data_2M0U # _entry.id 2M0U # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M0U pdb_00002m0u 10.2210/pdb2m0u/pdb RCSB RCSB103066 ? ? BMRB 18825 ? 10.13018/BMR18825 WWPDB D_1000103066 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-04-24 2 'Structure model' 1 1 2013-05-01 3 'Structure model' 1 2 2013-06-26 4 'Structure model' 1 3 2013-07-17 5 'Structure model' 1 4 2023-06-14 6 'Structure model' 1 5 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' Other 7 6 'Structure model' 'Data collection' 8 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' database_2 2 5 'Structure model' pdbx_database_status 3 5 'Structure model' pdbx_nmr_software 4 5 'Structure model' pdbx_nmr_spectrometer 5 5 'Structure model' struct_ref_seq_dif 6 6 'Structure model' chem_comp_atom 7 6 'Structure model' chem_comp_bond 8 6 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 5 'Structure model' '_pdbx_nmr_software.name' 5 5 'Structure model' '_pdbx_nmr_spectrometer.model' 6 5 'Structure model' '_struct_ref_seq_dif.details' 7 6 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M0U _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-11-06 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 18825 BMRB unspecified . 2M0T PDB unspecified . 2M0V PDB unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bhattacharya, S.' 1 'Ju, J.H.' 2 'Cowburn, D.' 3 'Bu, Z.' 4 # _citation.id primary _citation.title 'Ligand-Induced Dynamic Changes in Extended PDZ Domains from NHERF1.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 425 _citation.page_first 2509 _citation.page_last 2528 _citation.year 2013 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23583913 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2013.04.001 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bhattacharya, S.' 1 ? primary 'Ju, J.H.' 2 ? primary 'Orlova, N.' 3 ? primary 'Khajeh, J.A.' 4 ? primary 'Cowburn, D.' 5 ? primary 'Bu, Z.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Na(+)/H(+) exchange regulatory cofactor NHE-RF1' 12822.609 1 ? ? ? ? 2 polymer syn 'C-terminal CFTR peptide' 632.687 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;NHERF-1, Ezrin-radixin-moesin-binding phosphoprotein 50, EBP50, Regulatory cofactor of Na(+)/H(+) exchanger, Sodium-hydrogen exchanger regulatory factor 1, Solute carrier family 9 isoform A3 regulatory factor 1 ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GIDPFTMLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAAL NAVRLLVVDPETDEQLQKLGVQVREELLRAQEAPGQA ; ;GIDPFTMLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAAL NAVRLLVVDPETDEQLQKLGVQVREELLRAQEAPGQA ; A ? 2 'polypeptide(L)' no no QDTRL QDTRL B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ILE n 1 3 ASP n 1 4 PRO n 1 5 PHE n 1 6 THR n 1 7 MET n 1 8 LEU n 1 9 PRO n 1 10 ARG n 1 11 LEU n 1 12 CYS n 1 13 CYS n 1 14 LEU n 1 15 GLU n 1 16 LYS n 1 17 GLY n 1 18 PRO n 1 19 ASN n 1 20 GLY n 1 21 TYR n 1 22 GLY n 1 23 PHE n 1 24 HIS n 1 25 LEU n 1 26 HIS n 1 27 GLY n 1 28 GLU n 1 29 LYS n 1 30 GLY n 1 31 LYS n 1 32 LEU n 1 33 GLY n 1 34 GLN n 1 35 TYR n 1 36 ILE n 1 37 ARG n 1 38 LEU n 1 39 VAL n 1 40 GLU n 1 41 PRO n 1 42 GLY n 1 43 SER n 1 44 PRO n 1 45 ALA n 1 46 GLU n 1 47 LYS n 1 48 ALA n 1 49 GLY n 1 50 LEU n 1 51 LEU n 1 52 ALA n 1 53 GLY n 1 54 ASP n 1 55 ARG n 1 56 LEU n 1 57 VAL n 1 58 GLU n 1 59 VAL n 1 60 ASN n 1 61 GLY n 1 62 GLU n 1 63 ASN n 1 64 VAL n 1 65 GLU n 1 66 LYS n 1 67 GLU n 1 68 THR n 1 69 HIS n 1 70 GLN n 1 71 GLN n 1 72 VAL n 1 73 VAL n 1 74 SER n 1 75 ARG n 1 76 ILE n 1 77 ARG n 1 78 ALA n 1 79 ALA n 1 80 LEU n 1 81 ASN n 1 82 ALA n 1 83 VAL n 1 84 ARG n 1 85 LEU n 1 86 LEU n 1 87 VAL n 1 88 VAL n 1 89 ASP n 1 90 PRO n 1 91 GLU n 1 92 THR n 1 93 ASP n 1 94 GLU n 1 95 GLN n 1 96 LEU n 1 97 GLN n 1 98 LYS n 1 99 LEU n 1 100 GLY n 1 101 VAL n 1 102 GLN n 1 103 VAL n 1 104 ARG n 1 105 GLU n 1 106 GLU n 1 107 LEU n 1 108 LEU n 1 109 ARG n 1 110 ALA n 1 111 GLN n 1 112 GLU n 1 113 ALA n 1 114 PRO n 1 115 GLY n 1 116 GLN n 1 117 ALA n 2 1 GLN n 2 2 ASP n 2 3 THR n 2 4 ARG n 2 5 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SLC9A3R1, NHERF, NHERF1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Rosetta 2 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET151/D-TOPO _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 4 4 GLY GLY A . n A 1 2 ILE 2 5 5 ILE ILE A . n A 1 3 ASP 3 6 6 ASP ASP A . n A 1 4 PRO 4 7 7 PRO PRO A . n A 1 5 PHE 5 8 8 PHE PHE A . n A 1 6 THR 6 9 9 THR THR A . n A 1 7 MET 7 10 10 MET MET A . n A 1 8 LEU 8 11 11 LEU LEU A . n A 1 9 PRO 9 12 12 PRO PRO A . n A 1 10 ARG 10 13 13 ARG ARG A . n A 1 11 LEU 11 14 14 LEU LEU A . n A 1 12 CYS 12 15 15 CYS CYS A . n A 1 13 CYS 13 16 16 CYS CYS A . n A 1 14 LEU 14 17 17 LEU LEU A . n A 1 15 GLU 15 18 18 GLU GLU A . n A 1 16 LYS 16 19 19 LYS LYS A . n A 1 17 GLY 17 20 20 GLY GLY A . n A 1 18 PRO 18 21 21 PRO PRO A . n A 1 19 ASN 19 22 22 ASN ASN A . n A 1 20 GLY 20 23 23 GLY GLY A . n A 1 21 TYR 21 24 24 TYR TYR A . n A 1 22 GLY 22 25 25 GLY GLY A . n A 1 23 PHE 23 26 26 PHE PHE A . n A 1 24 HIS 24 27 27 HIS HIS A . n A 1 25 LEU 25 28 28 LEU LEU A . n A 1 26 HIS 26 29 29 HIS HIS A . n A 1 27 GLY 27 30 30 GLY GLY A . n A 1 28 GLU 28 31 31 GLU GLU A . n A 1 29 LYS 29 32 32 LYS LYS A . n A 1 30 GLY 30 33 33 GLY GLY A . n A 1 31 LYS 31 34 34 LYS LYS A . n A 1 32 LEU 32 35 35 LEU LEU A . n A 1 33 GLY 33 36 36 GLY GLY A . n A 1 34 GLN 34 37 37 GLN GLN A . n A 1 35 TYR 35 38 38 TYR TYR A . n A 1 36 ILE 36 39 39 ILE ILE A . n A 1 37 ARG 37 40 40 ARG ARG A . n A 1 38 LEU 38 41 41 LEU LEU A . n A 1 39 VAL 39 42 42 VAL VAL A . n A 1 40 GLU 40 43 43 GLU GLU A . n A 1 41 PRO 41 44 44 PRO PRO A . n A 1 42 GLY 42 45 45 GLY GLY A . n A 1 43 SER 43 46 46 SER SER A . n A 1 44 PRO 44 47 47 PRO PRO A . n A 1 45 ALA 45 48 48 ALA ALA A . n A 1 46 GLU 46 49 49 GLU GLU A . n A 1 47 LYS 47 50 50 LYS LYS A . n A 1 48 ALA 48 51 51 ALA ALA A . n A 1 49 GLY 49 52 52 GLY GLY A . n A 1 50 LEU 50 53 53 LEU LEU A . n A 1 51 LEU 51 54 54 LEU LEU A . n A 1 52 ALA 52 55 55 ALA ALA A . n A 1 53 GLY 53 56 56 GLY GLY A . n A 1 54 ASP 54 57 57 ASP ASP A . n A 1 55 ARG 55 58 58 ARG ARG A . n A 1 56 LEU 56 59 59 LEU LEU A . n A 1 57 VAL 57 60 60 VAL VAL A . n A 1 58 GLU 58 61 61 GLU GLU A . n A 1 59 VAL 59 62 62 VAL VAL A . n A 1 60 ASN 60 63 63 ASN ASN A . n A 1 61 GLY 61 64 64 GLY GLY A . n A 1 62 GLU 62 65 65 GLU GLU A . n A 1 63 ASN 63 66 66 ASN ASN A . n A 1 64 VAL 64 67 67 VAL VAL A . n A 1 65 GLU 65 68 68 GLU GLU A . n A 1 66 LYS 66 69 69 LYS LYS A . n A 1 67 GLU 67 70 70 GLU GLU A . n A 1 68 THR 68 71 71 THR THR A . n A 1 69 HIS 69 72 72 HIS HIS A . n A 1 70 GLN 70 73 73 GLN GLN A . n A 1 71 GLN 71 74 74 GLN GLN A . n A 1 72 VAL 72 75 75 VAL VAL A . n A 1 73 VAL 73 76 76 VAL VAL A . n A 1 74 SER 74 77 77 SER SER A . n A 1 75 ARG 75 78 78 ARG ARG A . n A 1 76 ILE 76 79 79 ILE ILE A . n A 1 77 ARG 77 80 80 ARG ARG A . n A 1 78 ALA 78 81 81 ALA ALA A . n A 1 79 ALA 79 82 82 ALA ALA A . n A 1 80 LEU 80 83 83 LEU LEU A . n A 1 81 ASN 81 84 84 ASN ASN A . n A 1 82 ALA 82 85 85 ALA ALA A . n A 1 83 VAL 83 86 86 VAL VAL A . n A 1 84 ARG 84 87 87 ARG ARG A . n A 1 85 LEU 85 88 88 LEU LEU A . n A 1 86 LEU 86 89 89 LEU LEU A . n A 1 87 VAL 87 90 90 VAL VAL A . n A 1 88 VAL 88 91 91 VAL VAL A . n A 1 89 ASP 89 92 92 ASP ASP A . n A 1 90 PRO 90 93 93 PRO PRO A . n A 1 91 GLU 91 94 94 GLU GLU A . n A 1 92 THR 92 95 95 THR THR A . n A 1 93 ASP 93 96 96 ASP ASP A . n A 1 94 GLU 94 97 97 GLU GLU A . n A 1 95 GLN 95 98 98 GLN GLN A . n A 1 96 LEU 96 99 99 LEU LEU A . n A 1 97 GLN 97 100 100 GLN GLN A . n A 1 98 LYS 98 101 101 LYS LYS A . n A 1 99 LEU 99 102 102 LEU LEU A . n A 1 100 GLY 100 103 103 GLY GLY A . n A 1 101 VAL 101 104 104 VAL VAL A . n A 1 102 GLN 102 105 105 GLN GLN A . n A 1 103 VAL 103 106 106 VAL VAL A . n A 1 104 ARG 104 107 107 ARG ARG A . n A 1 105 GLU 105 108 108 GLU GLU A . n A 1 106 GLU 106 109 109 GLU GLU A . n A 1 107 LEU 107 110 110 LEU LEU A . n A 1 108 LEU 108 111 111 LEU LEU A . n A 1 109 ARG 109 112 112 ARG ARG A . n A 1 110 ALA 110 113 113 ALA ALA A . n A 1 111 GLN 111 114 114 GLN GLN A . n A 1 112 GLU 112 115 115 GLU GLU A . n A 1 113 ALA 113 116 116 ALA ALA A . n A 1 114 PRO 114 117 117 PRO PRO A . n A 1 115 GLY 115 118 118 GLY GLY A . n A 1 116 GLN 116 119 119 GLN GLN A . n A 1 117 ALA 117 120 120 ALA ALA A . n B 2 1 GLN 1 1 1 GLN GLN B . n B 2 2 ASP 2 2 2 ASP ASP B . n B 2 3 THR 3 3 3 THR THR B . n B 2 4 ARG 4 4 4 ARG ARG B . n B 2 5 LEU 5 5 5 LEU LEU B . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M0U _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M0U _struct.title 'Complex structure of C-terminal CFTR peptide and extended PDZ1 domain from NHERF1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M0U _struct_keywords.pdbx_keywords 'PEPTIDE BINDING PROTEIN/PROTEIN BINDING' _struct_keywords.text 'PDZ domain, PEPTIDE BINDING PROTEIN-PROTEIN BINDING complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP NHRF1_HUMAN O14745 1 ;LPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLV VDPETDEQLQKLGVQVREELLRAQEAPGQA ; 11 ? 2 PDB 2M0U 2M0U 2 ? ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2M0U A 8 ? 117 ? O14745 11 ? 120 ? 11 120 2 2 2M0U B 1 ? 5 ? 2M0U 1 ? 5 ? 1 5 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2M0U GLY A 1 ? UNP O14745 ? ? 'expression tag' 4 1 1 2M0U ILE A 2 ? UNP O14745 ? ? 'expression tag' 5 2 1 2M0U ASP A 3 ? UNP O14745 ? ? 'expression tag' 6 3 1 2M0U PRO A 4 ? UNP O14745 ? ? 'expression tag' 7 4 1 2M0U PHE A 5 ? UNP O14745 ? ? 'expression tag' 8 5 1 2M0U THR A 6 ? UNP O14745 ? ? 'expression tag' 9 6 1 2M0U MET A 7 ? UNP O14745 ? ? 'expression tag' 10 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 43 ? ALA A 48 ? SER A 46 ALA A 51 1 ? 6 HELX_P HELX_P2 2 THR A 68 ? ALA A 78 ? THR A 71 ALA A 81 1 ? 11 HELX_P HELX_P3 3 ASP A 89 ? GLY A 100 ? ASP A 92 GLY A 103 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 10 ? GLU A 15 ? ARG A 13 GLU A 18 A 2 ALA A 82 ? VAL A 88 ? ALA A 85 VAL A 91 A 3 ARG A 55 ? VAL A 59 ? ARG A 58 VAL A 62 A 4 GLU A 62 ? ASN A 63 ? GLU A 65 ASN A 66 B 1 GLN A 34 ? VAL A 39 ? GLN A 37 VAL A 42 B 2 PHE A 23 ? GLY A 27 ? PHE A 26 GLY A 30 B 3 THR B 3 ? ARG B 4 ? THR B 3 ARG B 4 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N CYS A 12 ? N CYS A 15 O LEU A 85 ? O LEU A 88 A 2 3 O VAL A 88 ? O VAL A 91 N ARG A 55 ? N ARG A 58 A 3 4 N VAL A 59 ? N VAL A 62 O GLU A 62 ? O GLU A 65 B 1 2 O LEU A 38 ? O LEU A 41 N HIS A 24 ? N HIS A 27 B 2 3 N LEU A 25 ? N LEU A 28 O THR B 3 ? O THR B 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 HD1 A HIS 27 ? ? OD2 B ASP 2 ? ? 1.59 2 4 OD2 A ASP 92 ? ? HG1 A THR 95 ? ? 1.55 3 5 HH21 A ARG 40 ? ? OD2 B ASP 2 ? ? 1.59 4 8 HD1 A HIS 27 ? ? OD1 B ASP 2 ? ? 1.60 5 9 HB2 A MET 10 ? ? HG21 A THR 95 ? ? 1.33 6 9 H A GLY 25 ? ? OXT B LEU 5 ? ? 1.59 7 10 HD1 A HIS 27 ? ? OD1 B ASP 2 ? ? 1.57 8 10 HE2 A HIS 29 ? ? OD2 B ASP 2 ? ? 1.58 9 11 HD23 A LEU 35 ? ? HZ2 A LYS 69 ? ? 1.32 10 11 H A GLY 25 ? ? OXT B LEU 5 ? ? 1.58 11 12 OE1 A GLU 70 ? ? HH21 A ARG 78 ? ? 1.58 12 13 HB3 A MET 10 ? ? HG12 A VAL 106 ? ? 1.20 13 13 HZ3 A LYS 19 ? ? HA2 A GLY 23 ? ? 1.33 14 14 OE1 A GLU 18 ? ? HZ1 A LYS 50 ? ? 1.57 15 14 OE2 A GLU 68 ? ? HZ1 A LYS 69 ? ? 1.60 16 16 HB3 A MET 10 ? ? HG22 A THR 95 ? ? 1.34 17 17 HB3 A GLU 61 ? ? HA A ASN 66 ? ? 1.22 18 18 HB3 A MET 10 ? ? HG21 A THR 95 ? ? 1.32 19 19 HD1 A HIS 27 ? ? OD1 B ASP 2 ? ? 1.59 20 20 HE2 A HIS 72 ? ? OD1 B ASP 2 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 7 ? ? -68.92 -174.49 2 1 MET A 10 ? ? -170.81 68.63 3 1 LEU A 11 ? ? -146.11 59.41 4 1 ASN A 22 ? ? -147.26 25.15 5 1 LYS A 34 ? ? -141.14 -71.05 6 1 ALA A 55 ? ? -83.24 38.19 7 1 ASN A 84 ? ? -108.73 -63.36 8 1 GLU A 108 ? ? -146.15 -27.79 9 1 ALA A 113 ? ? -76.51 -154.65 10 1 ASP B 2 ? ? 64.24 -170.88 11 2 THR A 9 ? ? -128.69 -164.90 12 2 MET A 10 ? ? 74.33 -66.11 13 2 LEU A 11 ? ? 55.06 85.08 14 2 ASN A 22 ? ? -157.02 33.48 15 2 LYS A 32 ? ? -61.94 96.48 16 2 ASN A 84 ? ? -131.65 -58.51 17 2 GLN A 105 ? ? 73.06 -50.14 18 2 GLU A 108 ? ? 174.36 -33.30 19 2 GLU A 115 ? ? 76.54 120.10 20 2 ASP B 2 ? ? 63.57 80.80 21 3 ASN A 22 ? ? -150.86 33.32 22 3 LYS A 34 ? ? -123.72 -67.56 23 3 ASN A 84 ? ? -145.48 -34.92 24 3 GLU A 108 ? ? -146.66 -26.38 25 3 ALA A 113 ? ? -45.23 108.09 26 3 GLU A 115 ? ? 65.46 120.31 27 3 GLN A 119 ? ? -170.14 -7.99 28 4 MET A 10 ? ? 71.55 -74.55 29 4 LEU A 11 ? ? 59.15 93.29 30 4 LYS A 32 ? ? 74.68 -21.65 31 4 ASN A 84 ? ? -144.13 -52.32 32 4 GLU A 108 ? ? -143.85 -50.78 33 5 MET A 10 ? ? 76.27 -57.35 34 5 LEU A 11 ? ? 58.86 79.96 35 5 LYS A 32 ? ? -67.96 93.29 36 5 ALA A 55 ? ? -81.26 44.56 37 5 LEU A 83 ? ? -82.04 -70.76 38 5 GLU A 108 ? ? -121.87 -57.44 39 5 ALA A 113 ? ? 66.25 169.90 40 5 ASP B 2 ? ? 70.34 126.65 41 6 LYS A 34 ? ? -118.21 -70.33 42 6 ASN A 84 ? ? -142.49 -48.25 43 6 GLN A 105 ? ? -93.68 46.32 44 7 ASN A 22 ? ? -154.60 25.41 45 7 LYS A 34 ? ? -125.07 -60.35 46 7 ASN A 63 ? ? 66.42 -69.56 47 7 ASN A 84 ? ? 74.95 -58.74 48 7 GLN A 105 ? ? -99.62 31.44 49 7 GLU A 108 ? ? -132.36 -46.04 50 8 LYS A 34 ? ? -135.20 -71.83 51 8 ASN A 84 ? ? -133.15 -60.89 52 8 GLU A 108 ? ? -127.63 -59.10 53 8 ALA A 113 ? ? 63.99 174.24 54 9 MET A 10 ? ? 71.53 -48.98 55 9 LEU A 11 ? ? 62.33 84.23 56 9 ASN A 22 ? ? -141.51 26.44 57 9 ALA A 55 ? ? -83.66 37.38 58 9 ASN A 84 ? ? 71.83 -60.49 59 9 GLN A 105 ? ? -82.22 31.59 60 9 GLU A 108 ? ? -141.24 -9.88 61 9 ARG A 112 ? ? -106.14 54.65 62 9 ASP B 2 ? ? -88.95 -78.55 63 10 PRO A 7 ? ? -59.42 171.14 64 10 LYS A 32 ? ? 72.16 -52.36 65 10 LYS A 34 ? ? -139.22 -73.95 66 10 ASN A 84 ? ? -158.01 -62.72 67 10 GLU A 108 ? ? -149.83 -41.32 68 10 ALA A 116 ? ? 65.84 82.91 69 10 ASP B 2 ? ? 74.64 121.92 70 11 ILE A 5 ? ? 52.20 173.39 71 11 PRO A 7 ? ? -75.46 23.34 72 11 MET A 10 ? ? -169.84 -94.86 73 11 LEU A 11 ? ? 52.50 72.07 74 11 ASN A 22 ? ? -140.39 22.87 75 11 LYS A 32 ? ? 88.25 -46.77 76 11 LYS A 34 ? ? -103.49 -63.35 77 11 ASN A 84 ? ? -141.04 -67.29 78 11 GLU A 108 ? ? -161.62 -40.66 79 11 ARG A 112 ? ? -80.41 48.09 80 11 ALA A 113 ? ? -107.26 75.58 81 11 GLN A 119 ? ? -161.63 100.11 82 11 ASP B 2 ? ? -88.51 -151.03 83 12 MET A 10 ? ? -177.43 24.52 84 12 LYS A 34 ? ? -126.20 -67.40 85 12 ASN A 63 ? ? 67.29 -69.79 86 12 ASN A 84 ? ? -145.66 -48.91 87 12 GLU A 108 ? ? -133.37 -33.65 88 12 ALA A 113 ? ? 73.24 128.95 89 12 ASP B 2 ? ? 69.69 145.82 90 13 THR A 9 ? ? -89.08 -116.64 91 13 LEU A 11 ? ? -152.38 57.77 92 13 ASN A 22 ? ? -152.41 46.97 93 13 LYS A 34 ? ? -134.90 -60.25 94 13 ASN A 63 ? ? 73.19 -39.51 95 13 LEU A 83 ? ? 71.77 -17.72 96 13 ASN A 84 ? ? -149.32 -54.37 97 13 LEU A 102 ? ? -110.33 -80.12 98 13 GLN A 105 ? ? 72.93 -42.24 99 13 GLU A 108 ? ? -164.18 -38.22 100 13 ALA A 116 ? ? 56.53 70.67 101 14 LYS A 34 ? ? -133.43 -67.11 102 14 ALA A 55 ? ? -84.03 43.97 103 14 ASN A 84 ? ? -136.04 -47.75 104 14 GLU A 108 ? ? -108.03 -60.93 105 14 ALA A 113 ? ? 66.81 175.70 106 14 GLU A 115 ? ? 63.37 111.27 107 14 PRO A 117 ? ? -58.78 96.70 108 15 ILE A 5 ? ? 45.11 -168.54 109 15 PRO A 7 ? ? -57.86 172.93 110 15 MET A 10 ? ? 75.01 -56.77 111 15 LEU A 11 ? ? 67.90 98.92 112 15 ASN A 22 ? ? -149.16 20.50 113 15 LEU A 83 ? ? -81.26 -72.35 114 15 LEU A 102 ? ? -71.41 -84.70 115 15 GLU A 108 ? ? -148.06 -22.53 116 15 GLU A 115 ? ? 67.10 122.57 117 16 ILE A 5 ? ? 47.04 -174.31 118 16 PRO A 7 ? ? -65.42 27.44 119 16 PHE A 8 ? ? 55.96 -92.06 120 16 THR A 9 ? ? 51.66 167.49 121 16 LYS A 34 ? ? -108.77 -63.21 122 16 ASN A 63 ? ? 68.25 -25.64 123 16 ASN A 84 ? ? -145.68 -53.99 124 16 LEU A 102 ? ? -62.66 -73.29 125 16 GLU A 108 ? ? -137.44 -58.03 126 16 ALA A 113 ? ? 67.58 128.40 127 17 PHE A 8 ? ? 50.04 76.24 128 17 MET A 10 ? ? 58.33 72.24 129 17 LYS A 34 ? ? -117.21 -71.75 130 17 ALA A 55 ? ? -65.57 83.84 131 17 ASN A 63 ? ? 65.34 -73.02 132 17 ASN A 84 ? ? -171.66 -48.39 133 17 GLU A 108 ? ? -155.61 -32.57 134 17 ASP B 2 ? ? -107.93 -167.47 135 18 ASN A 22 ? ? -155.43 30.56 136 18 LYS A 32 ? ? -170.54 -73.56 137 18 LYS A 34 ? ? -95.31 -68.38 138 18 ASN A 84 ? ? -148.06 -65.22 139 18 GLN A 105 ? ? 34.52 62.93 140 18 ALA A 116 ? ? 54.93 88.67 141 18 PRO A 117 ? ? -66.62 78.74 142 19 LEU A 11 ? ? -152.71 63.78 143 19 LYS A 19 ? ? -58.96 101.23 144 19 ASN A 22 ? ? -147.78 34.28 145 19 LYS A 32 ? ? 55.48 135.98 146 19 LYS A 34 ? ? -124.46 -51.87 147 19 ASN A 63 ? ? 67.55 -67.79 148 19 ASN A 84 ? ? -123.97 -60.15 149 19 ARG A 112 ? ? -110.41 52.98 150 19 ALA A 113 ? ? -79.18 21.07 151 19 GLU A 115 ? ? 67.77 146.02 152 19 ALA A 116 ? ? 53.62 71.24 153 20 MET A 10 ? ? 161.49 -25.30 154 20 LEU A 11 ? ? -58.70 105.41 155 20 ASN A 22 ? ? -140.84 42.99 156 20 LYS A 34 ? ? -107.28 -69.88 157 20 ALA A 55 ? ? -87.73 40.96 158 20 LEU A 83 ? ? 71.62 -81.63 159 20 GLU A 108 ? ? -163.29 -49.29 160 20 ALA A 113 ? ? -152.88 34.40 161 20 GLU A 115 ? ? 62.08 95.23 162 20 ASP B 2 ? ? -111.54 -147.72 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 1000 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M0U _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M0U _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.contents '286 uM [U-99% 13C; U-99% 15N] PDZ1, 20 mM TRIS, 150 mM sodium chloride, 0.5 mM DTT, 0.5 mM EDTA, 275 uM CFTR, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id PDZ1-1 286 ? uM '[U-99% 13C; U-99% 15N]' 1 TRIS-2 20 ? mM ? 1 'sodium chloride-3' 150 ? mM ? 1 DTT-4 0.5 ? mM ? 1 EDTA-5 0.5 ? mM ? 1 CFTR-6 275 ? uM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 288 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC aliphatic' 1 3 1 '2D 1H-13C HSQC aromatic' 1 4 1 '3D 1H-15N NOESY' 1 5 1 '3D 1H-13C NOESY aliphatic' 1 6 1 '3D 1H-13C NOESY aromatic' 1 7 1 '3D HNCA' 1 8 1 '3D CBCA(CO)NH' 1 9 1 '3D HBHA(CO)NH' 1 10 1 '3D HNCACB' 1 11 1 '3D HNCO' 1 12 1 '3D HCCH-TOCSY' 1 13 1 '4D 13C,15N NOESY' 1 14 1 '4D 13C,13C NOESY aliphatic' 1 15 1 '2D 13C,15N f1,f2-filtered NOESY' 1 16 1 '2D 13C,15N f2-filtered NOESY' # _pdbx_nmr_refine.entry_id 2M0U _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin 2.1 1 'Bruker Biospin' processing TopSpin 2.1 2 'Keller and Wuthrich' 'data analysis' CARA 1.5 3 'Keller and Wuthrich' 'peak picking' CARA 1.5 4 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 5 ;Linge, O'Donoghue and Nilges ; refinement ARIA 2.2 6 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS 1.01 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 900 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' 700 Bruker AVANCE 3 'Bruker Avance' 500 Bruker AVANCE 4 'Bruker Avance' # _atom_sites.entry_id 2M0U _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_