data_2M5C # _entry.id 2M5C # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M5C pdb_00002m5c 10.2210/pdb2m5c/pdb RCSB RCSB103228 ? ? BMRB 19047 ? ? WWPDB D_1000103228 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 19047 BMRB unspecified . 2M5D PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M5C _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2013-02-20 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Karsisiotis, A.I.' 1 'Damblon, C.F.' 2 'Roberts, G.C.K.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Solution structures of the Bacillus cereus metallo-beta-lactamase BcII and its complex with the broad spectrum inhibitor R-thiomandelic acid. ; Biochem.J. 456 397 407 2013 BIJOAK UK 1470-8728 0043 ? 24059435 10.1042/BJ20131003 1 ;Complete (1)H, (15)N and (13)C resonance assignments of Bacillus cereus metallo-beta-lactamase and its complex with the inhibitor R-thiomandelic acid ; 'Biomol.Nmr Assign.' ? ? ? 2013 ? NE 1874-270X ? ? 23838816 10.1007/s12104-013-9507-1 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Karsisiotis, A.I.' 1 ? primary 'Damblon, C.F.' 2 ? primary 'Roberts, G.C.' 3 ? 1 'Karsisiotis, A.I.' 4 ? 1 'Damblon, C.F.' 5 ? 1 'Roberts, G.C.K.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Beta-lactamase 2' 24995.533 1 3.5.2.6 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'BcII, Beta-lactamase II, Cephalosporinase, Penicillinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SQKVEKTVIKNETGTISISQLNKNVWVHTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVT DVIITHAHADRIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQ YNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK ; _entity_poly.pdbx_seq_one_letter_code_can ;SQKVEKTVIKNETGTISISQLNKNVWVHTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVT DVIITHAHADRIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQ YNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLN n 1 3 LYS n 1 4 VAL n 1 5 GLU n 1 6 LYS n 1 7 THR n 1 8 VAL n 1 9 ILE n 1 10 LYS n 1 11 ASN n 1 12 GLU n 1 13 THR n 1 14 GLY n 1 15 THR n 1 16 ILE n 1 17 SER n 1 18 ILE n 1 19 SER n 1 20 GLN n 1 21 LEU n 1 22 ASN n 1 23 LYS n 1 24 ASN n 1 25 VAL n 1 26 TRP n 1 27 VAL n 1 28 HIS n 1 29 THR n 1 30 GLU n 1 31 LEU n 1 32 GLY n 1 33 SER n 1 34 PHE n 1 35 ASN n 1 36 GLY n 1 37 GLU n 1 38 ALA n 1 39 VAL n 1 40 PRO n 1 41 SER n 1 42 ASN n 1 43 GLY n 1 44 LEU n 1 45 VAL n 1 46 LEU n 1 47 ASN n 1 48 THR n 1 49 SER n 1 50 LYS n 1 51 GLY n 1 52 LEU n 1 53 VAL n 1 54 LEU n 1 55 VAL n 1 56 ASP n 1 57 SER n 1 58 SER n 1 59 TRP n 1 60 ASP n 1 61 ASP n 1 62 LYS n 1 63 LEU n 1 64 THR n 1 65 LYS n 1 66 GLU n 1 67 LEU n 1 68 ILE n 1 69 GLU n 1 70 MET n 1 71 VAL n 1 72 GLU n 1 73 LYS n 1 74 LYS n 1 75 PHE n 1 76 GLN n 1 77 LYS n 1 78 ARG n 1 79 VAL n 1 80 THR n 1 81 ASP n 1 82 VAL n 1 83 ILE n 1 84 ILE n 1 85 THR n 1 86 HIS n 1 87 ALA n 1 88 HIS n 1 89 ALA n 1 90 ASP n 1 91 ARG n 1 92 ILE n 1 93 GLY n 1 94 GLY n 1 95 ILE n 1 96 LYS n 1 97 THR n 1 98 LEU n 1 99 LYS n 1 100 GLU n 1 101 ARG n 1 102 GLY n 1 103 ILE n 1 104 LYS n 1 105 ALA n 1 106 HIS n 1 107 SER n 1 108 THR n 1 109 ALA n 1 110 LEU n 1 111 THR n 1 112 ALA n 1 113 GLU n 1 114 LEU n 1 115 ALA n 1 116 LYS n 1 117 LYS n 1 118 ASN n 1 119 GLY n 1 120 TYR n 1 121 GLU n 1 122 GLU n 1 123 PRO n 1 124 LEU n 1 125 GLY n 1 126 ASP n 1 127 LEU n 1 128 GLN n 1 129 THR n 1 130 VAL n 1 131 THR n 1 132 ASN n 1 133 LEU n 1 134 LYS n 1 135 PHE n 1 136 GLY n 1 137 ASN n 1 138 MET n 1 139 LYS n 1 140 VAL n 1 141 GLU n 1 142 THR n 1 143 PHE n 1 144 TYR n 1 145 PRO n 1 146 GLY n 1 147 LYS n 1 148 GLY n 1 149 HIS n 1 150 THR n 1 151 GLU n 1 152 ASP n 1 153 ASN n 1 154 ILE n 1 155 VAL n 1 156 VAL n 1 157 TRP n 1 158 LEU n 1 159 PRO n 1 160 GLN n 1 161 TYR n 1 162 ASN n 1 163 ILE n 1 164 LEU n 1 165 VAL n 1 166 GLY n 1 167 GLY n 1 168 CYS n 1 169 LEU n 1 170 VAL n 1 171 LYS n 1 172 SER n 1 173 THR n 1 174 SER n 1 175 ALA n 1 176 LYS n 1 177 ASP n 1 178 LEU n 1 179 GLY n 1 180 ASN n 1 181 VAL n 1 182 ALA n 1 183 ASP n 1 184 ALA n 1 185 TYR n 1 186 VAL n 1 187 ASN n 1 188 GLU n 1 189 TRP n 1 190 SER n 1 191 THR n 1 192 SER n 1 193 ILE n 1 194 GLU n 1 195 ASN n 1 196 VAL n 1 197 LEU n 1 198 LYS n 1 199 ARG n 1 200 TYR n 1 201 ARG n 1 202 ASN n 1 203 ILE n 1 204 ASN n 1 205 ALA n 1 206 VAL n 1 207 VAL n 1 208 PRO n 1 209 GLY n 1 210 HIS n 1 211 GLY n 1 212 GLU n 1 213 VAL n 1 214 GLY n 1 215 ASP n 1 216 LYS n 1 217 GLY n 1 218 LEU n 1 219 LEU n 1 220 LEU n 1 221 HIS n 1 222 THR n 1 223 LEU n 1 224 ASP n 1 225 LEU n 1 226 LEU n 1 227 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene blm _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 569/H _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus cereus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1396 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vecctor _entity_src_gen.pdbx_host_org_vector pET9a/BCII _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BLA2_BACCE _struct_ref.pdbx_db_accession P04190 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SQKVEKTVIKNETGTISISQLNKNVWVHTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVT DVIITHAHADRIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQ YNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK ; _struct_ref.pdbx_align_begin 31 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M5C _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 227 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04190 _struct_ref_seq.db_align_beg 31 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 257 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 227 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-15N HSQC' 1 3 2 '2D 1H-13C HSQC aliphatic' 1 4 2 '2D 1H-13C HSQC aromatic' 1 5 2 '3D CBCA(CO)NH' 1 6 2 '3D HNCACB' 1 7 2 '3D HBHA(CO)NH' 1 8 2 '3D HBHANH' 1 9 2 '3D HCCH-TOCSY' 1 10 2 '3D HCCH-TOCSY' 1 11 2 '3D HNCA' 1 12 2 '3D HN(CO)CA' 1 13 2 '3D HNCO' 1 14 2 '3D HN(CA)CO' 1 15 1 '3D 1H-15N NOESY' 1 16 2 '3D 1H-13C NOESY aliphatic' 1 17 2 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.pH 6.4 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-99% 15N] BcII-1, 20 mM MES-2, 0.2 mM Zinc Chloride-3, 100 mM sodium chloride-4, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM [U-99% 13C; U-99% 15N] BcII-5, 20 mM MES-6, 0.2 mM Zinc Chloride-7, 100 mM sodium chloride-8, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' 600 Bruker AVANCE 3 'Bruker Avance' 800 Varian INOVA 4 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2M5C _pdbx_nmr_refine.method 'simulated annealing, torsion angle dynamics' _pdbx_nmr_refine.details ;The refinement protocol used consisted of five cycles of simulated annealing with a high start temperature (8000 K) and a gradual slow cooling to a low temperature (100 K) in a large number of steps (20,000). This standard torsion angle based simulating annealing protocol with all constraints applied simultaneously is combined with cycles of redundant dihedral angle constraints (REDAC; Guntert and Wuthrich, 1991). Several cycles of this combined refinement protocol, which eliminates violations and progressively reduces target function values while improving local and overall quality, were used to generate the final converged structures. Out of an ensemble of 100 converged structures generated, the 20 best (lowest CYANA target function during refinement) structures were selected. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M5C _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M5C _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 1 ? 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2 ? 'Herrmann, Guntert and Wuthrich' 'structure solution' CANDID 3 ? 'Herrmann, Guntert and Wuthrich' 'automated noe assignment' CANDID 4 ? Goddard 'data analysis' Sparky 5 ? Goddard 'peak picking' Sparky 6 ? 'Koradi, Billeter and Wuthrich' 'data analysis' MOLMOL 7 ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 8 ? 'Bruker Biospin' collection TopSpin 9 ? 'Bruker Biospin' processing TopSpin 10 ? 'Bruker Biospin' collection XwinNMR 11 ? 'Laskowski and MacArthur' validation ProcheckNMR 12 ? Vriend validation 'WHAT IF' 13 ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRDraw 14 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M5C _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M5C _struct.title 'Solution Structure of the Bacillus cereus Metallo-Beta-Lactamase BcII' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M5C _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'BcII, Metallo-Beta-Lactamase, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 60 ? PHE A 75 ? ASP A 60 PHE A 75 1 ? 16 HELX_P HELX_P2 2 GLY A 94 ? GLY A 102 ? GLY A 94 GLY A 102 1 ? 9 HELX_P HELX_P3 3 LEU A 110 ? GLY A 119 ? LEU A 110 GLY A 119 1 ? 10 HELX_P HELX_P4 4 CYS A 168 ? VAL A 170 ? CYS A 168 VAL A 170 5 ? 3 HELX_P HELX_P5 5 TYR A 185 ? LEU A 197 ? TYR A 185 LEU A 197 1 ? 13 HELX_P HELX_P6 6 LYS A 216 ? LYS A 227 ? LYS A 216 LYS A 227 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 86 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 86 A ZN 301 1_555 ? ? ? ? ? ? ? 2.438 ? ? metalc2 metalc ? ? A HIS 88 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 88 A ZN 301 1_555 ? ? ? ? ? ? ? 2.444 ? ? metalc3 metalc ? ? A ASP 90 OD2 ? ? ? 1_555 C ZN . ZN ? ? A ASP 90 A ZN 302 1_555 ? ? ? ? ? ? ? 2.404 ? ? metalc4 metalc ? ? A HIS 149 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 149 A ZN 301 1_555 ? ? ? ? ? ? ? 2.260 ? ? metalc5 metalc ? ? A CYS 168 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 168 A ZN 302 1_555 ? ? ? ? ? ? ? 2.216 ? ? metalc6 metalc ? ? A HIS 210 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 210 A ZN 302 1_555 ? ? ? ? ? ? ? 2.516 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 7 ? C ? 2 ? D ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? parallel B 6 7 ? parallel C 1 2 ? anti-parallel D 1 2 ? anti-parallel D 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 9 ? LYS A 10 ? ILE A 9 LYS A 10 A 2 ILE A 16 ? GLN A 20 ? ILE A 16 GLN A 20 A 3 VAL A 25 ? LEU A 31 ? VAL A 25 LEU A 31 A 4 PRO A 40 ? SER A 41 ? PRO A 40 SER A 41 B 1 ILE A 9 ? LYS A 10 ? ILE A 9 LYS A 10 B 2 ILE A 16 ? GLN A 20 ? ILE A 16 GLN A 20 B 3 VAL A 25 ? LEU A 31 ? VAL A 25 LEU A 31 B 4 VAL A 45 ? LEU A 46 ? VAL A 45 LEU A 46 B 5 LEU A 52 ? LEU A 54 ? LEU A 52 LEU A 54 B 6 VAL A 79 ? ILE A 83 ? VAL A 79 ILE A 83 B 7 LYS A 104 ? HIS A 106 ? LYS A 104 HIS A 106 C 1 ASN A 132 ? LYS A 134 ? ASN A 132 LYS A 134 C 2 LYS A 139 ? GLU A 141 ? LYS A 139 GLU A 141 D 1 VAL A 156 ? LEU A 158 ? VAL A 156 LEU A 158 D 2 ILE A 163 ? GLY A 167 ? ILE A 163 GLY A 167 D 3 ALA A 205 ? PRO A 208 ? ALA A 205 PRO A 208 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 9 ? N ILE A 9 O ILE A 18 ? O ILE A 18 A 2 3 N SER A 17 ? N SER A 17 O THR A 29 ? O THR A 29 A 3 4 N GLU A 30 ? N GLU A 30 O SER A 41 ? O SER A 41 B 1 2 N ILE A 9 ? N ILE A 9 O ILE A 18 ? O ILE A 18 B 2 3 N SER A 17 ? N SER A 17 O THR A 29 ? O THR A 29 B 3 4 N TRP A 26 ? N TRP A 26 O VAL A 45 ? O VAL A 45 B 4 5 N LEU A 46 ? N LEU A 46 O VAL A 53 ? O VAL A 53 B 5 6 N LEU A 52 ? N LEU A 52 O THR A 80 ? O THR A 80 B 6 7 N VAL A 82 ? N VAL A 82 O LYS A 104 ? O LYS A 104 C 1 2 N LEU A 133 ? N LEU A 133 O VAL A 140 ? O VAL A 140 D 1 2 N LEU A 158 ? N LEU A 158 O ILE A 163 ? O ILE A 163 D 2 3 N LEU A 164 ? N LEU A 164 O ALA A 205 ? O ALA A 205 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 301 ? 5 'BINDING SITE FOR RESIDUE ZN A 301' AC2 Software A ZN 302 ? 3 'BINDING SITE FOR RESIDUE ZN A 302' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 HIS A 86 ? HIS A 86 . ? 1_555 ? 2 AC1 5 HIS A 88 ? HIS A 88 . ? 1_555 ? 3 AC1 5 ASP A 90 ? ASP A 90 . ? 1_555 ? 4 AC1 5 HIS A 149 ? HIS A 149 . ? 1_555 ? 5 AC1 5 CYS A 168 ? CYS A 168 . ? 1_555 ? 6 AC2 3 ASP A 90 ? ASP A 90 . ? 1_555 ? 7 AC2 3 CYS A 168 ? CYS A 168 . ? 1_555 ? 8 AC2 3 HIS A 210 ? HIS A 210 . ? 1_555 ? # _atom_sites.entry_id 2M5C _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 TRP 26 26 26 TRP TRP A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 TYR 120 120 120 TYR TYR A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 MET 138 138 138 MET MET A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 TYR 144 144 144 TYR TYR A . n A 1 145 PRO 145 145 145 PRO PRO A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 HIS 149 149 149 HIS HIS A . n A 1 150 THR 150 150 150 THR THR A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 ASN 153 153 153 ASN ASN A . n A 1 154 ILE 154 154 154 ILE ILE A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 TRP 157 157 157 TRP TRP A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 PRO 159 159 159 PRO PRO A . n A 1 160 GLN 160 160 160 GLN GLN A . n A 1 161 TYR 161 161 161 TYR TYR A . n A 1 162 ASN 162 162 162 ASN ASN A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 CYS 168 168 168 CYS CYS A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 LYS 171 171 171 LYS LYS A . n A 1 172 SER 172 172 172 SER SER A . n A 1 173 THR 173 173 173 THR THR A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 ASP 177 177 177 ASP ASP A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 GLY 179 179 179 GLY GLY A . n A 1 180 ASN 180 180 180 ASN ASN A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 ALA 182 182 182 ALA ALA A . n A 1 183 ASP 183 183 183 ASP ASP A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 TYR 185 185 185 TYR TYR A . n A 1 186 VAL 186 186 186 VAL VAL A . n A 1 187 ASN 187 187 187 ASN ASN A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 TRP 189 189 189 TRP TRP A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 THR 191 191 191 THR THR A . n A 1 192 SER 192 192 192 SER SER A . n A 1 193 ILE 193 193 193 ILE ILE A . n A 1 194 GLU 194 194 194 GLU GLU A . n A 1 195 ASN 195 195 195 ASN ASN A . n A 1 196 VAL 196 196 196 VAL VAL A . n A 1 197 LEU 197 197 197 LEU LEU A . n A 1 198 LYS 198 198 198 LYS LYS A . n A 1 199 ARG 199 199 199 ARG ARG A . n A 1 200 TYR 200 200 200 TYR TYR A . n A 1 201 ARG 201 201 201 ARG ARG A . n A 1 202 ASN 202 202 202 ASN ASN A . n A 1 203 ILE 203 203 203 ILE ILE A . n A 1 204 ASN 204 204 204 ASN ASN A . n A 1 205 ALA 205 205 205 ALA ALA A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 VAL 207 207 207 VAL VAL A . n A 1 208 PRO 208 208 208 PRO PRO A . n A 1 209 GLY 209 209 209 GLY GLY A . n A 1 210 HIS 210 210 210 HIS HIS A . n A 1 211 GLY 211 211 211 GLY GLY A . n A 1 212 GLU 212 212 212 GLU GLU A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 GLY 214 214 214 GLY GLY A . n A 1 215 ASP 215 215 215 ASP ASP A . n A 1 216 LYS 216 216 216 LYS LYS A . n A 1 217 GLY 217 217 217 GLY GLY A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 LEU 219 219 219 LEU LEU A . n A 1 220 LEU 220 220 220 LEU LEU A . n A 1 221 HIS 221 221 221 HIS HIS A . n A 1 222 THR 222 222 222 THR THR A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 ASP 224 224 224 ASP ASP A . n A 1 225 LEU 225 225 225 LEU LEU A . n A 1 226 LEU 226 226 226 LEU LEU A . n A 1 227 LYS 227 227 227 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 301 241 ZN ZN A . C 2 ZN 1 302 254 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 ND1 ? A HIS 88 ? A HIS 88 ? 1_555 123.3 ? 2 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 149 ? A HIS 149 ? 1_555 119.5 ? 3 ND1 ? A HIS 88 ? A HIS 88 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 149 ? A HIS 149 ? 1_555 79.1 ? 4 OD2 ? A ASP 90 ? A ASP 90 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 SG ? A CYS 168 ? A CYS 168 ? 1_555 123.7 ? 5 OD2 ? A ASP 90 ? A ASP 90 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 NE2 ? A HIS 210 ? A HIS 210 ? 1_555 134.2 ? 6 SG ? A CYS 168 ? A CYS 168 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 NE2 ? A HIS 210 ? A HIS 210 ? 1_555 102.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-10-09 2 'Structure model' 1 1 2022-08-24 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_nmr_software 5 2 'Structure model' pdbx_nmr_spectrometer 6 2 'Structure model' pdbx_struct_conn_angle 7 2 'Structure model' struct_conn 8 2 'Structure model' struct_site 9 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.name' 6 2 'Structure model' '_database_2.pdbx_DOI' 7 2 'Structure model' '_database_2.pdbx_database_accession' 8 2 'Structure model' '_pdbx_nmr_software.name' 9 2 'Structure model' '_pdbx_nmr_spectrometer.model' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 15 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 16 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 17 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 18 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 19 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 20 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 21 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 22 2 'Structure model' '_pdbx_struct_conn_angle.value' 23 2 'Structure model' '_struct_conn.pdbx_dist_value' 24 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 25 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 26 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 27 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 28 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 29 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 30 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 31 2 'Structure model' '_struct_site.pdbx_auth_asym_id' 32 2 'Structure model' '_struct_site.pdbx_auth_comp_id' 33 2 'Structure model' '_struct_site.pdbx_auth_seq_id' 34 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id BcII-1 1 ? mM '[U-99% 15N]' 1 MES-2 20 ? mM ? 1 'Zinc Chloride-3' 0.2 ? mM ? 1 'sodium chloride-4' 100 ? mM ? 1 BcII-5 1 ? mM '[U-99% 13C; U-99% 15N]' 2 MES-6 20 ? mM ? 2 'Zinc Chloride-7' 0.2 ? mM ? 2 'sodium chloride-8' 100 ? mM ? 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2M5C _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 7190 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count 2912 _pdbx_nmr_constraints.NOE_medium_range_total_count 1277 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 3001 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 HE2 A HIS 149 ? ? ZN A ZN 301 ? ? 1.59 2 4 HE2 A HIS 149 ? ? ZN A ZN 301 ? ? 1.44 3 8 HE2 A HIS 149 ? ? ZN A ZN 301 ? ? 1.51 4 9 HG1 A THR 108 ? ? HD2 A ASP 152 ? ? 1.34 5 10 HE2 A HIS 149 ? ? ZN A ZN 301 ? ? 1.57 6 12 HE2 A HIS 149 ? ? ZN A ZN 301 ? ? 1.49 7 16 HE2 A HIS 149 ? ? ZN A ZN 301 ? ? 1.55 8 17 HE2 A HIS 149 ? ? ZN A ZN 301 ? ? 1.53 9 18 HE2 A HIS 149 ? ? ZN A ZN 301 ? ? 1.49 10 19 HE2 A HIS 149 ? ? ZN A ZN 301 ? ? 1.51 11 20 HE2 A HIS 149 ? ? ZN A ZN 301 ? ? 1.43 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 5 ? ? -118.42 72.98 2 1 VAL A 8 ? ? -58.86 -176.83 3 1 ASN A 22 ? ? -151.85 -97.08 4 1 LYS A 23 ? ? -150.09 9.45 5 1 ASN A 24 ? ? -150.53 8.25 6 1 SER A 33 ? ? -175.18 116.71 7 1 PHE A 34 ? ? -93.21 42.33 8 1 ASN A 35 ? ? 64.20 69.91 9 1 ASP A 56 ? ? 73.40 121.02 10 1 SER A 57 ? ? -66.12 -166.73 11 1 MET A 70 ? ? -132.90 -40.11 12 1 THR A 80 ? ? -143.79 13.89 13 1 ARG A 91 ? ? -122.11 -77.61 14 1 PRO A 123 ? ? -69.76 -179.85 15 1 THR A 129 ? ? -50.94 -70.73 16 1 TYR A 161 ? ? -141.41 12.28 17 1 VAL A 165 ? ? -115.17 76.93 18 1 SER A 174 ? ? -95.46 44.96 19 1 ASN A 180 ? ? 62.11 103.17 20 1 TYR A 200 ? ? -94.89 38.66 21 1 PRO A 208 ? ? -69.70 -176.01 22 1 ASP A 215 ? ? -163.67 -168.88 23 2 LYS A 3 ? ? -170.56 141.85 24 2 LYS A 6 ? ? -68.74 -176.24 25 2 ASN A 22 ? ? -150.68 -96.47 26 2 LYS A 23 ? ? -150.24 9.56 27 2 ASN A 24 ? ? -151.15 8.56 28 2 SER A 33 ? ? -175.10 115.91 29 2 PHE A 34 ? ? -95.37 41.30 30 2 ASN A 35 ? ? 64.31 68.23 31 2 ASP A 56 ? ? 72.20 129.10 32 2 SER A 57 ? ? -72.52 -165.00 33 2 MET A 70 ? ? -130.46 -39.92 34 2 ARG A 91 ? ? -144.00 -77.34 35 2 PRO A 123 ? ? -69.73 -178.63 36 2 THR A 129 ? ? -50.91 -70.94 37 2 PHE A 143 ? ? -172.83 135.35 38 2 TYR A 161 ? ? -144.25 14.49 39 2 VAL A 165 ? ? -117.73 74.09 40 2 ASP A 177 ? ? 179.95 176.18 41 2 ASN A 180 ? ? -57.41 107.38 42 2 TYR A 200 ? ? -101.84 66.51 43 2 ASN A 202 ? ? -51.63 107.73 44 2 PRO A 208 ? ? -69.73 -174.78 45 2 ASP A 215 ? ? -171.65 -168.87 46 3 VAL A 8 ? ? -59.13 -175.89 47 3 ASN A 22 ? ? -152.04 -96.99 48 3 LYS A 23 ? ? -150.33 9.81 49 3 ASN A 24 ? ? -150.84 7.97 50 3 SER A 33 ? ? 178.91 119.78 51 3 ASP A 56 ? ? 72.80 129.02 52 3 SER A 57 ? ? -71.90 -167.14 53 3 MET A 70 ? ? -131.95 -39.89 54 3 THR A 80 ? ? -142.46 13.28 55 3 ARG A 91 ? ? -140.62 -75.72 56 3 SER A 107 ? ? -178.38 -174.19 57 3 THR A 129 ? ? -50.86 -70.31 58 3 PHE A 135 ? ? -107.65 47.13 59 3 PHE A 143 ? ? -171.82 133.50 60 3 ASP A 152 ? ? -140.21 11.45 61 3 TYR A 161 ? ? -143.82 14.05 62 3 VAL A 165 ? ? -117.33 76.47 63 3 ASP A 177 ? ? 179.01 173.36 64 3 ASN A 180 ? ? 59.56 102.36 65 3 ALA A 205 ? ? -172.74 125.31 66 3 ASP A 215 ? ? -161.95 -169.60 67 4 VAL A 8 ? ? -67.57 -177.28 68 4 ASN A 22 ? ? -150.71 -97.27 69 4 LYS A 23 ? ? -151.47 9.89 70 4 ASN A 24 ? ? -150.58 6.31 71 4 SER A 33 ? ? -175.17 116.18 72 4 PHE A 34 ? ? -95.15 41.40 73 4 ASN A 35 ? ? 64.48 67.96 74 4 ASN A 42 ? ? -52.56 170.76 75 4 ASP A 56 ? ? 72.65 129.01 76 4 SER A 57 ? ? -72.18 -167.41 77 4 MET A 70 ? ? -130.85 -39.75 78 4 ARG A 91 ? ? -136.02 -76.91 79 4 SER A 107 ? ? -178.49 -179.88 80 4 ASP A 126 ? ? -107.11 41.98 81 4 THR A 129 ? ? -50.58 -71.27 82 4 LYS A 134 ? ? -179.04 112.56 83 4 PHE A 135 ? ? -110.49 74.12 84 4 TYR A 161 ? ? -142.53 19.14 85 4 VAL A 165 ? ? -116.53 79.31 86 4 SER A 174 ? ? -93.49 41.39 87 4 ASN A 202 ? ? -51.49 104.95 88 4 PRO A 208 ? ? -69.66 -168.61 89 4 ASP A 215 ? ? -169.01 -168.86 90 5 VAL A 8 ? ? -58.47 -176.55 91 5 ASN A 22 ? ? -153.48 -96.79 92 5 LYS A 23 ? ? -150.44 9.66 93 5 ASN A 24 ? ? -150.77 7.74 94 5 SER A 33 ? ? -175.07 116.93 95 5 PHE A 34 ? ? -92.49 43.96 96 5 ASN A 35 ? ? 63.73 69.34 97 5 ASP A 56 ? ? 71.51 134.50 98 5 SER A 57 ? ? -72.15 -165.94 99 5 MET A 70 ? ? -131.01 -39.74 100 5 ARG A 91 ? ? -131.13 -77.27 101 5 PRO A 123 ? ? -69.71 -177.42 102 5 ASP A 126 ? ? -99.03 33.54 103 5 THR A 129 ? ? -50.49 -70.01 104 5 LYS A 134 ? ? -171.31 110.23 105 5 PHE A 135 ? ? -117.92 -167.57 106 5 ASP A 152 ? ? -150.18 19.36 107 5 LYS A 171 ? ? -52.15 170.69 108 5 TYR A 200 ? ? -94.99 38.38 109 5 ASN A 202 ? ? -59.97 101.68 110 5 ASP A 215 ? ? -163.25 -169.00 111 6 LYS A 3 ? ? 62.48 164.80 112 6 ASN A 22 ? ? -152.58 -96.88 113 6 LYS A 23 ? ? -150.24 9.41 114 6 ASN A 24 ? ? -150.75 8.17 115 6 SER A 33 ? ? 178.81 120.22 116 6 ASP A 56 ? ? 70.81 131.65 117 6 SER A 57 ? ? -69.41 -164.40 118 6 ARG A 91 ? ? -129.83 -77.37 119 6 SER A 107 ? ? -176.64 -176.88 120 6 PRO A 123 ? ? -69.80 -171.69 121 6 THR A 129 ? ? -49.93 -70.33 122 6 TYR A 161 ? ? -144.00 14.15 123 6 THR A 173 ? ? -44.04 156.68 124 6 ASN A 180 ? ? 63.08 104.75 125 6 TYR A 200 ? ? -97.24 37.78 126 6 ASN A 202 ? ? -59.34 98.48 127 6 ALA A 205 ? ? -170.75 123.51 128 6 ASP A 215 ? ? -174.83 -167.72 129 7 GLN A 2 ? ? -148.98 -65.67 130 7 VAL A 8 ? ? -59.12 -176.84 131 7 ASN A 11 ? ? -58.37 -176.24 132 7 ASN A 22 ? ? -150.73 -97.36 133 7 LYS A 23 ? ? -151.44 10.14 134 7 ASN A 24 ? ? -150.51 6.37 135 7 SER A 33 ? ? 61.78 103.48 136 7 PHE A 34 ? ? -88.51 46.65 137 7 ASN A 35 ? ? 60.56 67.17 138 7 VAL A 39 ? ? -113.51 73.32 139 7 ASN A 42 ? ? -49.51 159.80 140 7 ASP A 56 ? ? 72.64 132.79 141 7 SER A 57 ? ? -75.36 -166.98 142 7 MET A 70 ? ? -130.87 -39.88 143 7 ARG A 91 ? ? -144.89 -76.75 144 7 PRO A 123 ? ? -69.85 -176.22 145 7 THR A 129 ? ? -50.79 -70.54 146 7 TYR A 161 ? ? -143.63 13.88 147 7 VAL A 165 ? ? -111.28 78.95 148 7 THR A 173 ? ? -49.23 156.34 149 7 VAL A 181 ? ? 36.56 45.05 150 7 ASP A 215 ? ? -164.28 -167.69 151 8 LYS A 6 ? ? -65.43 -175.01 152 8 ASN A 22 ? ? -149.02 -97.41 153 8 LYS A 23 ? ? -151.84 10.29 154 8 ASN A 24 ? ? -150.96 6.46 155 8 SER A 33 ? ? -175.27 83.07 156 8 PHE A 34 ? ? -69.76 84.26 157 8 ASP A 56 ? ? 72.37 128.70 158 8 SER A 57 ? ? -73.52 -165.59 159 8 MET A 70 ? ? -130.32 -40.07 160 8 ARG A 91 ? ? -138.83 -77.43 161 8 PRO A 123 ? ? -69.79 -176.10 162 8 THR A 129 ? ? -50.62 -71.10 163 8 THR A 150 ? ? -147.15 -158.31 164 8 TYR A 161 ? ? -143.40 13.76 165 8 VAL A 165 ? ? -112.22 79.78 166 8 SER A 174 ? ? -93.36 42.34 167 8 ASN A 202 ? ? -53.03 102.14 168 8 PRO A 208 ? ? -69.62 -169.48 169 8 ASP A 215 ? ? -160.15 -169.32 170 9 ASN A 22 ? ? -151.26 -96.67 171 9 LYS A 23 ? ? -151.42 9.90 172 9 ASN A 24 ? ? -150.98 6.78 173 9 SER A 33 ? ? 58.53 98.56 174 9 GLU A 37 ? ? -100.18 -166.46 175 9 VAL A 39 ? ? -112.44 77.63 176 9 ASP A 56 ? ? 72.10 130.23 177 9 SER A 57 ? ? -72.85 -166.65 178 9 THR A 80 ? ? -155.41 19.56 179 9 ARG A 91 ? ? -121.68 -77.34 180 9 PRO A 123 ? ? -69.77 -178.75 181 9 ASP A 126 ? ? -107.84 45.17 182 9 THR A 129 ? ? -50.89 -70.62 183 9 ASP A 152 ? ? -145.75 16.18 184 9 TYR A 161 ? ? -143.52 13.91 185 9 VAL A 165 ? ? -115.02 79.20 186 9 SER A 174 ? ? -93.50 46.30 187 9 VAL A 181 ? ? 36.73 44.62 188 9 ASN A 202 ? ? -52.64 101.78 189 9 PRO A 208 ? ? -69.82 -171.30 190 9 ASP A 215 ? ? -163.57 -169.12 191 10 LYS A 3 ? ? 63.19 169.98 192 10 GLU A 5 ? ? -116.36 55.95 193 10 ILE A 18 ? ? -101.52 -164.28 194 10 SER A 19 ? ? -178.23 115.48 195 10 ASN A 22 ? ? -148.43 -96.61 196 10 LYS A 23 ? ? -152.62 10.44 197 10 ASN A 24 ? ? -151.51 5.60 198 10 SER A 33 ? ? 178.70 119.44 199 10 ASN A 35 ? ? 49.67 28.68 200 10 ASP A 56 ? ? 72.77 128.22 201 10 SER A 57 ? ? -70.84 -167.84 202 10 MET A 70 ? ? -131.65 -39.99 203 10 ARG A 91 ? ? -149.13 -71.64 204 10 SER A 107 ? ? -179.01 -177.56 205 10 ASP A 126 ? ? -99.23 34.47 206 10 PHE A 135 ? ? -107.60 45.42 207 10 THR A 150 ? ? -139.83 -87.14 208 10 GLU A 151 ? ? -160.56 -32.91 209 10 TYR A 161 ? ? -143.46 13.40 210 10 VAL A 165 ? ? -111.05 78.72 211 10 SER A 174 ? ? -93.08 43.16 212 10 ASN A 180 ? ? -63.38 95.95 213 10 ASN A 202 ? ? -59.92 103.80 214 10 ALA A 205 ? ? -172.53 130.14 215 10 ASP A 215 ? ? -171.47 -166.39 216 11 VAL A 8 ? ? -62.30 -177.62 217 11 ASN A 22 ? ? -151.06 -97.48 218 11 LYS A 23 ? ? -150.26 9.48 219 11 ASN A 24 ? ? -150.09 7.26 220 11 SER A 33 ? ? 178.30 119.82 221 11 ASN A 35 ? ? 49.92 28.93 222 11 ASP A 56 ? ? 72.58 128.09 223 11 SER A 57 ? ? -71.60 -167.10 224 11 MET A 70 ? ? -130.95 -40.03 225 11 THR A 80 ? ? -140.07 13.44 226 11 ASP A 90 ? ? -95.37 30.11 227 11 ARG A 91 ? ? -150.94 -70.89 228 11 PRO A 123 ? ? -69.67 -179.68 229 11 ASP A 126 ? ? -98.55 36.88 230 11 THR A 129 ? ? -50.73 -70.26 231 11 PHE A 135 ? ? -110.08 51.39 232 11 PHE A 143 ? ? -170.84 130.83 233 11 TYR A 161 ? ? -144.04 14.60 234 11 LYS A 171 ? ? -51.66 171.15 235 11 THR A 173 ? ? -39.49 149.38 236 11 ASP A 177 ? ? 179.46 164.18 237 11 ASN A 202 ? ? -51.99 103.68 238 11 PRO A 208 ? ? -69.84 -175.73 239 11 LEU A 225 ? ? -133.62 -38.56 240 12 LYS A 6 ? ? -60.38 -174.15 241 12 VAL A 8 ? ? -67.17 -177.70 242 12 ASN A 22 ? ? -151.07 -97.42 243 12 LYS A 23 ? ? -151.54 10.08 244 12 ASN A 24 ? ? -150.56 6.35 245 12 SER A 33 ? ? 178.59 74.54 246 12 PHE A 34 ? ? -59.78 96.66 247 12 ASP A 56 ? ? 72.94 128.65 248 12 SER A 57 ? ? -71.92 -168.56 249 12 MET A 70 ? ? -130.50 -39.95 250 12 THR A 80 ? ? -140.89 12.11 251 12 ARG A 91 ? ? -137.87 -76.52 252 12 ASP A 126 ? ? -108.10 43.90 253 12 THR A 129 ? ? -50.90 -70.82 254 12 THR A 150 ? ? -145.68 -159.96 255 12 TYR A 161 ? ? -140.64 12.41 256 12 ASN A 180 ? ? -52.07 105.88 257 12 ASN A 202 ? ? -52.03 102.32 258 12 ALA A 205 ? ? -174.98 134.64 259 12 PRO A 208 ? ? -69.80 -177.70 260 12 ASP A 215 ? ? -168.34 -169.01 261 13 VAL A 4 ? ? 64.05 156.41 262 13 VAL A 8 ? ? -58.31 -176.79 263 13 ASN A 22 ? ? -151.93 -97.14 264 13 LYS A 23 ? ? -150.64 9.61 265 13 ASN A 24 ? ? -150.28 7.17 266 13 SER A 33 ? ? -175.35 81.46 267 13 ASP A 56 ? ? 72.54 127.79 268 13 SER A 57 ? ? -72.35 -166.95 269 13 MET A 70 ? ? -131.35 -40.30 270 13 THR A 80 ? ? -155.24 20.64 271 13 ARG A 91 ? ? -146.48 -74.81 272 13 PRO A 123 ? ? -69.69 -176.58 273 13 THR A 129 ? ? -51.02 -70.67 274 13 LYS A 134 ? ? -176.15 112.38 275 13 PHE A 135 ? ? -106.73 74.84 276 13 TYR A 161 ? ? -142.04 13.01 277 13 SER A 174 ? ? -94.98 45.02 278 13 ASN A 180 ? ? -58.94 98.03 279 13 ASN A 202 ? ? -60.31 99.51 280 13 ALA A 205 ? ? -173.58 132.69 281 13 PRO A 208 ? ? -69.82 -169.54 282 13 ASP A 215 ? ? -172.13 -167.17 283 14 LYS A 3 ? ? 58.67 179.50 284 14 VAL A 8 ? ? -66.57 -176.63 285 14 ASN A 22 ? ? -151.02 -97.19 286 14 LYS A 23 ? ? -151.50 10.04 287 14 ASN A 24 ? ? -150.59 6.13 288 14 SER A 33 ? ? -175.44 117.34 289 14 PHE A 34 ? ? -107.92 78.18 290 14 ASN A 42 ? ? -49.36 162.40 291 14 ASP A 56 ? ? 72.98 125.51 292 14 SER A 57 ? ? -69.60 -166.47 293 14 THR A 80 ? ? -160.37 20.62 294 14 ARG A 91 ? ? -120.69 -78.64 295 14 PRO A 123 ? ? -69.72 -176.10 296 14 THR A 129 ? ? -50.56 -70.36 297 14 ASP A 152 ? ? -147.07 16.47 298 14 VAL A 165 ? ? -112.02 76.94 299 14 VAL A 181 ? ? 36.77 44.53 300 14 TYR A 200 ? ? -95.13 38.24 301 14 ASN A 202 ? ? -59.59 99.87 302 14 ALA A 205 ? ? -170.71 133.73 303 14 PRO A 208 ? ? -69.73 -169.82 304 14 ASP A 215 ? ? -161.73 -169.48 305 15 GLN A 2 ? ? 61.79 95.74 306 15 THR A 7 ? ? -100.38 -68.71 307 15 ASN A 22 ? ? -151.10 -97.00 308 15 LYS A 23 ? ? -150.34 9.56 309 15 ASN A 24 ? ? -150.75 7.76 310 15 SER A 33 ? ? -175.48 117.70 311 15 ASP A 56 ? ? 73.50 141.15 312 15 ARG A 91 ? ? -152.24 -70.90 313 15 PRO A 123 ? ? -69.86 -169.96 314 15 PHE A 143 ? ? -170.10 137.31 315 15 ASP A 152 ? ? -141.72 12.09 316 15 TYR A 161 ? ? -144.27 14.29 317 15 VAL A 165 ? ? -113.13 76.43 318 15 SER A 174 ? ? -98.34 43.63 319 15 ASN A 180 ? ? -52.43 103.04 320 15 TYR A 200 ? ? -102.15 40.09 321 15 ASN A 202 ? ? -59.07 103.87 322 15 PRO A 208 ? ? -69.70 -176.27 323 15 ASP A 215 ? ? -171.82 -168.89 324 16 GLN A 2 ? ? 57.88 91.61 325 16 LYS A 6 ? ? -62.76 -179.71 326 16 VAL A 8 ? ? -66.19 -177.33 327 16 ASN A 22 ? ? -150.12 -97.23 328 16 LYS A 23 ? ? -151.52 9.98 329 16 ASN A 24 ? ? -150.52 6.19 330 16 SER A 33 ? ? -175.53 117.68 331 16 ASP A 56 ? ? 72.91 141.02 332 16 HIS A 86 ? ? -173.15 -176.34 333 16 ARG A 91 ? ? -151.28 -70.40 334 16 PRO A 123 ? ? -69.83 -169.76 335 16 ASP A 126 ? ? -97.42 31.31 336 16 THR A 129 ? ? -50.79 -70.27 337 16 LYS A 134 ? ? -171.74 112.16 338 16 PHE A 135 ? ? -106.73 73.93 339 16 PHE A 143 ? ? -170.89 135.90 340 16 THR A 173 ? ? -49.43 157.29 341 16 ASP A 177 ? ? 179.83 158.78 342 16 TYR A 200 ? ? -101.12 65.99 343 16 ASN A 202 ? ? -56.14 100.16 344 16 ALA A 205 ? ? -171.99 137.76 345 16 PRO A 208 ? ? -69.85 -170.76 346 17 GLN A 2 ? ? -148.82 47.81 347 17 LYS A 6 ? ? -107.19 -169.94 348 17 THR A 7 ? ? -96.70 -68.30 349 17 ASN A 22 ? ? -151.96 -96.57 350 17 LYS A 23 ? ? -150.70 9.79 351 17 ASN A 24 ? ? -151.24 7.99 352 17 SER A 33 ? ? -175.93 117.81 353 17 LEU A 44 ? ? -160.52 118.13 354 17 ASP A 56 ? ? 73.75 139.89 355 17 MET A 70 ? ? -130.75 -39.71 356 17 HIS A 86 ? ? -175.11 -175.45 357 17 ARG A 91 ? ? -143.54 -70.75 358 17 PRO A 123 ? ? -69.75 -169.84 359 17 THR A 129 ? ? -50.25 -70.74 360 17 PHE A 143 ? ? -170.82 135.55 361 17 TYR A 161 ? ? -143.72 14.11 362 17 VAL A 165 ? ? -119.21 75.09 363 17 SER A 174 ? ? -98.25 39.08 364 17 TYR A 200 ? ? -95.91 39.24 365 17 ALA A 205 ? ? -170.21 126.66 366 17 PRO A 208 ? ? -69.82 -173.25 367 18 GLN A 2 ? ? -95.10 -69.85 368 18 LYS A 3 ? ? 61.70 100.31 369 18 ASN A 22 ? ? -151.11 -97.17 370 18 LYS A 23 ? ? -151.15 9.80 371 18 ASN A 24 ? ? -150.55 6.47 372 18 SER A 33 ? ? 178.99 89.16 373 18 ASN A 42 ? ? -55.81 170.16 374 18 ASP A 56 ? ? 72.92 128.96 375 18 SER A 57 ? ? -71.96 -164.96 376 18 MET A 70 ? ? -130.43 -40.32 377 18 ARG A 91 ? ? -135.32 -76.39 378 18 SER A 107 ? ? -173.75 -175.12 379 18 PRO A 123 ? ? -69.66 -178.89 380 18 THR A 129 ? ? -50.43 -70.48 381 18 TYR A 161 ? ? -140.30 12.15 382 18 SER A 174 ? ? -96.87 34.50 383 18 ASN A 202 ? ? -52.13 102.06 384 18 ALA A 205 ? ? -174.97 129.08 385 18 PRO A 208 ? ? -69.83 -170.64 386 18 ASP A 215 ? ? -167.29 -168.04 387 19 GLN A 2 ? ? 63.14 163.70 388 19 VAL A 8 ? ? -58.11 -175.90 389 19 ASN A 22 ? ? -151.84 -97.07 390 19 LYS A 23 ? ? -150.30 9.59 391 19 ASN A 24 ? ? -150.46 7.78 392 19 SER A 33 ? ? 49.46 89.38 393 19 PHE A 34 ? ? -77.15 -160.88 394 19 VAL A 39 ? ? -113.13 74.76 395 19 LEU A 44 ? ? -160.22 117.32 396 19 ASP A 56 ? ? 73.57 138.98 397 19 ARG A 91 ? ? -144.33 -70.06 398 19 PRO A 123 ? ? -69.81 -170.28 399 19 ASP A 126 ? ? -96.79 33.01 400 19 THR A 129 ? ? -50.02 -70.14 401 19 PHE A 135 ? ? -113.02 69.35 402 19 PHE A 143 ? ? -170.66 139.72 403 19 ASP A 152 ? ? -141.66 13.78 404 19 TYR A 161 ? ? -141.32 13.01 405 19 VAL A 165 ? ? -113.42 75.22 406 19 ASN A 180 ? ? 62.29 103.25 407 19 TYR A 200 ? ? -101.07 64.31 408 19 ASN A 202 ? ? -50.97 107.93 409 20 GLN A 2 ? ? -169.24 103.84 410 20 ASN A 22 ? ? -151.32 -96.74 411 20 LYS A 23 ? ? -150.87 9.70 412 20 ASN A 24 ? ? -150.61 6.97 413 20 SER A 33 ? ? 64.93 111.62 414 20 LEU A 44 ? ? -160.68 116.97 415 20 ASP A 56 ? ? 72.56 146.11 416 20 THR A 80 ? ? -146.53 14.33 417 20 ARG A 91 ? ? -135.97 -70.41 418 20 PRO A 123 ? ? -69.90 -168.33 419 20 PHE A 143 ? ? -170.69 134.34 420 20 ASP A 152 ? ? -144.00 25.43 421 20 TYR A 161 ? ? -143.63 14.32 422 20 SER A 174 ? ? -95.72 44.09 423 20 ASN A 180 ? ? -59.10 100.37 424 20 PRO A 208 ? ? -69.86 -173.41 425 20 ASP A 215 ? ? -179.80 -170.30 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #