data_2M6Y # _entry.id 2M6Y # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2M6Y RCSB RCSB103286 BMRB 19163 WWPDB D_1000103286 # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 19163 BMRB unspecified . NESG-HR3099B TargetTrack unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M6Y _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-04-14 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Stark, J.L.' 1 'Mehla, K.' 2 'Chaika, N.' 3 'Acton, T.B.' 4 'Xiao, R.' 5 'Singh, P.K.' 6 'Montelione, G.T.' 7 'Powers, R.' 8 'Northeast Structural Genomics Consortium (NESG)' 9 # _citation.id primary _citation.title 'Structure and function of human DnaJ homologue subfamily a member 1 (DNAJA1) and its relationship to pancreatic cancer.' _citation.journal_abbrev Biochemistry _citation.journal_volume 53 _citation.page_first 1360 _citation.page_last 1372 _citation.year 2014 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24512202 _citation.pdbx_database_id_DOI 10.1021/bi401329a # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Stark, J.L.' 1 primary 'Mehla, K.' 2 primary 'Chaika, N.' 3 primary 'Acton, T.B.' 4 primary 'Xiao, R.' 5 primary 'Singh, P.K.' 6 primary 'Montelione, G.T.' 7 primary 'Powers, R.' 8 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'DnaJ homolog subfamily A member 1' _entity.formula_weight 9095.297 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'J-domain (UNP residues 1-67)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DnaJ protein homolog 2, HSDJ, Heat shock 40 kDa protein 4, Heat shock protein J2, HSJ-2, Human DnaJ protein 2, hDj-2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MGHHHHHHSHMVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKG _entity_poly.pdbx_seq_one_letter_code_can MGHHHHHHSHMVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NESG-HR3099B # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 SER n 1 10 HIS n 1 11 MET n 1 12 VAL n 1 13 LYS n 1 14 GLU n 1 15 THR n 1 16 THR n 1 17 TYR n 1 18 TYR n 1 19 ASP n 1 20 VAL n 1 21 LEU n 1 22 GLY n 1 23 VAL n 1 24 LYS n 1 25 PRO n 1 26 ASN n 1 27 ALA n 1 28 THR n 1 29 GLN n 1 30 GLU n 1 31 GLU n 1 32 LEU n 1 33 LYS n 1 34 LYS n 1 35 ALA n 1 36 TYR n 1 37 ARG n 1 38 LYS n 1 39 LEU n 1 40 ALA n 1 41 LEU n 1 42 LYS n 1 43 TYR n 1 44 HIS n 1 45 PRO n 1 46 ASP n 1 47 LYS n 1 48 ASN n 1 49 PRO n 1 50 ASN n 1 51 GLU n 1 52 GLY n 1 53 GLU n 1 54 LYS n 1 55 PHE n 1 56 LYS n 1 57 GLN n 1 58 ILE n 1 59 SER n 1 60 GLN n 1 61 ALA n 1 62 TYR n 1 63 GLU n 1 64 VAL n 1 65 LEU n 1 66 SER n 1 67 ASP n 1 68 ALA n 1 69 LYS n 1 70 LYS n 1 71 ARG n 1 72 GLU n 1 73 LEU n 1 74 TYR n 1 75 ASP n 1 76 LYS n 1 77 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'DNAJA1, DNAJ2, HDJ2, HSJ2, HSPF4' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET15_NESG _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DNJA1_HUMAN _struct_ref.pdbx_db_accession P31689 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKG _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M6Y _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 11 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 77 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P31689 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 67 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 11 _struct_ref_seq.pdbx_auth_seq_align_end 77 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2M6Y MET A 1 ? UNP P31689 ? ? 'EXPRESSION TAG' 1 1 1 2M6Y GLY A 2 ? UNP P31689 ? ? 'EXPRESSION TAG' 2 2 1 2M6Y HIS A 3 ? UNP P31689 ? ? 'EXPRESSION TAG' 3 3 1 2M6Y HIS A 4 ? UNP P31689 ? ? 'EXPRESSION TAG' 4 4 1 2M6Y HIS A 5 ? UNP P31689 ? ? 'EXPRESSION TAG' 5 5 1 2M6Y HIS A 6 ? UNP P31689 ? ? 'EXPRESSION TAG' 6 6 1 2M6Y HIS A 7 ? UNP P31689 ? ? 'EXPRESSION TAG' 7 7 1 2M6Y HIS A 8 ? UNP P31689 ? ? 'EXPRESSION TAG' 8 8 1 2M6Y SER A 9 ? UNP P31689 ? ? 'EXPRESSION TAG' 9 9 1 2M6Y HIS A 10 ? UNP P31689 ? ? 'EXPRESSION TAG' 10 10 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D HN(CA)CO' 1 5 1 '3D HNCA' 1 6 1 '3D HN(CO)CA' 1 7 1 '3D CBCA(CO)NH' 1 8 1 '3D CBCANH' 1 9 1 '3D HNHA' 1 10 1 '3D HBHA(CO)NH' 1 11 1 '3D CC(CO)NH' 1 12 1 '3D HCC(CO)NH' 1 13 1 '3D HCCH-TOCSY' 1 14 1 '3D HCCH-COSY' 1 15 1 '3D 1H-15N NOESY' 1 16 1 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 125 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;1.03 mM [U-13C; U-15N] J-domain of DnaJA1, 20 mM MES, 0.02 % sodium azide, 10 mM DTT, 5 mM calcium chloride, 100 mM sodium chloride, 50 uM DSS, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker Avance 1 'Bruker Avance' 600 Bruker Avance 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2M6Y _pdbx_nmr_refine.method 'distance geometry, torsion angle dynamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 400 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M6Y _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M6Y _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal CCPN 'chemical shift assignment' CCPNMR_Analysis 2.2.2 1 CCPN 'data analysis' CCPNMR_Analysis 2.2.2 2 CCPN 'peak picking' CCPNMR_Analysis 2.2.2 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 4 'Bhattacharya and Montelione' 'structure validation' PSVS ? 5 'Bruker Biospin' collection TOPSPIN ? 6 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' X-PLOR_NIH ? 7 'Schwieters, Kuszewski, Tjandra and Clore' refinement X-PLOR_NIH ? 8 'Schwieters, Kuszewski, Tjandra and Clore' 'geometry optimization' X-PLOR_NIH ? 9 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M6Y _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M6Y _struct.title 'The solution structure of the J-domain of human DnaJA1' _struct.pdbx_descriptor 'DnaJ homolog subfamily A member 1' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M6Y _struct_keywords.pdbx_keywords CHAPERONE _struct_keywords.text 'protein, CHAPERONE, Structural Genomics, PSI-Biology, Northeast Structural Genomics Consortium, NESG' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 16 ? LEU A 21 ? THR A 16 LEU A 21 1 ? 6 HELX_P HELX_P2 2 THR A 28 ? HIS A 44 ? THR A 28 HIS A 44 1 ? 17 HELX_P HELX_P3 3 GLU A 51 ? SER A 66 ? GLU A 51 SER A 66 1 ? 16 HELX_P HELX_P4 4 ASP A 67 ? GLY A 77 ? ASP A 67 GLY A 77 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2M6Y _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 GLY 77 77 77 GLY GLY A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-06-26 2 'Structure model' 1 1 2015-04-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'J-domain of DnaJA1-1' 1.03 ? mM '[U-13C; U-15N]' 1 MES-2 20 ? mM ? 1 'sodium azide-3' 0.02 ? % ? 1 DTT-4 10 ? mM ? 1 'calcium chloride-5' 5 ? mM ? 1 'sodium chloride-6' 100 ? mM ? 1 DSS-7 50 ? uM ? 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 8 ? ? 60.00 8.30 2 1 GLU A 14 ? ? 62.23 81.12 3 3 GLU A 14 ? ? 52.37 72.20 4 3 HIS A 44 ? ? -45.88 107.91 5 4 HIS A 8 ? ? 71.44 -60.50 6 4 GLU A 14 ? ? 50.60 80.57 7 4 TYR A 43 ? ? -105.70 43.81 8 4 HIS A 44 ? ? -48.73 105.10 9 6 GLU A 14 ? ? 53.83 74.82 10 9 GLU A 14 ? ? 60.73 89.67 11 10 SER A 9 ? ? 48.47 -102.17 12 10 HIS A 10 ? ? 62.05 -167.45 13 10 GLU A 14 ? ? -160.80 72.14 14 12 HIS A 5 ? ? 71.32 93.22 15 12 GLU A 14 ? ? 59.21 74.51 16 13 HIS A 3 ? ? 64.79 92.39 17 13 HIS A 10 ? ? -161.91 90.46 18 13 HIS A 44 ? ? -51.93 109.82 19 14 HIS A 44 ? ? -45.29 105.94 20 16 LYS A 13 ? ? -157.46 89.28 21 16 GLU A 14 ? ? 56.64 75.18 22 17 SER A 9 ? ? -65.92 97.13 23 17 GLU A 14 ? ? 55.87 72.47 24 18 GLU A 14 ? ? -161.11 97.43 25 19 GLU A 14 ? ? 63.70 68.08 26 19 TYR A 43 ? ? -99.95 32.18 #