE A 101 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 7  HZ2 A LYS 144 ? ? OE1 A GLU 148 ? ? 1.60 
2 11 HZ3 A LYS 144 ? ? OE1 A GLU 148 ? ? 1.60 
3 12 H1  A MET 62  ? ? OE1 A GLU 73  ? ? 1.57 
4 15 H3  A MET 62  ? ? OE1 A GLU 132 ? ? 1.58 
5 15 HZ3 A LYS 136 ? ? OE1 A GLU 174 ? ? 1.60 
6 17 HZ1 A LYS 144 ? ? OE2 A GLU 148 ? ? 1.55 
7 17 OE2 A GLU 149 ? ? HZ1 A LYS 152 ? ? 1.59 
8 17 HZ1 A LYS 67  ? ? OE1 A GLU 71  ? ? 1.60 
9 19 OE1 A GLU 98  ? ? HZ2 A LYS 156 ? ? 1.59 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  SER A 64  ? ? -167.29 -164.52 
2   1  GLU A 79  ? ? -93.16  54.20   
3   1  SER A 85  ? ? -92.90  39.01   
4   1  ASP A 97  ? ? 62.33   67.75   
5   1  THR A 154 ? ? -131.70 -30.21  
6   1  GLU A 174 ? ? 45.70   72.56   
7   1  HIS A 175 ? ? -148.24 47.33   
8   1  HIS A 178 ? ? -176.78 89.43   
9   2  LYS A 67  ? ? -95.39  -82.01  
10  2  GLU A 79  ? ? -92.97  30.58   
11  2  SER A 85  ? ? -99.16  49.51   
12  2  ASP A 94  ? ? -79.94  -167.93 
13  2  PRO A 134 ? ? -84.84  34.03   
14  2  THR A 167 ? ? -55.62  -4.85   
15  2  THR A 172 ? ? 67.40   -59.65  
16  2  GLU A 174 ? ? 178.99  172.53  
17  3  GLU A 79  ? ? -94.14  38.93   
18  3  ASP A 94  ? ? -79.52  -168.54 
19  3  PRO A 134 ? ? -86.11  36.24   
20  3  SER A 163 ? ? -55.33  109.78  
21  3  VAL A 171 ? ? -128.46 -136.99 
22  4  GLU A 79  ? ? -107.96 53.79   
23  4  PRO A 120 ? ? -77.53  24.64   
24  4  PRO A 134 ? ? -76.39  46.75   
25  4  GLU A 174 ? ? 70.15   -62.12  
26  4  HIS A 179 ? ? 66.62   88.22   
27  5  SER A 64  ? ? -140.84 -68.72  
28  5  ALA A 65  ? ? 38.84   96.52   
29  5  GLU A 79  ? ? -98.49  53.68   
30  5  SER A 85  ? ? -92.97  31.68   
31  5  CYS A 123 ? ? -67.95  96.66   
32  5  VAL A 157 ? ? -158.60 77.37   
33  5  LYS A 170 ? ? 77.01   135.79  
34  5  LEU A 173 ? ? 76.07   -179.78 
35  5  HIS A 176 ? ? -56.79  99.15   
36  5  HIS A 179 ? ? -125.29 -70.21  
37  6  ALA A 65  ? ? 79.46   145.62  
38  6  LYS A 67  ? ? -86.52  -77.48  
39  6  GLU A 79  ? ? -96.95  54.13   
40  6  ASP A 94  ? ? -78.64  -166.96 
41  6  PRO A 120 ? ? -76.65  24.47   
42  6  VAL A 157 ? ? 41.13   75.99   
43  6  LYS A 170 ? ? -87.50  33.40   
44  6  HIS A 178 ? ? 76.69   179.42  
45  7  ALA A 65  ? ? 64.01   -173.91 
46  7  LYS A 67  ? ? -61.39  -77.49  
47  7  GLU A 79  ? ? -112.93 53.26   
48  7  ASP A 94  ? ? -78.64  -168.16 
49  7  PRO A 120 ? ? -74.07  24.13   
50  7  PRO A 134 ? ? -82.31  32.47   
51  7  LEU A 173 ? ? 68.31   164.42  
52  7  HIS A 175 ? ? 70.72   -44.02  
53  8  ALA A 63  ? ? -140.17 -58.84  
54  8  SER A 64  ? ? -163.70 98.35   
55  8  GLU A 79  ? ? -103.49 53.79   
56  8  PRO A 134 ? ? -82.91  32.92   
57  8  LYS A 170 ? ? 67.33   134.96  
58  8  HIS A 175 ? ? 53.74   80.44   
59  9  ALA A 63  ? ? -169.29 -35.83  
60  9  GLU A 79  ? ? -104.85 53.15   
61  9  ASP A 94  ? ? -79.16  -169.44 
62  9  LYS A 170 ? ? -68.88  1.40    
63  9  HIS A 179 ? ? -179.54 -39.11  
64  10 LYS A 67  ? ? -79.80  -152.55 
65  10 PRO A 120 ? ? -73.53  21.12   
66  10 PRO A 134 ? ? -76.83  39.29   
67  10 SER A 163 ? ? -102.95 -152.72 
68  10 ASN A 166 ? ? -103.34 -79.54  
69  10 VAL A 171 ? ? 53.56   -79.74  
70  10 HIS A 179 ? ? -100.90 -162.49 
71  11 ALA A 63  ? ? -105.89 77.70   
72  11 GLU A 79  ? ? -109.63 54.25   
73  11 SER A 85  ? ? -94.05  30.65   
74  11 PRO A 134 ? ? -78.32  39.41   
75  11 LYS A 170 ? ? 64.09   -165.49 
76  11 THR A 172 ? ? 63.17   -47.88  
77  11 HIS A 178 ? ? -146.58 -60.39  
78  12 LYS A 67  ? ? -128.39 -72.59  
79  12 GLU A 79  ? ? -94.56  56.09   
80  12 SER A 85  ? ? -98.60  34.21   
81  12 PRO A 134 ? ? -82.72  37.92   
82  12 HIS A 178 ? ? -154.85 23.33   
83  13 GLU A 79  ? ? -101.62 53.07   
84  13 SER A 85  ? ? -95.50  32.79   
85  13 PRO A 120 ? ? -79.27  32.56   
86  13 LYS A 162 ? ? -76.01  -82.10  
87  13 HIS A 175 ? ? -121.88 -71.66  
88  14 GLU A 79  ? ? -102.09 53.57   
89  14 VAL A 157 ? ? -158.43 86.87   
90  14 LYS A 170 ? ? 73.69   -71.85  
91  14 VAL A 171 ? ? 58.68   76.75   
92  14 HIS A 179 ? ? -161.79 -49.53  
93  15 ALA A 63  ? ? -65.34  99.97   
94  15 LYS A 67  ? ? -104.68 -86.77  
95  15 GLU A 79  ? ? -107.26 52.77   
96  15 PRO A 134 ? ? -88.80  32.37   
97  15 VAL A 157 ? ? -155.84 70.96   
98  15 ASN A 166 ? ? -131.63 -68.33  
99  15 LYS A 170 ? ? 69.02   88.04   
100 15 THR A 172 ? ? -178.59 -44.00  
101 15 GLU A 174 ? ? 54.51   100.51  
102 15 HIS A 178 ? ? 71.35   116.09  
103 16 GLU A 79  ? ? -97.85  55.48   
104 16 SER A 85  ? ? -89.58  36.38   
105 16 ASP A 94  ? ? -78.92  -167.19 
106 16 PRO A 134 ? ? -77.84  45.41   
107 16 THR A 154 ? ? -130.88 -36.11  
108 16 LYS A 170 ? ? -167.16 109.06  
109 17 SER A 64  ? ? 71.37   149.33  
110 17 GLU A 79  ? ? -90.34  53.91   
111 17 PRO A 134 ? ? -88.90  37.74   
112 17 THR A 154 ? ? -138.01 -31.27  
113 17 SER A 163 ? ? 71.13   112.53  
114 17 LYS A 170 ? ? 77.51   -61.81  
115 17 HIS A 175 ? ? 71.27   159.69  
116 17 HIS A 177 ? ? -69.79  97.29   
117 18 LYS A 67  ? ? -88.06  -70.13  
118 18 GLU A 79  ? ? -95.14  50.89   
119 18 SER A 85  ? ? -95.30  34.74   
120 18 PRO A 134 ? ? -79.65  31.52   
121 18 LYS A 156 ? ? -91.47  -70.58  
122 18 VAL A 157 ? ? 41.40   83.27   
123 18 LYS A 162 ? ? -64.26  -71.54  
124 18 SER A 163 ? ? 178.35  151.85  
125 18 LYS A 170 ? ? 65.81   -83.53  
126 19 GLU A 79  ? ? -97.95  47.89   
127 19 PRO A 120 ? ? -68.84  14.28   
128 19 LYS A 170 ? ? -176.16 140.51  
129 19 HIS A 178 ? ? 70.43   109.06  
130 20 SER A 64  ? ? -95.03  31.47   
131 20 GLU A 79  ? ? -99.43  52.97   
132 20 SER A 85  ? ? -93.69  35.72   
133 20 ASP A 97  ? ? 61.51   62.94   
134 20 PRO A 120 ? ? -74.84  29.75   
135 20 LYS A 156 ? ? -78.95  -74.94  
136 20 LYS A 170 ? ? -92.38  36.80   
137 20 GLU A 174 ? ? -99.46  32.94   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 5  ARG A 106 ? ? 0.086 'SIDE CHAIN' 
2 10 ARG A 106 ? ? 0.074 'SIDE CHAIN' 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2LWF 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2LWF 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_sample_details.contents         
'0.5-1.0 mM [U-13C; U-15N] protein, 50 mM sodium phosphate, 10 mM DTT, 0.02 % DSS, 0.1 v/v [U-2H] D2O, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
entity-1             ?    0.5-1.0 mM  '[U-13C; U-15N]' 1 
'sodium phosphate-2' 50   ?       mM  ?                1 
DTT-3                10   ?       mM  ?                1 
DSS-4                0.02 ?       %   ?                1 
D2O-5                0.1  ?       v/v '[U-2H]'         1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.05 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'            
1 2  1 '2D 1H-13C HSQC'            
1 3  1 '3D CBCA(CO)NH'             
1 4  1 '3D HNCA'                   
1 5  1 '3D HNCACB'                 
1 6  1 '3D HNCO'                   
1 7  1 '3D HBHA(CO)NH'             
1 8  1 '3D HCCH-TOCSY'             
1 9  1 '3D HCCH-COSY'              
1 10 1 '3D CCH-TOCSY'              
1 11 1 '3D 1H-15N TOCSY'           
1 12 1 '3D 1H-15N NOESY'           
1 13 1 '3D 1H-13C NOESY aliphatic' 
1 14 1 '3D 1H-13C NOESY aromatic'  
# 
_pdbx_nmr_refine.entry_id           2LWF 
_pdbx_nmr_refine.method             'molecular dynamics, simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Bruker Biospin'                               collection                  XwinNMR ? 1 
'Accelrys Software Inc.'                       processing                  Felix   ? 2 
'Johnson, One Moon Scientific'                 'peak picking'              NMRView ? 3 
'Johnson, One Moon Scientific'                 'chemical shift assignment' NMRView ? 4 
'Johnson, One Moon Scientific'                 'data analysis'             NMRView ? 5 
'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution'        CNS     ? 6 
'Brunger, Adams, Clore, Gros, Nilges and Read' refinement                  CNS     ? 7 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
HIS N    N N N 137 
HIS CA   C N S 138 
HIS C    C N N 139 
HIS O    O N N 140 
HIS CB   C N N 141 
HIS CG   C Y N 142 
HIS ND1  N Y N 143 
HIS CD2  C Y N 144 
HIS CE1  C Y N 145 
HIS NE2  N Y N 146 
HIS OXT  O N N 147 
HIS H    H N N 148 
HIS H2   H N N 149 
HIS HA   H N N 150 
HIS HB2  H N N 151 
HIS HB3  H N N 152 
HIS HD1  H N N 153 
HIS HD2  H N N 154 
HIS HE1  H N N 155 
HIS HE2  H N N 156 
HIS HXT  H N N 157 
ILE N    N N N 158 
ILE CA   C N S 159 
ILE C    C N N 160 
ILE O    O N N 161 
ILE CB   C N S 162 
ILE CG1  C N N 163 
ILE CG2  C N N 164 
ILE CD1  C N N 165 
ILE OXT  O N N 166 
ILE H    H N N 167 
ILE H2   H N N 168 
ILE HA   H N N 169 
ILE HB   H N N 170 
ILE HG12 H N N 171 
ILE HG13 H N N 172 
ILE HG21 H N N 173 
ILE HG22 H N N 174 
ILE HG23 H N N 175 
ILE HD11 H N N 176 
ILE HD12 H N N 177 
ILE HD13 H N N 178 
ILE HXT  H N N 179 
LEU N    N N N 180 
LEU CA   C N S 181 
LEU C    C N N 182 
LEU O    O N N 183 
LEU CB   C N N 184 
LEU CG   C N N 185 
LEU CD1  C N N 186 
LEU CD2  C N N 187 
LEU OXT  O N N 188 
LEU H    H N N 189 
LEU H2   H N N 190 
LEU HA   H N N 191 
LEU HB2  H N N 192 
LEU HB3  H N N 193 
LEU HG   H N N 194 
LEU HD11 H N N 195 
LEU HD12 H N N 196 
LEU HD13 H N N 197 
LEU HD21 H N N 198 
LEU HD22 H N N 199 
LEU HD23 H N N 200 
LEU HXT  H N N 201 
LYS N    N N N 202 
LYS CA   C N S 203 
LYS C    C N N 204 
LYS O    O N N 205 
LYS CB   C N N 206 
LYS CG   C N N 207 
LYS CD   C N N 208 
LYS CE   C N N 209 
LYS NZ   N N N 210 
LYS OXT  O N N 211 
LYS H    H N N 212 
LYS H2   H N N 213 
LYS HA   H N N 214 
LYS HB2  H N N 215 
LYS HB3  H N N 216 
LYS HG2  H N N 217 
LYS HG3  H N N 218 
LYS HD2  H N N 219 
LYS HD3  H N N 220 
LYS HE2  H N N 221 
LYS HE3  H N N 222 
LYS HZ1  H N N 223 
LYS HZ2  H N N 224 
LYS HZ3  H N N 225 
LYS HXT  H N N 226 
MET N    N N N 227 
MET CA   C N S 228 
MET C    C N N 229 
MET O    O N N 230 
MET CB   C N N 231 
MET CG   C N N 232 
MET SD   S N N 233 
MET CE   C N N 234 
MET OXT  O N N 235 
MET H    H N N 236 
MET H2   H N N 237 
MET HA   H N N 238 
MET HB2  H N N 239 
MET HB3  H N N 240 
MET HG2  H N N 241 
MET HG3  H N N 242 
MET HE1  H N N 243 
MET HE2  H N N 244 
MET HE3  H N N 245 
MET HXT  H N N 246 
PHE N    N N N 247 
PHE CA   C N S 248 
PHE C    C N N 249 
PHE O    O N N 250 
PHE CB   C N N 251 
PHE CG   C Y N 252 
PHE CD1  C Y N 253 
PHE CD2  C Y N 254 
PHE CE1  C Y N 255 
PHE CE2  C Y N 256 
PHE CZ   C Y N 257 
PHE OXT  O N N 258 
PHE H    H N N 259 
PHE H2   H N N 260 
PHE HA   H N N 261 
PHE HB2  H N N 262 
PHE HB3  H N N 263 
PHE HD1  H N N 264 
PHE HD2  H N N 265 
PHE HE1  H N N 266 
PHE HE2  H N N 267 
PHE HZ   H N N 268 
PHE HXT  H N N 269 
PRO N    N N N 270 
PRO CA   C N S 271 
PRO C    C N N 272 
PRO O    O N N 273 
PRO CB   C N N 274 
PRO CG   C N N 275 
PRO CD   C N N 276 
PRO OXT  O N N 277 
PRO H    H N N 278 
PRO HA   H N N 279 
PRO HB2  H N N 280 
PRO HB3  H N N 281 
PRO HG2  H N N 282 
PRO HG3  H N N 283 
PRO HD2  H N N 284 
PRO HD3  H N N 285 
PRO HXT  H N N 286 
SER N    N N N 287 
SER CA   C N S 288 
SER C    C N N 289 
SER O    O N N 290 
SER CB   C N N 291 
SER OG   O N N 292 
SER OXT  O N N 293 
SER H    H N N 294 
SER H2   H N N 295 
SER HA   H N N 296 
SER HB2  H N N 297 
SER HB3  H N N 298 
SER HG   H N N 299 
SER HXT  H N N 300 
THR N    N N N 301 
THR CA   C N S 302 
THR C    C N N 303 
THR O    O N N 304 
THR CB   C N R 305 
THR OG1  O N N 306 
THR CG2  C N N 307 
THR OXT  O N N 308 
THR H    H N N 309 
THR H2   H N N 310 
THR HA   H N N 311 
THR HB   H N N 312 
THR HG1  H N N 313 
THR HG21 H N N 314 
THR HG22 H N N 315 
THR HG23 H N N 316 
THR HXT  H N N 317 
TRP N    N N N 318 
TRP CA   C N S 319 
TRP C    C N N 320 
TRP O    O N N 321 
TRP CB   C N N 322 
TRP CG   C Y N 323 
TRP CD1  C Y N 324 
TRP CD2  C Y N 325 
TRP NE1  N Y N 326 
TRP CE2  C Y N 327 
TRP CE3  C Y N 328 
TRP CZ2  C Y N 329 
TRP CZ3  C Y N 330 
TRP CH2  C Y N 331 
TRP OXT  O N N 332 
TRP H    H N N 333 
TRP H2   H N N 334 
TRP HA   H N N 335 
TRP HB2  H N N 336 
TRP HB3  H N N 337 
TRP HD1  H N N 338 
TRP HE1  H N N 339 
TRP HE3  H N N 340 
TRP HZ2  H N N 341 
TRP HZ3  H N N 342 
TRP HH2  H N N 343 
TRP HXT  H N N 344 
TYR N    N N N 345 
TYR CA   C N S 346 
TYR C    C N N 347 
TYR O    O N N 348 
TYR CB   C N N 349 
TYR CG   C Y N 350 
TYR CD1  C Y N 351 
TYR CD2  C Y N 352 
TYR CE1  C Y N 353 
TYR CE2  C Y N 354 
TYR CZ   C Y N 355 
TYR OH   O N N 356 
TYR OXT  O N N 357 
TYR H    H N N 358 
TYR H2   H N N 359 
TYR HA   H N N 360 
TYR HB2  H N N 361 
TYR HB3  H N N 362 
TYR HD1  H N N 363 
TYR HD2  H N N 364 
TYR HE1  H N N 365 
TYR HE2  H N N 366 
TYR HH   H N N 367 
TYR HXT  H N N 368 
VAL N    N N N 369 
VAL CA   C N S 370 
VAL C    C N N 371 
VAL O    O N N 372 
VAL CB   C N N 373 
VAL CG1  C N N 374 
VAL CG2  C N N 375 
VAL OXT  O N N 376 
VAL H    H N N 377 
VAL H2   H N N 378 
VAL HA   H N N 379 
VAL HB   H N N 380 
VAL HG11 H N N 381 
VAL HG12 H N N 382 
VAL HG13 H N N 383 
VAL HG21 H N N 384 
VAL HG22 H N N 385 
VAL HG23 H N N 386 
VAL HXT  H N N 387 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LEU N   CA   sing N N 171 
LEU N   H    sing N N 172 
LEU N   H2   sing N N 173 
LEU CA  C    sing N N 174 
LEU CA  CB   sing N N 175 
LEU CA  HA   sing N N 176 
LEU C   O    doub N N 177 
LEU C   OXT  sing N N 178 
LEU CB  CG   sing N N 179 
LEU CB  HB2  sing N N 180 
LEU CB  HB3  sing N N 181 
LEU CG  CD1  sing N N 182 
LEU CG  CD2  sing N N 183 
LEU CG  HG   sing N N 184 
LEU CD1 HD11 sing N N 185 
LEU CD1 HD12 sing N N 186 
LEU CD1 HD13 sing N N 187 
LEU CD2 HD21 sing N N 188 
LEU CD2 HD22 sing N N 189 
LEU CD2 HD23 sing N N 190 
LEU OXT HXT  sing N N 191 
LYS N   CA   sing N N 192 
LYS N   H    sing N N 193 
LYS N   H2   sing N N 194 
LYS CA  C    sing N N 195 
LYS CA  CB   sing N N 196 
LYS CA  HA   sing N N 197 
LYS C   O    doub N N 198 
LYS C   OXT  sing N N 199 
LYS CB  CG   sing N N 200 
LYS CB  HB2  sing N N 201 
LYS CB  HB3  sing N N 202 
LYS CG  CD   sing N N 203 
LYS CG  HG2  sing N N 204 
LYS CG  HG3  sing N N 205 
LYS CD  CE   sing N N 206 
LYS CD  HD2  sing N N 207 
LYS CD  HD3  sing N N 208 
LYS CE  NZ   sing N N 209 
LYS CE  HE2  sing N N 210 
LYS CE  HE3  sing N N 211 
LYS NZ  HZ1  sing N N 212 
LYS NZ  HZ2  sing N N 213 
LYS NZ  HZ3  sing N N 214 
LYS OXT HXT  sing N N 215 
MET N   CA   sing N N 216 
MET N   H    sing N N 217 
MET N   H2   sing N N 218 
MET CA  C    sing N N 219 
MET CA  CB   sing N N 220 
MET CA  HA   sing N N 221 
MET C   O    doub N N 222 
MET C   OXT  sing N N 223 
MET CB  CG   sing N N 224 
MET CB  HB2  sing N N 225 
MET CB  HB3  sing N N 226 
MET CG  SD   sing N N 227 
MET CG  HG2  sing N N 228 
MET CG  HG3  sing N N 229 
MET SD  CE   sing N N 230 
MET CE  HE1  sing N N 231 
MET CE  HE2  sing N N 232 
MET CE  HE3  sing N N 233 
MET OXT HXT  sing N N 234 
PHE N   CA   sing N N 235 
PHE N   H    sing N N 236 
PHE N   H2   sing N N 237 
PHE CA  C    sing N N 238 
PHE CA  CB   sing N N 239 
PHE CA  HA   sing N N 240 
PHE C   O    doub N N 241 
PHE C   OXT  sing N N 242 
PHE CB  CG   sing N N 243 
PHE CB  HB2  sing N N 244 
PHE CB  HB3  sing N N 245 
PHE CG  CD1  doub Y N 246 
PHE CG  CD2  sing Y N 247 
PHE CD1 CE1  sing Y N 248 
PHE CD1 HD1  sing N N 249 
PHE CD2 CE2  doub Y N 250 
PHE CD2 HD2  sing N N 251 
PHE CE1 CZ   doub Y N 252 
PHE CE1 HE1  sing N N 253 
PHE CE2 CZ   sing Y N 254 
PHE CE2 HE2  sing N N 255 
PHE CZ  HZ   sing N N 256 
PHE OXT HXT  sing N N 257 
PRO N   CA   sing N N 258 
PRO N   CD   sing N N 259 
PRO N   H    sing N N 260 
PRO CA  C    sing N N 261 
PRO CA  CB   sing N N 262 
PRO CA  HA   sing N N 263 
PRO C   O    doub N N 264 
PRO C   OXT  sing N N 265 
PRO CB  CG   sing N N 266 
PRO CB  HB2  sing N N 267 
PRO CB  HB3  sing N N 268 
PRO CG  CD   sing N N 269 
PRO CG  HG2  sing N N 270 
PRO CG  HG3  sing N N 271 
PRO CD  HD2  sing N N 272 
PRO CD  HD3  sing N N 273 
PRO OXT HXT  sing N N 274 
SER N   CA   sing N N 275 
SER N   H    sing N N 276 
SER N   H2   sing N N 277 
SER CA  C    sing N N 278 
SER CA  CB   sing N N 279 
SER CA  HA   sing N N 280 
SER C   O    doub N N 281 
SER C   OXT  sing N N 282 
SER CB  OG   sing N N 283 
SER CB  HB2  sing N N 284 
SER CB  HB3  sing N N 285 
SER OG  HG   sing N N 286 
SER OXT HXT  sing N N 287 
THR N   CA   sing N N 288 
THR N   H    sing N N 289 
THR N   H2   sing N N 290 
THR CA  C    sing N N 291 
THR CA  CB   sing N N 292 
THR CA  HA   sing N N 293 
THR C   O    doub N N 294 
THR C   OXT  sing N N 295 
THR CB  OG1  sing N N 296 
THR CB  CG2  sing N N 297 
THR CB  HB   sing N N 298 
THR OG1 HG1  sing N N 299 
THR CG2 HG21 sing N N 300 
THR CG2 HG22 sing N N 301 
THR CG2 HG23 sing N N 302 
THR OXT HXT  sing N N 303 
TRP N   CA   sing N N 304 
TRP N   H    sing N N 305 
TRP N   H2   sing N N 306 
TRP CA  C    sing N N 307 
TRP CA  CB   sing N N 308 
TRP CA  HA   sing N N 309 
TRP C   O    doub N N 310 
TRP C   OXT  sing N N 311 
TRP CB  CG   sing N N 312 
TRP CB  HB2  sing N N 313 
TRP CB  HB3  sing N N 314 
TRP CG  CD1  doub Y N 315 
TRP CG  CD2  sing Y N 316 
TRP CD1 NE1  sing Y N 317 
TRP CD1 HD1  sing N N 318 
TRP CD2 CE2  doub Y N 319 
TRP CD2 CE3  sing Y N 320 
TRP NE1 CE2  sing Y N 321 
TRP NE1 HE1  sing N N 322 
TRP CE2 CZ2  sing Y N 323 
TRP CE3 CZ3  doub Y N 324 
TRP CE3 HE3  sing N N 325 
TRP CZ2 CH2  doub Y N 326 
TRP CZ2 HZ2  sing N N 327 
TRP CZ3 CH2  sing Y N 328 
TRP CZ3 HZ3  sing N N 329 
TRP CH2 HH2  sing N N 330 
TRP OXT HXT  sing N N 331 
TYR N   CA   sing N N 332 
TYR N   H    sing N N 333 
TYR N   H2   sing N N 334 
TYR CA  C    sing N N 335 
TYR CA  CB   sing N N 336 
TYR CA  HA   sing N N 337 
TYR C   O    doub N N 338 
TYR C   OXT  sing N N 339 
TYR CB  CG   sing N N 340 
TYR CB  HB2  sing N N 341 
TYR CB  HB3  sing N N 342 
TYR CG  CD1  doub Y N 343 
TYR CG  CD2  sing Y N 344 
TYR CD1 CE1  sing Y N 345 
TYR CD1 HD1  sing N N 346 
TYR CD2 CE2  doub Y N 347 
TYR CD2 HD2  sing N N 348 
TYR CE1 CZ   doub Y N 349 
TYR CE1 HE1  sing N N 350 
TYR CE2 CZ   sing Y N 351 
TYR CE2 HE2  sing N N 352 
TYR CZ  OH   sing N N 353 
TYR OH  HH   sing N N 354 
TYR OXT HXT  sing N N 355 
VAL N   CA   sing N N 356 
VAL N   H    sing N N 357 
VAL N   H2   sing N N 358 
VAL CA  C    sing N N 359 
VAL CA  CB   sing N N 360 
VAL CA  HA   sing N N 361 
VAL C   O    doub N N 362 
VAL C   OXT  sing N N 363 
VAL CB  CG1  sing N N 364 
VAL CB  CG2  sing N N 365 
VAL CB  HB   sing N N 366 
VAL CG1 HG11 sing N N 367 
VAL CG1 HG12 sing N N 368 
VAL CG1 HG13 sing N N 369 
VAL CG2 HG21 sing N N 370 
VAL CG2 HG22 sing N N 371 
VAL CG2 HG23 sing N N 372 
VAL OXT HXT  sing N N 373 
# 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             DMX 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker DMX' 
# 
_atom_sites.entry_id                    2LWF 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_