data_2M2A # _entry.id 2M2A # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M2A pdb_00002m2a 10.2210/pdb2m2a/pdb RCSB RCSB103118 ? ? BMRB 18904 ? ? WWPDB D_1000103118 ? ? # _pdbx_database_related.db_id 18904 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M2A _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-12-17 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kovermann, M.' 1 'Weininger, U.' 2 'Balbach, J.' 3 # _citation.id primary _citation.title 'NMR solution structure of the two domain PPIase SlpA from Escherichia coli' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kovermann, M.' 1 ? primary 'Geitner, A.' 2 ? primary 'Weininger, U.' 3 ? primary 'Schmid, F.' 4 ? primary 'Balbach, J.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'FKBP-type 16 kDa peptidyl-prolyl cis-trans isomerase' _entity.formula_weight 16022.854 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 5.2.1.8 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PPIase, Rotamase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSESVQSNSAVLVHFTLKLDDGTTAESTRNNGKPALFRLGDASLSEGLEQHLLGLKVGDKTTFSLEPDAAFGVPSPDLIQ YFSRREFMDAGEPEIGAIMLFTAMDGSEMPGVIREINGDSITVDFNHPLAGQTVHFDIEVLEIDPALE ; _entity_poly.pdbx_seq_one_letter_code_can ;MSESVQSNSAVLVHFTLKLDDGTTAESTRNNGKPALFRLGDASLSEGLEQHLLGLKVGDKTTFSLEPDAAFGVPSPDLIQ YFSRREFMDAGEPEIGAIMLFTAMDGSEMPGVIREINGDSITVDFNHPLAGQTVHFDIEVLEIDPALE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLU n 1 4 SER n 1 5 VAL n 1 6 GLN n 1 7 SER n 1 8 ASN n 1 9 SER n 1 10 ALA n 1 11 VAL n 1 12 LEU n 1 13 VAL n 1 14 HIS n 1 15 PHE n 1 16 THR n 1 17 LEU n 1 18 LYS n 1 19 LEU n 1 20 ASP n 1 21 ASP n 1 22 GLY n 1 23 THR n 1 24 THR n 1 25 ALA n 1 26 GLU n 1 27 SER n 1 28 THR n 1 29 ARG n 1 30 ASN n 1 31 ASN n 1 32 GLY n 1 33 LYS n 1 34 PRO n 1 35 ALA n 1 36 LEU n 1 37 PHE n 1 38 ARG n 1 39 LEU n 1 40 GLY n 1 41 ASP n 1 42 ALA n 1 43 SER n 1 44 LEU n 1 45 SER n 1 46 GLU n 1 47 GLY n 1 48 LEU n 1 49 GLU n 1 50 GLN n 1 51 HIS n 1 52 LEU n 1 53 LEU n 1 54 GLY n 1 55 LEU n 1 56 LYS n 1 57 VAL n 1 58 GLY n 1 59 ASP n 1 60 LYS n 1 61 THR n 1 62 THR n 1 63 PHE n 1 64 SER n 1 65 LEU n 1 66 GLU n 1 67 PRO n 1 68 ASP n 1 69 ALA n 1 70 ALA n 1 71 PHE n 1 72 GLY n 1 73 VAL n 1 74 PRO n 1 75 SER n 1 76 PRO n 1 77 ASP n 1 78 LEU n 1 79 ILE n 1 80 GLN n 1 81 TYR n 1 82 PHE n 1 83 SER n 1 84 ARG n 1 85 ARG n 1 86 GLU n 1 87 PHE n 1 88 MET n 1 89 ASP n 1 90 ALA n 1 91 GLY n 1 92 GLU n 1 93 PRO n 1 94 GLU n 1 95 ILE n 1 96 GLY n 1 97 ALA n 1 98 ILE n 1 99 MET n 1 100 LEU n 1 101 PHE n 1 102 THR n 1 103 ALA n 1 104 MET n 1 105 ASP n 1 106 GLY n 1 107 SER n 1 108 GLU n 1 109 MET n 1 110 PRO n 1 111 GLY n 1 112 VAL n 1 113 ILE n 1 114 ARG n 1 115 GLU n 1 116 ILE n 1 117 ASN n 1 118 GLY n 1 119 ASP n 1 120 SER n 1 121 ILE n 1 122 THR n 1 123 VAL n 1 124 ASP n 1 125 PHE n 1 126 ASN n 1 127 HIS n 1 128 PRO n 1 129 LEU n 1 130 ALA n 1 131 GLY n 1 132 GLN n 1 133 THR n 1 134 VAL n 1 135 HIS n 1 136 PHE n 1 137 ASP n 1 138 ILE n 1 139 GLU n 1 140 VAL n 1 141 LEU n 1 142 GLU n 1 143 ILE n 1 144 ASP n 1 145 PRO n 1 146 ALA n 1 147 LEU n 1 148 GLU n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Escherichia coli' _entity_src_nat.pdbx_ncbi_taxonomy_id 83333 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain K12 _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FKBX_ECOLI _struct_ref.pdbx_db_accession P0AEM0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSESVQSNSAVLVHFTLKLDDGTTAESTRNNGKPALFRLGDASLSEGLEQHLLGLKVGDKTTFSLEPDAAFGVPSPDLIQ YFSRREFMDAGEPEIGAIMLFTAMDGSEMPGVIREINGDSITVDFNHPLAGQTVHFDIEVLEIDPALE ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M2A _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 148 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0AEM0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 148 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 148 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC aliphatic' 1 3 1 '2D 1H-13C HSQC aromatic' 1 4 1 '3D 1H-13C NOESY aliphatic' 1 5 1 '3D 1H-13C NOESY aromatic' 1 6 1 '3D 1H-15N NOESY' 1 7 1 '3D HNCA' 1 8 1 '3D HNCACB' 1 9 1 '3D HN(COCA)CB' 1 10 1 '3D HCCH-TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1 mM [U-99% 13C; U-99% 15N] SlpA, 100 mM potassium phosphate, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2M2A _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 300 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M2A _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M2A _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin 2.3 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView ? 3 'Johnson, One Moon Scientific' 'data analysis' NMRView ? 4 'Johnson, One Moon Scientific' 'peak picking' NMRView ? 5 ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA ? 6 ;Linge, O'Donoghue and Nilges ; refinement ARIA ? 7 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M2A _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M2A _struct.title 'NMR solution structure of the two domain PPIase SlpA from Escherichia coli' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M2A _struct_keywords.pdbx_keywords ISOMERASE _struct_keywords.text 'FKBP fold, ISOMERASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 45 ? GLN A 50 ? SER A 45 GLN A 50 1 ? 6 HELX_P HELX_P2 2 GLU A 66 ? ALA A 70 ? GLU A 66 ALA A 70 5 ? 5 HELX_P HELX_P3 3 SER A 75 ? ILE A 79 ? SER A 75 ILE A 79 5 ? 5 HELX_P HELX_P4 4 ARG A 85 ? GLY A 91 ? ARG A 85 GLY A 91 5 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 4 ? C ? 3 ? D ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel D 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 35 ? PHE A 37 ? ALA A 35 PHE A 37 A 2 VAL A 11 ? VAL A 13 ? VAL A 11 VAL A 13 A 3 GLU A 142 ? ILE A 143 ? GLU A 142 ILE A 143 B 1 THR A 24 ? THR A 28 ? THR A 24 THR A 28 B 2 PHE A 15 ? LYS A 18 ? PHE A 15 LYS A 18 B 3 VAL A 134 ? GLU A 139 ? VAL A 134 GLU A 139 B 4 LYS A 60 ? LEU A 65 ? LYS A 60 LEU A 65 C 1 TYR A 81 ? SER A 83 ? TYR A 81 SER A 83 C 2 SER A 120 ? THR A 122 ? SER A 120 THR A 122 C 3 GLU A 115 ? ILE A 116 ? GLU A 115 ILE A 116 D 1 ALA A 97 ? THR A 102 ? ALA A 97 THR A 102 D 2 GLU A 108 ? ILE A 113 ? GLU A 108 ILE A 113 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ALA A 35 ? O ALA A 35 N VAL A 13 ? N VAL A 13 A 2 3 N LEU A 12 ? N LEU A 12 O GLU A 142 ? O GLU A 142 B 1 2 O GLU A 26 ? O GLU A 26 N LEU A 17 ? N LEU A 17 B 2 3 N LYS A 18 ? N LYS A 18 O HIS A 135 ? O HIS A 135 B 3 4 O ILE A 138 ? O ILE A 138 N THR A 61 ? N THR A 61 C 1 2 N PHE A 82 ? N PHE A 82 O ILE A 121 ? O ILE A 121 C 2 3 O THR A 122 ? O THR A 122 N GLU A 115 ? N GLU A 115 D 1 2 N PHE A 101 ? N PHE A 101 O MET A 109 ? O MET A 109 # _atom_sites.entry_id 2M2A _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 MET 88 88 88 MET MET A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 MET 99 99 99 MET MET A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 MET 104 104 104 MET MET A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 MET 109 109 109 MET MET A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 ARG 114 114 114 ARG ARG A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 HIS 127 127 127 HIS HIS A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 GLN 132 132 132 GLN GLN A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 HIS 135 135 135 HIS HIS A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 PRO 145 145 145 PRO PRO A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 GLU 148 148 148 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-12-18 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id SlpA-1 1 ? mM '[U-99% 13C; U-99% 15N]' 1 'potassium phosphate-2' 100 ? mM ? 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A PRO 128 ? ? H A ALA 130 ? ? 1.57 2 2 HG A SER 75 ? ? OD1 A ASP 77 ? ? 1.54 3 2 O A PRO 128 ? ? H A ALA 130 ? ? 1.55 4 3 O A PRO 128 ? ? H A ALA 130 ? ? 1.48 5 4 O A PRO 128 ? ? H A ALA 130 ? ? 1.47 6 5 O A PRO 128 ? ? H A ALA 130 ? ? 1.50 7 6 O A PRO 128 ? ? H A ALA 130 ? ? 1.48 8 7 O A PRO 128 ? ? H A ALA 130 ? ? 1.54 9 7 OD2 A ASP 105 ? ? HG A SER 107 ? ? 1.56 10 8 O A PRO 128 ? ? H A ALA 130 ? ? 1.46 11 9 O A PRO 128 ? ? H A ALA 130 ? ? 1.58 12 10 O A PRO 128 ? ? H A ALA 130 ? ? 1.50 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -165.02 43.34 2 1 THR A 28 ? ? -148.23 44.55 3 1 ARG A 29 ? ? -151.65 -45.96 4 1 SER A 43 ? ? -154.31 -45.09 5 1 ALA A 70 ? ? -131.92 -84.66 6 1 ASP A 105 ? ? -78.59 22.97 7 1 PRO A 128 ? ? -46.06 175.76 8 1 LEU A 129 ? ? -49.45 43.74 9 1 LEU A 147 ? ? -98.61 45.94 10 2 ASN A 8 ? ? 77.24 -1.01 11 2 ARG A 29 ? ? -118.12 -71.78 12 2 PHE A 71 ? ? 72.07 -45.48 13 2 PHE A 125 ? ? -117.98 59.15 14 2 HIS A 127 ? ? -60.73 -175.20 15 2 PRO A 128 ? ? -42.82 177.47 16 2 LEU A 129 ? ? -47.60 42.45 17 3 ASN A 8 ? ? 73.50 41.25 18 3 ASN A 30 ? ? -82.52 35.00 19 3 SER A 43 ? ? -134.42 -39.79 20 3 ALA A 70 ? ? -117.86 -85.84 21 3 PRO A 128 ? ? -44.59 173.70 22 3 LEU A 129 ? ? -51.44 37.07 23 4 ASN A 8 ? ? 72.70 35.07 24 4 THR A 28 ? ? -91.69 57.14 25 4 ARG A 29 ? ? -146.44 -55.73 26 4 SER A 43 ? ? -161.18 -54.36 27 4 PHE A 71 ? ? 73.48 -40.93 28 4 PRO A 128 ? ? -41.53 174.11 29 4 LEU A 129 ? ? -50.50 38.32 30 4 LEU A 147 ? ? -82.44 44.88 31 5 SER A 2 ? ? 42.55 70.25 32 5 ASN A 8 ? ? 75.08 38.06 33 5 THR A 28 ? ? -152.42 65.77 34 5 ARG A 29 ? ? -154.11 -52.27 35 5 SER A 43 ? ? -154.17 -37.96 36 5 ALA A 70 ? ? -119.58 -86.60 37 5 PRO A 128 ? ? -43.23 172.28 38 5 LEU A 129 ? ? -52.23 36.85 39 6 ARG A 29 ? ? -151.75 -61.15 40 6 SER A 43 ? ? -166.32 -49.17 41 6 ALA A 70 ? ? -126.25 -86.11 42 6 PRO A 128 ? ? -41.83 172.64 43 6 LEU A 129 ? ? -51.68 34.76 44 6 LEU A 147 ? ? -90.19 41.79 45 7 ARG A 29 ? ? -174.07 -70.85 46 7 PHE A 71 ? ? 74.37 -47.96 47 7 PRO A 128 ? ? -41.51 174.77 48 7 LEU A 129 ? ? -48.85 41.43 49 8 SER A 2 ? ? 49.59 70.01 50 8 THR A 28 ? ? -148.59 14.48 51 8 ARG A 29 ? ? -92.94 -68.99 52 8 SER A 43 ? ? -163.68 -60.64 53 8 PHE A 71 ? ? 84.11 -44.29 54 8 PHE A 125 ? ? -68.78 98.00 55 8 HIS A 127 ? ? 60.76 -171.73 56 8 PRO A 128 ? ? -46.50 177.72 57 8 LEU A 129 ? ? -51.42 37.23 58 8 ALA A 130 ? ? -54.00 179.97 59 9 ASN A 8 ? ? 80.53 41.43 60 9 THR A 28 ? ? -97.64 51.40 61 9 ARG A 29 ? ? -143.56 -67.94 62 9 ASN A 30 ? ? -80.69 33.80 63 9 SER A 43 ? ? -137.31 -65.85 64 9 ALA A 70 ? ? -121.25 -84.74 65 9 VAL A 73 ? ? -150.19 60.44 66 9 SER A 75 ? ? -152.45 63.28 67 9 HIS A 127 ? ? 70.68 124.81 68 9 PRO A 128 ? ? -51.42 -174.37 69 9 LEU A 129 ? ? -51.11 27.21 70 10 SER A 2 ? ? -156.01 82.78 71 10 ARG A 29 ? ? -132.06 -62.47 72 10 PHE A 71 ? ? 76.31 -44.96 73 10 ASP A 105 ? ? -76.93 22.05 74 10 PRO A 128 ? ? -42.13 174.92 75 10 LEU A 129 ? ? -49.37 40.64 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 9 PRO A 74 ? ? SER A 75 ? ? 145.49 2 9 HIS A 127 ? ? PRO A 128 ? ? 141.70 #