data_2LWZ # _entry.id 2LWZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2LWZ RCSB RCSB102936 BMRB 18654 WWPDB D_1000102936 # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 18654 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LWZ _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-08-09 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Weiss, M.A.' 1 'Yang, Y.' 2 # _citation.id primary _citation.title 'Dynamic repair of an amyloidogenic protein: Insulin fibrillation is blocked by tethering a nascent alpha-helix' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Yang, Y.' 1 primary 'Wan, Z.' 2 primary 'Hua, Q.' 3 primary 'Phillips, N.B.' 4 primary 'Huang, K.' 5 primary 'Yeh, I.' 6 primary 'Liu, Y.' 7 primary 'Hu, S.' 8 primary 'Hattier, T.' 9 primary 'Whittaker, J.' 10 primary 'Weiss, M.A.' 11 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'SINGLE-CHAIN INSULIN' _entity.formula_weight 6382.185 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name Insulin # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code FVNQHLCGSDLVEALYLVCGERGFFYTDPTGGGPRRGIVEQCCHSICSLYQLENYCN _entity_poly.pdbx_seq_one_letter_code_can FVNQHLCGSDLVEALYLVCGERGFFYTDPTGGGPRRGIVEQCCHSICSLYQLENYCN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PHE n 1 2 VAL n 1 3 ASN n 1 4 GLN n 1 5 HIS n 1 6 LEU n 1 7 CYS n 1 8 GLY n 1 9 SER n 1 10 ASP n 1 11 LEU n 1 12 VAL n 1 13 GLU n 1 14 ALA n 1 15 LEU n 1 16 TYR n 1 17 LEU n 1 18 VAL n 1 19 CYS n 1 20 GLY n 1 21 GLU n 1 22 ARG n 1 23 GLY n 1 24 PHE n 1 25 PHE n 1 26 TYR n 1 27 THR n 1 28 ASP n 1 29 PRO n 1 30 THR n 1 31 GLY n 1 32 GLY n 1 33 GLY n 1 34 PRO n 1 35 ARG n 1 36 ARG n 1 37 GLY n 1 38 ILE n 1 39 VAL n 1 40 GLU n 1 41 GLN n 1 42 CYS n 1 43 CYS n 1 44 HIS n 1 45 SER n 1 46 ILE n 1 47 CYS n 1 48 SER n 1 49 LEU n 1 50 TYR n 1 51 GLN n 1 52 LEU n 1 53 GLU n 1 54 ASN n 1 55 TYR n 1 56 CYS n 1 57 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene INS _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'Pichia pastoris' _entity_src_gen.pdbx_host_org_scientific_name 'Komagataella pastoris' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pPICz _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP INS_HUMAN P01308 1 FVNQHLCGSHLVEALYLVCGERGFFYTPKT 25 ? 2 UNP INS_HUMAN P01308 1 RGIVEQCCTSICSLYQLENYCN 89 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2LWZ A 1 ? 30 ? P01308 25 ? 54 ? 1 30 2 2 2LWZ A 36 ? 57 ? P01308 89 ? 110 ? 36 57 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LWZ ASP A 10 ? UNP P01308 HIS 34 CONFLICT 10 1 1 2LWZ ASP A 28 ? UNP P01308 PRO 52 CONFLICT 28 2 1 2LWZ PRO A 29 ? UNP P01308 LYS 53 CONFLICT 29 3 1 2LWZ GLY A 31 ? UNP P01308 ? ? linker 31 4 1 2LWZ GLY A 32 ? UNP P01308 ? ? linker 32 5 1 2LWZ GLY A 33 ? UNP P01308 ? ? linker 33 6 1 2LWZ PRO A 34 ? UNP P01308 ? ? linker 34 7 1 2LWZ ARG A 35 ? UNP P01308 ? ? linker 35 8 2 2LWZ HIS A 44 ? UNP P01308 THR 97 CONFLICT 44 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCACB' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCO' 1 6 1 '3D C(CO)NH' 1 7 1 '3D H(CCO)NH' 1 8 1 '3D HCCH-TOCSY' 1 9 1 '3D 1H-15N NOESY' 1 10 1 '4D Time-shared NOESY (4D-N15,C13-edited and 4D-C13,C13-edited NOESY)' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.9 mM [U-100% 13C; U-100% 15N] insulin, 93% H2O/7% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '93% H2O/7% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker Avance 1 'Bruker Avance' 700 Bruker Avance 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LWZ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with acceptable covalent geometry' _pdbx_nmr_ensemble.conformers_calculated_total_number 70 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LWZ _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LWZ _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' X-PLOR_NIH ? 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'data analysis' NMRDraw ? 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 3 Garrett 'peak picking' PIPP ? 4 'Bruker Biospin' collection xwinnmr ? 5 'Accelrys Software Inc.' 'data analysis' InsightII ? 6 'Koradi, Billeter and Wuthrich' 'structure display' Molmol ? 7 'Schwieters, Kuszewski, Tjandra and Clore' refinement X-PLOR_NIH ? 8 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LWZ _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LWZ _struct.title 'NMR Structures of Single-chain Insulin' _struct.pdbx_descriptor 'SINGLE-CHAIN INSULIN' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LWZ _struct_keywords.pdbx_keywords HORMONE _struct_keywords.text 'Single chain Insulin, HORMONE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 8 ? GLY A 20 ? GLY A 8 GLY A 20 1 ? 13 HELX_P HELX_P2 2 GLU A 21 ? GLY A 23 ? GLU A 21 GLY A 23 5 ? 3 HELX_P HELX_P3 3 ILE A 38 ? SER A 45 ? ILE A 38 SER A 45 1 ? 8 HELX_P HELX_P4 4 SER A 48 ? GLU A 53 ? SER A 48 GLU A 53 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 43 SG ? ? A CYS 7 A CYS 43 1_555 ? ? ? ? ? ? ? 2.021 ? disulf2 disulf ? ? A CYS 19 SG ? ? ? 1_555 A CYS 56 SG ? ? A CYS 19 A CYS 56 1_555 ? ? ? ? ? ? ? 2.020 ? disulf3 disulf ? ? A CYS 42 SG ? ? ? 1_555 A CYS 47 SG ? ? A CYS 42 A CYS 47 1_555 ? ? ? ? ? ? ? 2.018 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 2LWZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PHE 1 1 1 PHE PHE A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 ASN 57 57 57 ASN ASN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2013-08-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.0273 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.0061 _pdbx_nmr_ensemble_rms.entry_id 2LWZ _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_exptl_sample.component Insulin-1 _pdbx_nmr_exptl_sample.concentration 0.9 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LWZ _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1048 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 392 _pdbx_nmr_constraints.NOE_long_range_total_count 203 _pdbx_nmr_constraints.NOE_medium_range_total_count 220 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 233 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 54 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 54 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A VAL 39 ? ? H A CYS 43 ? ? 1.56 2 3 O A VAL 39 ? ? H A CYS 43 ? ? 1.59 3 5 O A VAL 39 ? ? H A CYS 43 ? ? 1.60 4 6 O A VAL 39 ? ? H A CYS 43 ? ? 1.59 5 8 O A VAL 39 ? ? H A CYS 43 ? ? 1.59 6 9 O A VAL 39 ? ? H A CYS 43 ? ? 1.59 7 10 O A VAL 39 ? ? H A CYS 43 ? ? 1.59 8 12 HG1 A THR 27 ? ? H A ASP 28 ? ? 1.35 9 12 O A VAL 39 ? ? H A CYS 43 ? ? 1.58 10 14 O A VAL 39 ? ? H A CYS 43 ? ? 1.57 11 15 O A VAL 39 ? ? H A CYS 43 ? ? 1.58 12 16 O A VAL 39 ? ? H A CYS 43 ? ? 1.58 13 17 O A VAL 39 ? ? H A CYS 43 ? ? 1.59 14 18 O A VAL 39 ? ? H A CYS 43 ? ? 1.60 15 19 O A VAL 39 ? ? H A CYS 43 ? ? 1.58 16 20 O A VAL 39 ? ? H A CYS 43 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 2 ? ? -103.13 -91.60 2 1 ASP A 28 ? ? -43.52 150.22 3 1 PRO A 34 ? ? -68.75 -174.14 4 1 ARG A 35 ? ? -56.23 86.92 5 1 ARG A 36 ? ? -59.15 -2.48 6 2 VAL A 2 ? ? -101.61 -91.93 7 2 ASP A 28 ? ? -43.58 150.74 8 2 ARG A 35 ? ? -61.53 85.48 9 3 VAL A 2 ? ? -105.13 -91.88 10 3 PRO A 34 ? ? -68.86 -175.19 11 3 ARG A 35 ? ? -58.04 86.47 12 3 ARG A 36 ? ? -59.75 -2.01 13 4 VAL A 2 ? ? -101.92 -91.69 14 4 ARG A 35 ? ? -57.90 86.67 15 4 ARG A 36 ? ? -59.37 -6.24 16 5 VAL A 2 ? ? -99.55 -91.51 17 5 PRO A 34 ? ? -69.52 -175.54 18 5 ARG A 35 ? ? -59.68 86.45 19 6 VAL A 2 ? ? -102.38 -91.65 20 6 ARG A 35 ? ? -56.67 86.30 21 6 ARG A 36 ? ? -60.10 0.16 22 7 VAL A 2 ? ? -94.70 -91.36 23 7 ASP A 28 ? ? -42.29 150.38 24 7 ARG A 35 ? ? -57.60 86.90 25 8 VAL A 2 ? ? -98.32 -91.29 26 8 PRO A 34 ? ? -69.48 -175.29 27 8 ARG A 35 ? ? -56.68 86.02 28 8 ARG A 36 ? ? -60.63 0.66 29 9 VAL A 2 ? ? -104.39 -91.67 30 9 PRO A 34 ? ? -69.51 -175.58 31 9 ARG A 35 ? ? -57.34 85.86 32 9 ARG A 36 ? ? -59.64 -6.81 33 10 VAL A 2 ? ? -100.28 -91.42 34 10 ARG A 35 ? ? -60.49 86.93 35 10 ARG A 36 ? ? -59.31 -2.98 36 11 VAL A 2 ? ? -101.13 -91.75 37 11 PRO A 34 ? ? -69.96 -175.62 38 11 ARG A 35 ? ? -58.96 86.08 39 11 ARG A 36 ? ? -59.57 -5.49 40 12 VAL A 2 ? ? -102.73 -91.99 41 12 PRO A 34 ? ? -67.81 -173.95 42 12 ARG A 35 ? ? -56.24 87.10 43 12 ARG A 36 ? ? -58.99 -1.55 44 13 VAL A 2 ? ? -102.85 -91.78 45 13 PRO A 34 ? ? -69.39 -175.44 46 13 ARG A 35 ? ? -59.84 86.19 47 13 ARG A 36 ? ? -61.58 3.08 48 14 VAL A 2 ? ? -101.99 -91.75 49 14 PRO A 34 ? ? -69.17 -174.46 50 14 ARG A 35 ? ? -56.34 86.52 51 14 ARG A 36 ? ? -59.61 -1.73 52 15 VAL A 2 ? ? -104.04 -91.78 53 15 ARG A 35 ? ? -57.05 86.26 54 15 ARG A 36 ? ? -62.25 6.31 55 16 VAL A 2 ? ? -103.00 -91.83 56 16 PRO A 34 ? ? -68.82 -174.71 57 16 ARG A 35 ? ? -57.46 87.93 58 16 ARG A 36 ? ? -59.10 -5.88 59 17 VAL A 2 ? ? -99.77 -91.57 60 17 ARG A 35 ? ? -63.40 87.93 61 18 VAL A 2 ? ? -104.50 -91.78 62 18 ASP A 28 ? ? -43.51 151.87 63 18 ARG A 35 ? ? -57.01 85.95 64 19 VAL A 2 ? ? -102.60 -91.58 65 19 PRO A 34 ? ? -69.98 -174.61 66 19 ARG A 35 ? ? -60.31 89.18 67 20 VAL A 2 ? ? -98.57 -91.70 68 20 PRO A 34 ? ? -69.29 -175.03 69 20 ARG A 35 ? ? -56.93 86.58 70 20 ARG A 36 ? ? -59.71 -1.72 #