data_2MA6 # _entry.id 2MA6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2MA6 RCSB RCSB103402 BMRB 19329 WWPDB D_1000103402 # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 19329 BMRB unspecified . NESG-HR8700A TargetTrack unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MA6 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-06-28 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ramelot, T.A.' 1 'Yang, Y.' 2 'Janjua, H.' 3 'Kohan, E.' 4 'Wang, H.' 5 'Xiao, R.' 6 'Acton, T.B.' 7 'Everett, J.K.' 8 'Montelione, G.T.' 9 'Kennedy, M.A.' 10 'Northeast Structural Genomics Consortium (NESG)' 11 # _citation.id primary _citation.title ;Solution NMR Structure of the RING finger domain from the Kip1 ubiquitination-promoting E3 complex protein 1 (KPC1/RNF123) from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR8700A ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Ramelot, T.A.' 1 primary 'Yang, Y.' 2 primary 'Janjua, H.' 3 primary 'Kohan, E.' 4 primary 'Wang, H.' 5 primary 'Xiao, R.' 6 primary 'Acton, T.B.' 7 primary 'Everett, J.K.' 8 primary 'Montelione, G.T.' 9 primary 'Kennedy, M.A.' 10 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'E3 ubiquitin-protein ligase RNF123' 6882.918 1 6.3.2.- ? 'UNP residues 1247-1304' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Kip1 ubiquitination-promoting complex protein 1, RING finger protein 123' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SHMPTSEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKTTIVSVEDWEKG _entity_poly.pdbx_seq_one_letter_code_can SHMPTSEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKTTIVSVEDWEKG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NESG-HR8700A # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 HIS n 1 3 MET n 1 4 PRO n 1 5 THR n 1 6 SER n 1 7 GLU n 1 8 GLU n 1 9 ASP n 1 10 LEU n 1 11 CYS n 1 12 PRO n 1 13 ILE n 1 14 CYS n 1 15 TYR n 1 16 ALA n 1 17 HIS n 1 18 PRO n 1 19 ILE n 1 20 SER n 1 21 ALA n 1 22 VAL n 1 23 PHE n 1 24 GLN n 1 25 PRO n 1 26 CYS n 1 27 GLY n 1 28 HIS n 1 29 LYS n 1 30 SER n 1 31 CYS n 1 32 LYS n 1 33 ALA n 1 34 CYS n 1 35 ILE n 1 36 ASN n 1 37 GLN n 1 38 HIS n 1 39 LEU n 1 40 MET n 1 41 ASN n 1 42 ASN n 1 43 LYS n 1 44 ASP n 1 45 CYS n 1 46 PHE n 1 47 PHE n 1 48 CYS n 1 49 LYS n 1 50 THR n 1 51 THR n 1 52 ILE n 1 53 VAL n 1 54 SER n 1 55 VAL n 1 56 GLU n 1 57 ASP n 1 58 TRP n 1 59 GLU n 1 60 LYS n 1 61 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FP1477, KPC1, RNF123' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pMgK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details pET15Avi6HT_NESG _entity_src_gen.pdbx_description plasmid # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RN123_HUMAN _struct_ref.pdbx_db_accession Q5XPI4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code PTSEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKTTIVSVEDWEKG _struct_ref.pdbx_align_begin 1247 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MA6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 61 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5XPI4 _struct_ref_seq.db_align_beg 1247 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1304 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 61 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MA6 SER A 1 ? UNP Q5XPI4 ? ? 'EXPRESSION TAG' 1 1 1 2MA6 HIS A 2 ? UNP Q5XPI4 ? ? 'EXPRESSION TAG' 2 2 1 2MA6 MET A 3 ? UNP Q5XPI4 ? ? 'EXPRESSION TAG' 3 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC aliphatic' 1 3 1 '2D 1H-13C HSQC aromatic CT' 1 4 1 '2D 1H-13C HSQC aromatic noCT' 1 5 1 '3D 1H-15N NOESY' 1 6 1 '3D 1H-15N NOESY NUS' 1 7 1 '3D 1H-13C NOESY aliphatic' 1 8 1 '3D 1H-13C NOESY aliphatic NUS' 1 9 1 '3D 1H-13C NOESY aromatic' 1 10 2 '2D 1H-13C HSQC aliphatic' 1 11 1 '3D C(CO)NH' 1 12 1 '3D H(CCO)NH' 1 13 1 '3D HCCH-COSY' 1 14 3 '2D 1H-15N HSQC' 1 15 3 '2D 1H-13C HSQC aliphatic' 1 16 3 '2D 1H-15N HSQC HIS' 1 17 1 '1D T1 NSQC array' 1 18 1 '1D T2 NHSQC array' 1 19 1 '3D CBCA(CO)NH' 1 20 1 '3D HNCACB' 1 21 1 '3D HBHA(CO)NH' 1 22 1 '3D HNCO' 1 23 1 '2D 1H-15N HSQC NH2 only' 1 24 2 '4D HCCH NOESY' 1 25 2 '3D CCH-TOCSY' 1 26 2 '2D 1H-15N HSQC' 1 27 1 '2D 1H-15N HSQC' 1 28 1 '3D HCCH-TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1.0 mM [U-15N] 5% 13C-fractional labeling HR8700A.005, 0.02 % NaN3, 10 mM DTT, 5 mM CaCL2, 100 mM NaCL, 1 x Proteinase Inhibitors, 20 mM MES pH 6.5, 10 % D2O, 50 uM DSS, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;1.0 mM [U-100% 13C; U-100% 15N] HR8700A.005, 0.02 % NaN3, 10 mM DTT, 5 mM CaCL2, 100 mM NaCL, 1 x Proteinase Inhibitors, 20 mM MES pH 6.5, 100 % D2O, 50 uM DSS, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' ;0.9 mM [U-100% 15N] 5% 13C-fractional labeling HR8700A.007, 0.02 % NaN3, 10 mM DTT, 5 mM CaCL2, 100 mM NaCL, 1 x Proteinase Inhibitors, 20 mM MES pH 6.5, 10 % D2O, 50 uM DSS, 90% H2O/10% D2O ; 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 850 Bruker 'Avance II' 1 'Bruker Avance II' 600 Varian INOVA 2 'Varian INOVA' 600 Bruker 'Avance III' 3 'Bruker Avance III' # _pdbx_nmr_refine.entry_id 2MA6 _pdbx_nmr_refine.method 'simulated annealing, null' _pdbx_nmr_refine.details 'CNS water refinement of Cyana structures via fmcGui, null' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MA6 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MA6 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' 'refinemen,structure solution,geometry optimization' CNS 1.3 1 'Guntert, Mumenthaler and Wuthrich' 'refinement,geometry optimization,structure solution' CYANA 3.0 2 'Huang, Tejero, Powers and Montelione' 'data analysis,refinement' AutoStructure 2.1 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe NMRPipe-2008 4 'Bruker Biospin' collection TOPSPIN 2.4 5 Varian collection VNMRJ vnmrj_1.1_D 6 'Bahrami, Markley, Assadi, and Eghbalnia' 'chemical shift assignment' PINE ? 7 Goddard 'data analysis' SPARKY 3.113 8 'Shen, Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS+ 'Version 1.2009.0721.18' 9 'Bhattacharya, Montelione' 'structure validation' PSVS 1.4 10 'Alex Lemak, Cheryl Arrowmith' refinement FMCGUI fmcgui2.5_linux 11 ? refinement CNS ? 12 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MA6 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MA6 _struct.title ;Solution NMR Structure of the RING finger domain from the Kip1 ubiquitination-promoting E3 complex protein 1 (KPC1/RNF123) from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR8700A ; _struct.pdbx_descriptor 'E3 ubiquitin-protein ligase RNF123 (E.C.6.3.2.-)' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MA6 _struct_keywords.pdbx_keywords LIGASE _struct_keywords.text ;Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, NESG, PSI-Biology, Protein Structure Initiative, Ring fing domain, Zinc binding protein, LIGASE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id CYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 31 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 39 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id CYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 31 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 39 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A HIS 28 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 28 A ZN 102 1_555 ? ? ? ? ? ? ? 2.066 ? metalc2 metalc ? ? A CYS 34 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 34 A ZN 101 1_555 ? ? ? ? ? ? ? 2.312 ? metalc3 metalc ? ? A CYS 26 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 26 A ZN 102 1_555 ? ? ? ? ? ? ? 2.315 ? metalc4 metalc ? ? A CYS 31 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 31 A ZN 101 1_555 ? ? ? ? ? ? ? 2.339 ? metalc5 metalc ? ? A CYS 48 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 48 A ZN 102 1_555 ? ? ? ? ? ? ? 2.345 ? metalc6 metalc ? ? A CYS 45 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 45 A ZN 102 1_555 ? ? ? ? ? ? ? 2.346 ? metalc7 metalc ? ? A CYS 11 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 11 A ZN 101 1_555 ? ? ? ? ? ? ? 2.350 ? metalc8 metalc ? ? A CYS 14 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 14 A ZN 101 1_555 ? ? ? ? ? ? ? 2.352 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 1 -2.89 2 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 2 -1.76 3 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 3 4.47 4 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 4 4.24 5 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 5 -1.30 6 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 6 -3.09 7 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 7 -2.38 8 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 8 3.15 9 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 9 -1.94 10 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 10 1.85 11 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 11 -3.30 12 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 12 -3.62 13 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 13 7.61 14 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 14 1.74 15 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 15 0.41 16 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 16 -0.27 17 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 17 3.34 18 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 18 2.21 19 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 19 3.44 20 GLN 24 A . ? GLN 24 A PRO 25 A ? PRO 25 A 20 -9.43 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 28 ? SER A 30 ? HIS A 28 SER A 30 A 2 ALA A 21 ? GLN A 24 ? ALA A 21 GLN A 24 A 3 SER A 54 ? ASP A 57 ? SER A 54 ASP A 57 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O HIS A 28 ? O HIS A 28 N PHE A 23 ? N PHE A 23 A 2 3 N VAL A 22 ? N VAL A 22 O GLU A 56 ? O GLU A 56 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 101' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 102' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 11 ? CYS A 11 . ? 1_555 ? 2 AC1 4 CYS A 14 ? CYS A 14 . ? 1_555 ? 3 AC1 4 CYS A 31 ? CYS A 31 . ? 1_555 ? 4 AC1 4 CYS A 34 ? CYS A 34 . ? 1_555 ? 5 AC2 4 CYS A 26 ? CYS A 26 . ? 1_555 ? 6 AC2 4 HIS A 28 ? HIS A 28 . ? 1_555 ? 7 AC2 4 CYS A 45 ? CYS A 45 . ? 1_555 ? 8 AC2 4 CYS A 48 ? CYS A 48 . ? 1_555 ? # _atom_sites.entry_id 2MA6 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 HIS 2 2 2 HIS HIS A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 TRP 58 58 58 TRP TRP A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLY 61 61 61 GLY GLY A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 101 62 ZN ZN A . C 2 ZN 1 102 63 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 28 ? A HIS 28 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 26 ? A CYS 26 ? 1_555 107.3 ? 2 ND1 ? A HIS 28 ? A HIS 28 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 48 ? A CYS 48 ? 1_555 110.3 ? 3 SG ? A CYS 26 ? A CYS 26 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 48 ? A CYS 48 ? 1_555 111.7 ? 4 ND1 ? A HIS 28 ? A HIS 28 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 45 ? A CYS 45 ? 1_555 108.6 ? 5 SG ? A CYS 26 ? A CYS 26 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 45 ? A CYS 45 ? 1_555 109.6 ? 6 SG ? A CYS 48 ? A CYS 48 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 45 ? A CYS 45 ? 1_555 109.3 ? 7 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 108.3 ? 8 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 11 ? A CYS 11 ? 1_555 108.3 ? 9 SG ? A CYS 31 ? A CYS 31 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 11 ? A CYS 11 ? 1_555 110.7 ? 10 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 14 ? A CYS 14 ? 1_555 108.2 ? 11 SG ? A CYS 31 ? A CYS 31 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 14 ? A CYS 14 ? 1_555 110.3 ? 12 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 14 ? A CYS 14 ? 1_555 110.9 ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2013-07-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id HR8700A.005-1 1.0 ? mM '[U-15N] 5% 13C-fractional labeling' 1 NaN3-2 0.02 ? % ? 1 DTT-3 10 ? mM ? 1 CaCL2-4 5 ? mM ? 1 NaCL-5 100 ? mM ? 1 'Proteinase Inhibitors-6' 1 ? % ? 1 'MES pH 6.5-7' 20 ? mM ? 1 D2O-8 10 ? % ? 1 DSS-9 50 ? uM ? 1 HR8700A.005-10 1.0 ? mM '[U-100% 13C; U-100% 15N]' 2 NaN3-11 0.02 ? % ? 2 DTT-12 10 ? mM ? 2 CaCL2-13 5 ? mM ? 2 NaCL-14 100 ? mM ? 2 'Proteinase Inhibitors-15' 1 ? % ? 2 'MES pH 6.5-16' 20 ? mM ? 2 D2O-17 100 ? % ? 2 DSS-18 50 ? uM ? 2 HR8700A.007-19 0.9 ? mM '[U-100% 15N] 5% 13C-fractional labeling' 3 NaN3-20 0.02 ? % ? 3 DTT-21 10 ? mM ? 3 CaCL2-22 5 ? mM ? 3 NaCL-23 100 ? mM ? 3 'Proteinase Inhibitors-24' 1 ? % ? 3 'MES pH 6.5-25' 20 ? mM ? 3 D2O-26 10 ? % ? 3 DSS-27 50 ? uM ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 8 ? ? -137.60 -156.58 2 1 ASP A 9 ? ? -81.50 43.34 3 1 TYR A 15 ? ? 68.03 -47.02 4 1 SER A 20 ? ? -150.17 -4.01 5 1 SER A 30 ? ? -161.19 -169.70 6 1 ASN A 41 ? ? -116.09 -74.19 7 1 ASN A 42 ? ? -125.28 -168.09 8 1 CYS A 45 ? ? -94.19 36.15 9 1 PHE A 46 ? ? 54.16 -82.39 10 1 CYS A 48 ? ? -143.14 -7.13 11 2 SER A 6 ? ? -91.97 53.42 12 2 GLU A 8 ? ? 61.33 -178.08 13 2 CYS A 14 ? ? -124.75 -51.38 14 2 TYR A 15 ? ? 71.69 -8.83 15 2 SER A 20 ? ? -142.65 15.27 16 2 CYS A 26 ? ? -142.95 -39.84 17 2 SER A 30 ? ? -174.40 -176.19 18 2 ASN A 41 ? ? -116.90 -73.58 19 2 ASN A 42 ? ? -125.39 -167.26 20 2 PHE A 46 ? ? 63.40 -85.69 21 3 GLU A 7 ? ? 69.46 177.86 22 3 TYR A 15 ? ? 74.66 -37.96 23 3 PRO A 18 ? ? -77.49 -169.80 24 3 SER A 20 ? ? -141.56 -10.96 25 3 CYS A 26 ? ? -67.08 -70.41 26 3 ASN A 41 ? ? -115.98 -75.84 27 3 PHE A 46 ? ? 47.71 -90.84 28 4 MET A 3 ? ? -161.37 81.57 29 4 PRO A 4 ? ? -64.85 85.18 30 4 ASP A 9 ? ? -66.42 75.39 31 4 TYR A 15 ? ? 75.30 -36.23 32 4 PRO A 18 ? ? -73.98 -165.08 33 4 ASN A 41 ? ? -133.92 -68.25 34 4 CYS A 45 ? ? -93.19 50.23 35 4 PHE A 46 ? ? 52.44 -84.03 36 5 TYR A 15 ? ? 81.90 -35.87 37 5 PRO A 18 ? ? -79.26 -165.02 38 5 ASN A 41 ? ? -106.28 -73.50 39 5 ASN A 42 ? ? -103.06 -168.60 40 5 LYS A 43 ? ? -150.55 22.33 41 5 CYS A 45 ? ? -91.73 39.24 42 5 PHE A 46 ? ? 57.05 -84.98 43 6 PRO A 4 ? ? -53.87 92.83 44 6 THR A 5 ? ? -138.29 -42.31 45 6 GLU A 8 ? ? -72.99 22.03 46 6 CYS A 11 ? ? -58.66 108.08 47 6 CYS A 14 ? ? -131.03 -55.09 48 6 PRO A 18 ? ? -84.15 47.26 49 6 ILE A 19 ? ? 68.21 143.63 50 6 SER A 20 ? ? -155.11 19.90 51 6 ASN A 41 ? ? -100.73 -67.90 52 6 PHE A 46 ? ? 42.97 -85.93 53 6 LYS A 49 ? ? 54.26 17.74 54 7 THR A 5 ? ? -68.15 98.51 55 7 TYR A 15 ? ? 77.78 -51.89 56 7 ILE A 19 ? ? 61.88 170.42 57 7 SER A 20 ? ? -156.31 -37.91 58 7 PRO A 25 ? ? -93.59 37.53 59 7 CYS A 26 ? ? -75.66 -78.64 60 7 SER A 30 ? ? -164.28 -168.91 61 7 ASN A 41 ? ? -104.38 -68.58 62 7 PHE A 46 ? ? 47.37 -81.48 63 8 THR A 5 ? ? -147.84 -44.08 64 8 GLU A 8 ? ? -118.43 70.98 65 8 CYS A 11 ? ? -53.07 109.29 66 8 TYR A 15 ? ? 67.27 -60.44 67 8 PRO A 18 ? ? -75.39 -164.42 68 8 SER A 30 ? ? -166.37 -164.57 69 8 ASN A 41 ? ? -149.41 -57.58 70 8 LYS A 43 ? ? -159.69 54.18 71 8 PHE A 47 ? ? -76.91 -75.23 72 9 THR A 5 ? ? -163.83 -30.74 73 9 SER A 6 ? ? 66.62 93.20 74 9 GLU A 8 ? ? -99.65 56.20 75 9 TYR A 15 ? ? 75.19 -39.37 76 9 PRO A 18 ? ? -79.09 -159.63 77 9 SER A 30 ? ? -172.18 -179.87 78 9 ASN A 41 ? ? -76.09 -70.41 79 9 CYS A 45 ? ? -96.02 54.35 80 9 PHE A 46 ? ? 49.68 -84.61 81 9 ASP A 57 ? ? -67.63 96.60 82 10 HIS A 2 ? ? -167.40 93.87 83 10 MET A 3 ? ? 59.33 92.60 84 10 THR A 5 ? ? 47.12 25.58 85 10 TYR A 15 ? ? 80.39 -42.42 86 10 PRO A 18 ? ? -75.64 -163.51 87 10 SER A 30 ? ? -170.20 -176.07 88 10 ASN A 41 ? ? -134.83 -70.42 89 10 CYS A 45 ? ? -94.51 37.00 90 10 PHE A 46 ? ? 58.65 -86.32 91 10 PHE A 47 ? ? -87.66 44.71 92 10 CYS A 48 ? ? 175.80 -31.96 93 11 THR A 5 ? ? 70.25 159.95 94 11 GLU A 8 ? ? 53.39 -152.10 95 11 CYS A 14 ? ? -134.39 -51.62 96 11 TYR A 15 ? ? 78.95 -40.08 97 11 PRO A 18 ? ? -76.02 -165.70 98 11 SER A 20 ? ? -136.13 -32.65 99 11 CYS A 26 ? ? -143.11 -64.52 100 11 ASN A 41 ? ? -105.87 -67.22 101 11 CYS A 45 ? ? -90.24 52.75 102 11 PHE A 46 ? ? 54.97 -80.25 103 12 HIS A 2 ? ? 60.31 91.38 104 12 GLU A 7 ? ? 56.92 -164.43 105 12 GLU A 8 ? ? 66.81 176.32 106 12 ASP A 9 ? ? -83.28 39.20 107 12 TYR A 15 ? ? 75.48 -46.45 108 12 CYS A 26 ? ? -81.36 -74.81 109 12 ASN A 41 ? ? -112.28 -75.12 110 12 CYS A 45 ? ? -94.62 46.05 111 12 PHE A 46 ? ? 54.19 -82.90 112 13 PRO A 4 ? ? -56.21 103.30 113 13 GLU A 7 ? ? -95.94 33.55 114 13 TYR A 15 ? ? 78.39 -40.32 115 13 SER A 20 ? ? -150.13 19.73 116 13 ASN A 41 ? ? -111.34 -73.13 117 13 CYS A 45 ? ? -91.39 38.65 118 13 PHE A 46 ? ? 57.43 -84.66 119 13 LYS A 49 ? ? 59.94 13.19 120 14 GLU A 7 ? ? -116.26 -77.63 121 14 TYR A 15 ? ? 80.02 -41.57 122 14 PRO A 18 ? ? -78.82 -166.23 123 14 SER A 20 ? ? -141.96 -14.70 124 14 PRO A 25 ? ? -97.95 31.15 125 14 SER A 30 ? ? -169.19 -166.43 126 14 ASN A 41 ? ? -121.09 -64.91 127 14 PHE A 46 ? ? 58.93 -86.00 128 14 LYS A 49 ? ? 66.97 -2.27 129 15 HIS A 2 ? ? 66.67 117.45 130 15 TYR A 15 ? ? 79.98 -54.77 131 15 PRO A 18 ? ? -75.27 -167.83 132 15 SER A 20 ? ? -154.87 25.12 133 15 CYS A 45 ? ? -87.70 37.37 134 15 PHE A 46 ? ? 57.60 -85.30 135 15 LYS A 49 ? ? 66.39 -4.18 136 15 TRP A 58 ? ? -69.46 95.55 137 16 MET A 3 ? ? -164.43 81.94 138 16 THR A 5 ? ? 70.99 -5.88 139 16 GLU A 8 ? ? -163.31 -169.03 140 16 TYR A 15 ? ? 76.81 -39.17 141 16 PRO A 18 ? ? -72.66 -166.07 142 16 ASN A 41 ? ? -84.18 -76.33 143 16 PHE A 47 ? ? -139.38 -77.20 144 17 THR A 5 ? ? -145.67 -82.53 145 17 GLU A 7 ? ? 64.45 -178.08 146 17 GLU A 8 ? ? -116.59 -163.31 147 17 TYR A 15 ? ? 77.09 -32.29 148 17 PRO A 18 ? ? -76.91 -159.60 149 17 ASN A 41 ? ? -106.02 -73.86 150 17 CYS A 45 ? ? -91.66 32.87 151 17 PHE A 46 ? ? 57.70 -83.46 152 18 ASP A 9 ? ? 75.17 77.37 153 18 TYR A 15 ? ? 74.84 -43.32 154 18 PRO A 18 ? ? -71.36 -164.55 155 18 SER A 30 ? ? -168.72 -157.34 156 18 ASN A 41 ? ? -105.15 -72.89 157 18 CYS A 45 ? ? -93.61 32.50 158 18 PHE A 46 ? ? 59.40 -84.35 159 19 MET A 3 ? ? 61.96 90.48 160 19 ASP A 9 ? ? -77.83 40.53 161 19 CYS A 14 ? ? -133.33 -42.06 162 19 TYR A 15 ? ? 77.94 -37.64 163 19 ILE A 19 ? ? 63.07 155.50 164 19 SER A 20 ? ? -159.81 -7.60 165 19 PRO A 25 ? ? -92.44 32.21 166 19 CYS A 26 ? ? -83.49 -72.83 167 19 SER A 30 ? ? -142.13 -155.94 168 19 ASN A 41 ? ? -131.37 -73.17 169 19 LYS A 43 ? ? -145.34 35.36 170 19 CYS A 48 ? ? -149.61 22.72 171 19 LYS A 49 ? ? 71.24 -28.22 172 20 TYR A 15 ? ? 74.69 -44.64 173 20 SER A 20 ? ? -142.29 13.42 174 20 ASN A 41 ? ? -88.30 -75.81 175 20 CYS A 45 ? ? -98.49 45.87 176 20 PHE A 46 ? ? 57.39 -87.31 177 20 ILE A 52 ? ? -59.51 105.70 178 20 ASP A 57 ? ? -69.46 96.80 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #