data_2MAG # _entry.id 2MAG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MAG pdb_00002mag 10.2210/pdb2mag/pdb WWPDB D_1000178329 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-04-08 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2016-10-26 5 'Structure model' 1 4 2024-06-05 6 'Structure model' 1 5 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Structure summary' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' 7 5 'Structure model' Other 8 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' chem_comp_atom 2 5 'Structure model' chem_comp_bond 3 5 'Structure model' database_2 4 5 'Structure model' pdbx_database_status 5 5 'Structure model' struct_conn 6 5 'Structure model' struct_site 7 6 'Structure model' pdbx_entry_details 8 6 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_pdbx_database_status.process_site' 4 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 8 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 13 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 14 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 15 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 16 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 17 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2MAG _pdbx_database_status.recvd_initial_deposition_date 1997-12-19 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gesell, J.J.' 1 'Zasloff, M.' 2 'Opella, S.J.' 3 # _citation.id primary _citation.title ;Two-dimensional 1H NMR experiments show that the 23-residue magainin antibiotic peptide is an alpha-helix in dodecylphosphocholine micelles, sodium dodecylsulfate micelles, and trifluoroethanol/water solution. ; _citation.journal_abbrev J.Biomol.NMR _citation.journal_volume 9 _citation.page_first 127 _citation.page_last 135 _citation.year 1997 _citation.journal_id_ASTM JBNME9 _citation.country NE _citation.journal_id_ISSN 0925-2738 _citation.journal_id_CSD 0800 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9090128 _citation.pdbx_database_id_DOI 10.1023/A:1018698002314 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gesell, J.' 1 ? primary 'Zasloff, M.' 2 ? primary 'Opella, S.J.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'MAGAININ 2' _entity.formula_weight 2469.945 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'GIGKFLHSAKKFGKAFVGEIMNS(NH2)' _entity_poly.pdbx_seq_one_letter_code_can GIGKFLHSAKKFGKAFVGEIMNSX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ILE n 1 3 GLY n 1 4 LYS n 1 5 PHE n 1 6 LEU n 1 7 HIS n 1 8 SER n 1 9 ALA n 1 10 LYS n 1 11 LYS n 1 12 PHE n 1 13 GLY n 1 14 LYS n 1 15 ALA n 1 16 PHE n 1 17 VAL n 1 18 GLY n 1 19 GLU n 1 20 ILE n 1 21 MET n 1 22 ASN n 1 23 SER n 1 24 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Xenopus laevis' _pdbx_entity_src_syn.organism_common_name 'African clawed frog' _pdbx_entity_src_syn.ncbi_taxonomy_id 8355 _pdbx_entity_src_syn.details 'THE PEPTIDE WAS PREPARED BY SOLID-PHASE SYNTHESIS' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 NH2 24 24 24 NH2 NH2 A . n # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # _cell.entry_id 2MAG _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2MAG _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 2MAG _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2MAG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2MAG _struct.title 'NMR STRUCTURE OF MAGAININ 2 IN DPC MICELLES, 10 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MAG _struct_keywords.pdbx_keywords ANTIBIOTIC _struct_keywords.text 'ANTIBIOTIC, MAGAININ, MEMBRANE, AMPHIPATHIC HELIX, MICELLE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MAGA_XENLA _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P11006 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MFKGLFICSLIAVICANALPQPEASADEDMDEREVRGIGKFLHSAGKFGKAFVGEIMKSKRDAEAVGPEAFADEDLDERE VRGIGKFLHSAKKFGKAFVGEIMNSKRDAEAVGPEAFADEDLDEREVRGIGKFLHSAKKFGKAFVGEIMNSKRDAEAVGP EAFADEDLDEREVRGIGKFLHSAKKFGKAFVGEIMNSKRDAEAVGPEAFADEDFDEREVRGIGKFLHSAKKFGKAFVGEI MNSKRDAEAVGPEAFADEDLDEREVRGIGKFLHSAKKFGKAFVGEIMNSKRDAEAVDDRRWVE ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MAG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 23 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P11006 _struct_ref_seq.db_align_beg 267 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 289 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 23 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id LYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 4 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id MET _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 21 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 4 _struct_conf.end_auth_comp_id MET _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 21 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id SER _struct_conn.ptnr1_label_seq_id 23 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id NH2 _struct_conn.ptnr2_label_seq_id 24 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id SER _struct_conn.ptnr1_auth_seq_id 23 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id NH2 _struct_conn.ptnr2_auth_seq_id 24 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.345 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id NH2 _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 24 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id SER _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 23 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id NH2 _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 24 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id SER _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 23 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id SER _pdbx_modification_feature.ref_pcm_id 6 _pdbx_modification_feature.ref_comp_id NH2 _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Terminal amidation' # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id NH2 _struct_site.pdbx_auth_seq_id 24 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 1 _struct_site.details 'BINDING SITE FOR RESIDUE NH2 A 24' # _struct_site_gen.id 1 _struct_site_gen.site_id AC1 _struct_site_gen.pdbx_num_res 1 _struct_site_gen.label_comp_id SER _struct_site_gen.label_asym_id A _struct_site_gen.label_seq_id 23 _struct_site_gen.pdbx_auth_ins_code ? _struct_site_gen.auth_comp_id SER _struct_site_gen.auth_asym_id A _struct_site_gen.auth_seq_id 23 _struct_site_gen.label_atom_id . _struct_site_gen.label_alt_id ? _struct_site_gen.symmetry 1_555 _struct_site_gen.details ? # _pdbx_entry_details.entry_id 2MAG _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 2 ? ? -76.69 26.44 2 1 LYS A 10 ? ? -63.61 -70.35 3 2 ASN A 22 ? ? -72.20 -87.53 4 3 ILE A 2 ? ? -75.92 27.79 5 5 ILE A 2 ? ? -82.28 32.35 6 5 PHE A 5 ? ? -47.38 -70.97 7 6 ASN A 22 ? ? -39.69 -86.65 8 7 ASN A 22 ? ? -69.12 -84.87 9 10 ASN A 22 ? ? 96.24 52.45 # _pdbx_nmr_ensemble.entry_id 2MAG _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST ENERGY' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 4.1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 TOCSY 1 3 1 DQF-COSY 1 # _pdbx_nmr_refine.entry_id 2MAG _pdbx_nmr_refine.method 'DISTANCE GEOMETRY, SIMULATED ANNEALING' _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE.' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement 'X-PLOR INTERFACED THROUGH NMRCOMPASS' NMRCOMPASS BRUNGER 1 'structure solution' 'BIOSYM NMRCOMPASS' NMRCOMPASS ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 GLU N N N N 31 GLU CA C N S 32 GLU C C N N 33 GLU O O N N 34 GLU CB C N N 35 GLU CG C N N 36 GLU CD C N N 37 GLU OE1 O N N 38 GLU OE2 O N N 39 GLU OXT O N N 40 GLU H H N N 41 GLU H2 H N N 42 GLU HA H N N 43 GLU HB2 H N N 44 GLU HB3 H N N 45 GLU HG2 H N N 46 GLU HG3 H N N 47 GLU HE2 H N N 48 GLU HXT H N N 49 GLY N N N N 50 GLY CA C N N 51 GLY C C N N 52 GLY O O N N 53 GLY OXT O N N 54 GLY H H N N 55 GLY H2 H N N 56 GLY HA2 H N N 57 GLY HA3 H N N 58 GLY HXT H N N 59 HIS N N N N 60 HIS CA C N S 61 HIS C C N N 62 HIS O O N N 63 HIS CB C N N 64 HIS CG C Y N 65 HIS ND1 N Y N 66 HIS CD2 C Y N 67 HIS CE1 C Y N 68 HIS NE2 N Y N 69 HIS OXT O N N 70 HIS H H N N 71 HIS H2 H N N 72 HIS HA H N N 73 HIS HB2 H N N 74 HIS HB3 H N N 75 HIS HD1 H N N 76 HIS HD2 H N N 77 HIS HE1 H N N 78 HIS HE2 H N N 79 HIS HXT H N N 80 ILE N N N N 81 ILE CA C N S 82 ILE C C N N 83 ILE O O N N 84 ILE CB C N S 85 ILE CG1 C N N 86 ILE CG2 C N N 87 ILE CD1 C N N 88 ILE OXT O N N 89 ILE H H N N 90 ILE H2 H N N 91 ILE HA H N N 92 ILE HB H N N 93 ILE HG12 H N N 94 ILE HG13 H N N 95 ILE HG21 H N N 96 ILE HG22 H N N 97 ILE HG23 H N N 98 ILE HD11 H N N 99 ILE HD12 H N N 100 ILE HD13 H N N 101 ILE HXT H N N 102 LEU N N N N 103 LEU CA C N S 104 LEU C C N N 105 LEU O O N N 106 LEU CB C N N 107 LEU CG C N N 108 LEU CD1 C N N 109 LEU CD2 C N N 110 LEU OXT O N N 111 LEU H H N N 112 LEU H2 H N N 113 LEU HA H N N 114 LEU HB2 H N N 115 LEU HB3 H N N 116 LEU HG H N N 117 LEU HD11 H N N 118 LEU HD12 H N N 119 LEU HD13 H N N 120 LEU HD21 H N N 121 LEU HD22 H N N 122 LEU HD23 H N N 123 LEU HXT H N N 124 LYS N N N N 125 LYS CA C N S 126 LYS C C N N 127 LYS O O N N 128 LYS CB C N N 129 LYS CG C N N 130 LYS CD C N N 131 LYS CE C N N 132 LYS NZ N N N 133 LYS OXT O N N 134 LYS H H N N 135 LYS H2 H N N 136 LYS HA H N N 137 LYS HB2 H N N 138 LYS HB3 H N N 139 LYS HG2 H N N 140 LYS HG3 H N N 141 LYS HD2 H N N 142 LYS HD3 H N N 143 LYS HE2 H N N 144 LYS HE3 H N N 145 LYS HZ1 H N N 146 LYS HZ2 H N N 147 LYS HZ3 H N N 148 LYS HXT H N N 149 MET N N N N 150 MET CA C N S 151 MET C C N N 152 MET O O N N 153 MET CB C N N 154 MET CG C N N 155 MET SD S N N 156 MET CE C N N 157 MET OXT O N N 158 MET H H N N 159 MET H2 H N N 160 MET HA H N N 161 MET HB2 H N N 162 MET HB3 H N N 163 MET HG2 H N N 164 MET HG3 H N N 165 MET HE1 H N N 166 MET HE2 H N N 167 MET HE3 H N N 168 MET HXT H N N 169 NH2 N N N N 170 NH2 HN1 H N N 171 NH2 HN2 H N N 172 PHE N N N N 173 PHE CA C N S 174 PHE C C N N 175 PHE O O N N 176 PHE CB C N N 177 PHE CG C Y N 178 PHE CD1 C Y N 179 PHE CD2 C Y N 180 PHE CE1 C Y N 181 PHE CE2 C Y N 182 PHE CZ C Y N 183 PHE OXT O N N 184 PHE H H N N 185 PHE H2 H N N 186 PHE HA H N N 187 PHE HB2 H N N 188 PHE HB3 H N N 189 PHE HD1 H N N 190 PHE HD2 H N N 191 PHE HE1 H N N 192 PHE HE2 H N N 193 PHE HZ H N N 194 PHE HXT H N N 195 SER N N N N 196 SER CA C N S 197 SER C C N N 198 SER O O N N 199 SER CB C N N 200 SER OG O N N 201 SER OXT O N N 202 SER H H N N 203 SER H2 H N N 204 SER HA H N N 205 SER HB2 H N N 206 SER HB3 H N N 207 SER HG H N N 208 SER HXT H N N 209 VAL N N N N 210 VAL CA C N S 211 VAL C C N N 212 VAL O O N N 213 VAL CB C N N 214 VAL CG1 C N N 215 VAL CG2 C N N 216 VAL OXT O N N 217 VAL H H N N 218 VAL H2 H N N 219 VAL HA H N N 220 VAL HB H N N 221 VAL HG11 H N N 222 VAL HG12 H N N 223 VAL HG13 H N N 224 VAL HG21 H N N 225 VAL HG22 H N N 226 VAL HG23 H N N 227 VAL HXT H N N 228 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 GLU N CA sing N N 29 GLU N H sing N N 30 GLU N H2 sing N N 31 GLU CA C sing N N 32 GLU CA CB sing N N 33 GLU CA HA sing N N 34 GLU C O doub N N 35 GLU C OXT sing N N 36 GLU CB CG sing N N 37 GLU CB HB2 sing N N 38 GLU CB HB3 sing N N 39 GLU CG CD sing N N 40 GLU CG HG2 sing N N 41 GLU CG HG3 sing N N 42 GLU CD OE1 doub N N 43 GLU CD OE2 sing N N 44 GLU OE2 HE2 sing N N 45 GLU OXT HXT sing N N 46 GLY N CA sing N N 47 GLY N H sing N N 48 GLY N H2 sing N N 49 GLY CA C sing N N 50 GLY CA HA2 sing N N 51 GLY CA HA3 sing N N 52 GLY C O doub N N 53 GLY C OXT sing N N 54 GLY OXT HXT sing N N 55 HIS N CA sing N N 56 HIS N H sing N N 57 HIS N H2 sing N N 58 HIS CA C sing N N 59 HIS CA CB sing N N 60 HIS CA HA sing N N 61 HIS C O doub N N 62 HIS C OXT sing N N 63 HIS CB CG sing N N 64 HIS CB HB2 sing N N 65 HIS CB HB3 sing N N 66 HIS CG ND1 sing Y N 67 HIS CG CD2 doub Y N 68 HIS ND1 CE1 doub Y N 69 HIS ND1 HD1 sing N N 70 HIS CD2 NE2 sing Y N 71 HIS CD2 HD2 sing N N 72 HIS CE1 NE2 sing Y N 73 HIS CE1 HE1 sing N N 74 HIS NE2 HE2 sing N N 75 HIS OXT HXT sing N N 76 ILE N CA sing N N 77 ILE N H sing N N 78 ILE N H2 sing N N 79 ILE CA C sing N N 80 ILE CA CB sing N N 81 ILE CA HA sing N N 82 ILE C O doub N N 83 ILE C OXT sing N N 84 ILE CB CG1 sing N N 85 ILE CB CG2 sing N N 86 ILE CB HB sing N N 87 ILE CG1 CD1 sing N N 88 ILE CG1 HG12 sing N N 89 ILE CG1 HG13 sing N N 90 ILE CG2 HG21 sing N N 91 ILE CG2 HG22 sing N N 92 ILE CG2 HG23 sing N N 93 ILE CD1 HD11 sing N N 94 ILE CD1 HD12 sing N N 95 ILE CD1 HD13 sing N N 96 ILE OXT HXT sing N N 97 LEU N CA sing N N 98 LEU N H sing N N 99 LEU N H2 sing N N 100 LEU CA C sing N N 101 LEU CA CB sing N N 102 LEU CA HA sing N N 103 LEU C O doub N N 104 LEU C OXT sing N N 105 LEU CB CG sing N N 106 LEU CB HB2 sing N N 107 LEU CB HB3 sing N N 108 LEU CG CD1 sing N N 109 LEU CG CD2 sing N N 110 LEU CG HG sing N N 111 LEU CD1 HD11 sing N N 112 LEU CD1 HD12 sing N N 113 LEU CD1 HD13 sing N N 114 LEU CD2 HD21 sing N N 115 LEU CD2 HD22 sing N N 116 LEU CD2 HD23 sing N N 117 LEU OXT HXT sing N N 118 LYS N CA sing N N 119 LYS N H sing N N 120 LYS N H2 sing N N 121 LYS CA C sing N N 122 LYS CA CB sing N N 123 LYS CA HA sing N N 124 LYS C O doub N N 125 LYS C OXT sing N N 126 LYS CB CG sing N N 127 LYS CB HB2 sing N N 128 LYS CB HB3 sing N N 129 LYS CG CD sing N N 130 LYS CG HG2 sing N N 131 LYS CG HG3 sing N N 132 LYS CD CE sing N N 133 LYS CD HD2 sing N N 134 LYS CD HD3 sing N N 135 LYS CE NZ sing N N 136 LYS CE HE2 sing N N 137 LYS CE HE3 sing N N 138 LYS NZ HZ1 sing N N 139 LYS NZ HZ2 sing N N 140 LYS NZ HZ3 sing N N 141 LYS OXT HXT sing N N 142 MET N CA sing N N 143 MET N H sing N N 144 MET N H2 sing N N 145 MET CA C sing N N 146 MET CA CB sing N N 147 MET CA HA sing N N 148 MET C O doub N N 149 MET C OXT sing N N 150 MET CB CG sing N N 151 MET CB HB2 sing N N 152 MET CB HB3 sing N N 153 MET CG SD sing N N 154 MET CG HG2 sing N N 155 MET CG HG3 sing N N 156 MET SD CE sing N N 157 MET CE HE1 sing N N 158 MET CE HE2 sing N N 159 MET CE HE3 sing N N 160 MET OXT HXT sing N N 161 NH2 N HN1 sing N N 162 NH2 N HN2 sing N N 163 PHE N CA sing N N 164 PHE N H sing N N 165 PHE N H2 sing N N 166 PHE CA C sing N N 167 PHE CA CB sing N N 168 PHE CA HA sing N N 169 PHE C O doub N N 170 PHE C OXT sing N N 171 PHE CB CG sing N N 172 PHE CB HB2 sing N N 173 PHE CB HB3 sing N N 174 PHE CG CD1 doub Y N 175 PHE CG CD2 sing Y N 176 PHE CD1 CE1 sing Y N 177 PHE CD1 HD1 sing N N 178 PHE CD2 CE2 doub Y N 179 PHE CD2 HD2 sing N N 180 PHE CE1 CZ doub Y N 181 PHE CE1 HE1 sing N N 182 PHE CE2 CZ sing Y N 183 PHE CE2 HE2 sing N N 184 PHE CZ HZ sing N N 185 PHE OXT HXT sing N N 186 SER N CA sing N N 187 SER N H sing N N 188 SER N H2 sing N N 189 SER CA C sing N N 190 SER CA CB sing N N 191 SER CA HA sing N N 192 SER C O doub N N 193 SER C OXT sing N N 194 SER CB OG sing N N 195 SER CB HB2 sing N N 196 SER CB HB3 sing N N 197 SER OG HG sing N N 198 SER OXT HXT sing N N 199 VAL N CA sing N N 200 VAL N H sing N N 201 VAL N H2 sing N N 202 VAL CA C sing N N 203 VAL CA CB sing N N 204 VAL CA HA sing N N 205 VAL C O doub N N 206 VAL C OXT sing N N 207 VAL CB CG1 sing N N 208 VAL CB CG2 sing N N 209 VAL CB HB sing N N 210 VAL CG1 HG11 sing N N 211 VAL CG1 HG12 sing N N 212 VAL CG1 HG13 sing N N 213 VAL CG2 HG21 sing N N 214 VAL CG2 HG22 sing N N 215 VAL CG2 HG23 sing N N 216 VAL OXT HXT sing N N 217 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DMX600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2MAG _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_