data_2MHD # _entry.id 2MHD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MHD pdb_00002mhd 10.2210/pdb2mhd/pdb RCSB RCSB103617 ? ? BMRB 19627 ? 10.13018/BMR19627 WWPDB D_1000103617 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-12-04 2 'Structure model' 1 1 2015-03-04 3 'Structure model' 1 2 2020-09-09 4 'Structure model' 1 3 2023-02-01 5 'Structure model' 1 4 2023-06-14 6 'Structure model' 1 5 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Database references' 6 5 'Structure model' Other 7 6 'Structure model' 'Data collection' 8 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' database_2 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' pdbx_database_status 7 6 'Structure model' chem_comp_atom 8 6 'Structure model' chem_comp_bond 9 6 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.title' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' 6 4 'Structure model' '_struct_ref_seq_dif.details' 7 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 8 6 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MHD _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-11-21 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 19627 BMRB unspecified . JCSG-417984 TargetTrack unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Shnitkind, S.' 1 ? 'Dutta, S.K.' 2 ? 'Serrano, P.' 3 ? 'Geralt, M.' 4 ? 'Wuthrich, K.' 5 ? 'Joint Center for Structural Genomics (JCSG)' 6 ? # _citation.id primary _citation.title 'NMR structure of the protein BACUNI_03114 from Bacteroides uniformis ATCC 8492' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shnitkind, S.' 1 ? primary 'Dutta, S.K.' 2 ? primary 'Serrano, P.' 3 ? primary 'Geralt, M.' 4 ? primary 'Wuthrich, K.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein' _entity.formula_weight 12814.306 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 24-132' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GDEDDKVEIPQLVGKWIVKEPVLQDDFVTCYTFNADKTYEVYTGSPLSNGVPFRGTYIISLDEKLIKLYDKEEHCTEQYH ILKLTSKEMKWENASPKDGNSDKRLEKYND ; _entity_poly.pdbx_seq_one_letter_code_can ;GDEDDKVEIPQLVGKWIVKEPVLQDDFVTCYTFNADKTYEVYTGSPLSNGVPFRGTYIISLDEKLIKLYDKEEHCTEQYH ILKLTSKEMKWENASPKDGNSDKRLEKYND ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier 'JCSG-417984 ' # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ASP n 1 3 GLU n 1 4 ASP n 1 5 ASP n 1 6 LYS n 1 7 VAL n 1 8 GLU n 1 9 ILE n 1 10 PRO n 1 11 GLN n 1 12 LEU n 1 13 VAL n 1 14 GLY n 1 15 LYS n 1 16 TRP n 1 17 ILE n 1 18 VAL n 1 19 LYS n 1 20 GLU n 1 21 PRO n 1 22 VAL n 1 23 LEU n 1 24 GLN n 1 25 ASP n 1 26 ASP n 1 27 PHE n 1 28 VAL n 1 29 THR n 1 30 CYS n 1 31 TYR n 1 32 THR n 1 33 PHE n 1 34 ASN n 1 35 ALA n 1 36 ASP n 1 37 LYS n 1 38 THR n 1 39 TYR n 1 40 GLU n 1 41 VAL n 1 42 TYR n 1 43 THR n 1 44 GLY n 1 45 SER n 1 46 PRO n 1 47 LEU n 1 48 SER n 1 49 ASN n 1 50 GLY n 1 51 VAL n 1 52 PRO n 1 53 PHE n 1 54 ARG n 1 55 GLY n 1 56 THR n 1 57 TYR n 1 58 ILE n 1 59 ILE n 1 60 SER n 1 61 LEU n 1 62 ASP n 1 63 GLU n 1 64 LYS n 1 65 LEU n 1 66 ILE n 1 67 LYS n 1 68 LEU n 1 69 TYR n 1 70 ASP n 1 71 LYS n 1 72 GLU n 1 73 GLU n 1 74 HIS n 1 75 CYS n 1 76 THR n 1 77 GLU n 1 78 GLN n 1 79 TYR n 1 80 HIS n 1 81 ILE n 1 82 LEU n 1 83 LYS n 1 84 LEU n 1 85 THR n 1 86 SER n 1 87 LYS n 1 88 GLU n 1 89 MET n 1 90 LYS n 1 91 TRP n 1 92 GLU n 1 93 ASN n 1 94 ALA n 1 95 SER n 1 96 PRO n 1 97 LYS n 1 98 ASP n 1 99 GLY n 1 100 ASN n 1 101 SER n 1 102 ASP n 1 103 LYS n 1 104 ARG n 1 105 LEU n 1 106 GLU n 1 107 LYS n 1 108 TYR n 1 109 ASN n 1 110 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BACUNI_03114 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacteroides uniformis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 411479 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 8492 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain Bl21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector SpeedET _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 CYS 75 75 75 CYS CYS A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 MET 89 89 89 MET MET A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 TRP 91 91 91 TRP TRP A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 TYR 108 108 108 TYR TYR A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 ASP 110 110 110 ASP ASP A . n # _cell.entry_id 2MHD _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2MHD _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MHD _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MHD _struct.title 'NMR structure of the protein BACUNI_03114 from Bacteroides uniformis ATCC 8492' _struct.pdbx_model_details 'closest to the average, model8' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MHD _struct_keywords.pdbx_keywords 'Structural genomics, Unknown function' _struct_keywords.text 'Lipocalin 4, Beta barrel, Structural genomics, Unknown function, PSI-Biology, Joint Center for Structural Genomics, JCSG' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A7V6A1_BACUN _struct_ref.pdbx_db_accession A7V6A1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DEDDKVEIPQLVGKWIVKEPVLQDDFVTCYTFNADKTYEVYTGSPLSNGVPFRGTYIISLDEKLIKLYDKEEHCTEQYHI LKLTSKEMKWENASPKDGNSDKRLEKYND ; _struct_ref.pdbx_align_begin 24 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MHD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 110 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A7V6A1 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 132 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 110 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2MHD _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code A7V6A1 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ILE _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 9 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id VAL _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 13 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ILE _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 9 _struct_conf.end_auth_comp_id VAL _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 13 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 20 A . ? GLU 20 A PRO 21 A ? PRO 21 A 1 -17.31 2 GLU 20 A . ? GLU 20 A PRO 21 A ? PRO 21 A 2 -16.33 3 GLU 20 A . ? GLU 20 A PRO 21 A ? PRO 21 A 3 -7.01 4 GLU 20 A . ? GLU 20 A PRO 21 A ? PRO 21 A 4 -4.51 5 GLU 20 A . ? GLU 20 A PRO 21 A ? PRO 21 A 5 -19.25 6 GLU 20 A . ? GLU 20 A PRO 21 A ? PRO 21 A 6 -16.40 7 GLU 20 A . ? GLU 20 A PRO 21 A ? PRO 21 A 7 -14.91 8 GLU 20 A . ? GLU 20 A PRO 21 A ? PRO 21 A 8 -10.02 9 GLU 20 A . ? GLU 20 A PRO 21 A ? PRO 21 A 9 -17.91 10 GLU 20 A . ? GLU 20 A PRO 21 A ? PRO 21 A 10 -19.18 11 GLU 20 A . ? GLU 20 A PRO 21 A ? PRO 21 A 11 -16.21 12 GLU 20 A . ? GLU 20 A PRO 21 A ? PRO 21 A 12 -3.29 13 GLU 20 A . ? GLU 20 A PRO 21 A ? PRO 21 A 13 0.26 14 GLU 20 A . ? GLU 20 A PRO 21 A ? PRO 21 A 14 -18.11 15 GLU 20 A . ? GLU 20 A PRO 21 A ? PRO 21 A 15 -16.03 16 GLU 20 A . ? GLU 20 A PRO 21 A ? PRO 21 A 16 2.07 17 GLU 20 A . ? GLU 20 A PRO 21 A ? PRO 21 A 17 -6.96 18 GLU 20 A . ? GLU 20 A PRO 21 A ? PRO 21 A 18 -19.38 19 GLU 20 A . ? GLU 20 A PRO 21 A ? PRO 21 A 19 -22.55 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 15 ? ILE A 17 ? LYS A 15 ILE A 17 A 2 CYS A 30 ? PHE A 33 ? CYS A 30 PHE A 33 A 3 TYR A 39 ? VAL A 41 ? TYR A 39 VAL A 41 A 4 PHE A 53 ? SER A 60 ? PHE A 53 SER A 60 A 5 LEU A 65 ? TYR A 69 ? LEU A 65 TYR A 69 A 6 GLU A 77 ? LEU A 84 ? GLU A 77 LEU A 84 A 7 MET A 89 ? GLU A 92 ? MET A 89 GLU A 92 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TRP A 16 ? N TRP A 16 O TYR A 31 ? O TYR A 31 A 2 3 N THR A 32 ? N THR A 32 O GLU A 40 ? O GLU A 40 A 3 4 N VAL A 41 ? N VAL A 41 O PHE A 53 ? O PHE A 53 A 4 5 N THR A 56 ? N THR A 56 O TYR A 69 ? O TYR A 69 A 5 6 N ILE A 66 ? N ILE A 66 O TYR A 79 ? O TYR A 79 A 6 7 N HIS A 80 ? N HIS A 80 O GLU A 92 ? O GLU A 92 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HG A SER 95 ? ? OD2 A ASP 98 ? ? 1.60 2 4 OE1 A GLU 77 ? ? HH A TYR 79 ? ? 1.59 3 8 HG1 A THR 38 ? ? O A GLY 55 ? ? 1.59 4 10 HG1 A THR 38 ? ? O A GLY 55 ? ? 1.57 5 11 OE2 A GLU 8 ? ? HG A SER 86 ? ? 1.55 6 12 OE1 A GLU 77 ? ? HH A TYR 79 ? ? 1.57 7 14 HH A TYR 39 ? ? OD1 A ASP 70 ? ? 1.55 8 14 OE1 A GLU 77 ? ? HH A TYR 79 ? ? 1.59 9 16 HH A TYR 79 ? ? O A LYS 90 ? ? 1.59 10 17 HG A SER 95 ? ? OD2 A ASP 98 ? ? 1.57 11 17 HG A SER 60 ? ? O A GLU 63 ? ? 1.59 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 12 CB A TYR 39 ? ? CG A TYR 39 ? ? CD1 A TYR 39 ? ? 116.52 121.00 -4.48 0.60 N 2 12 CB A TYR 42 ? ? CG A TYR 42 ? ? CD1 A TYR 42 ? ? 117.32 121.00 -3.68 0.60 N 3 13 CD1 A TRP 16 ? ? NE1 A TRP 16 ? ? CE2 A TRP 16 ? ? 114.93 109.00 5.93 0.90 N 4 13 CB A PHE 33 ? ? CG A PHE 33 ? ? CD2 A PHE 33 ? ? 109.44 120.80 -11.36 0.70 N 5 13 CB A PHE 33 ? ? CG A PHE 33 ? ? CD1 A PHE 33 ? ? 125.63 120.80 4.83 0.70 N 6 13 CB A TYR 42 ? ? CG A TYR 42 ? ? CD1 A TYR 42 ? ? 116.94 121.00 -4.06 0.60 N 7 13 CB A TYR 69 ? ? CG A TYR 69 ? ? CD2 A TYR 69 ? ? 117.20 121.00 -3.80 0.60 N 8 15 CA A VAL 41 ? ? CB A VAL 41 ? ? CG1 A VAL 41 ? ? 120.05 110.90 9.15 1.50 N 9 16 CB A TYR 79 ? ? CG A TYR 79 ? ? CD2 A TYR 79 ? ? 115.81 121.00 -5.19 0.60 N 10 18 CA A TYR 69 ? ? CB A TYR 69 ? ? CG A TYR 69 ? ? 126.10 113.40 12.70 1.90 N 11 18 CB A TYR 69 ? ? CG A TYR 69 ? ? CD2 A TYR 69 ? ? 113.71 121.00 -7.29 0.60 N 12 19 CB A TYR 39 ? ? CG A TYR 39 ? ? CD1 A TYR 39 ? ? 116.58 121.00 -4.42 0.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 3 ? ? 47.58 18.18 2 1 VAL A 7 ? ? -66.16 72.07 3 1 VAL A 13 ? ? -69.62 3.94 4 1 GLU A 20 ? ? -175.63 103.31 5 1 ASP A 36 ? ? -166.97 47.58 6 1 LYS A 37 ? ? -141.79 -68.60 7 1 LEU A 47 ? ? -151.54 -31.99 8 1 LYS A 71 ? ? -65.20 10.05 9 1 CYS A 75 ? ? 45.93 166.92 10 1 THR A 76 ? ? -150.06 -40.62 11 1 LYS A 87 ? ? -145.86 22.15 12 1 ALA A 94 ? ? 70.08 -50.06 13 1 LYS A 103 ? ? -120.17 -159.52 14 1 LYS A 107 ? ? 66.82 -174.38 15 2 GLU A 3 ? ? -77.23 23.14 16 2 ASP A 5 ? ? -145.12 53.98 17 2 VAL A 7 ? ? -69.65 93.40 18 2 ILE A 9 ? ? -92.16 -72.29 19 2 LYS A 19 ? ? -95.78 41.40 20 2 GLU A 20 ? ? -166.60 101.74 21 2 ASP A 36 ? ? -164.85 25.74 22 2 SER A 45 ? ? 174.31 85.52 23 2 GLU A 63 ? ? -142.45 -87.89 24 2 LYS A 64 ? ? -168.36 74.62 25 2 HIS A 74 ? ? -95.73 49.40 26 2 CYS A 75 ? ? 45.92 -170.10 27 2 THR A 76 ? ? -172.27 -43.70 28 2 LYS A 87 ? ? -144.34 -3.91 29 2 ALA A 94 ? ? 52.92 -30.33 30 2 ASP A 102 ? ? -92.78 43.81 31 2 LYS A 107 ? ? 67.56 178.06 32 3 ASP A 4 ? ? -156.62 62.35 33 3 PRO A 10 ? ? -67.86 6.08 34 3 VAL A 13 ? ? -64.32 1.61 35 3 LYS A 19 ? ? -75.14 27.67 36 3 ASP A 25 ? ? 58.21 -85.26 37 3 ASP A 26 ? ? -165.45 48.46 38 3 ASP A 36 ? ? -166.12 24.01 39 3 LYS A 37 ? ? -121.82 -64.66 40 3 SER A 45 ? ? 46.15 85.01 41 3 LEU A 47 ? ? -108.21 -78.42 42 3 GLU A 63 ? ? 174.69 -48.14 43 3 ASP A 70 ? ? -100.11 -165.29 44 3 LYS A 87 ? ? -154.90 66.66 45 3 ALA A 94 ? ? 51.95 -39.14 46 3 ASP A 102 ? ? -104.56 74.00 47 3 LYS A 103 ? ? -115.50 -158.36 48 3 LYS A 107 ? ? 57.82 -163.12 49 4 ASP A 5 ? ? -150.21 48.47 50 4 VAL A 13 ? ? -59.72 -6.40 51 4 GLU A 20 ? ? -173.05 90.63 52 4 ASP A 25 ? ? 58.98 10.92 53 4 ASP A 36 ? ? -169.83 -21.13 54 4 SER A 45 ? ? 45.00 74.21 55 4 LEU A 61 ? ? -109.96 -60.94 56 4 ASP A 62 ? ? -122.82 -70.01 57 4 ALA A 94 ? ? 68.24 -51.64 58 4 LYS A 107 ? ? 52.64 -165.63 59 5 ASP A 2 ? ? 60.59 -174.66 60 5 LYS A 6 ? ? 62.35 77.64 61 5 GLU A 20 ? ? -174.60 105.03 62 5 ASP A 36 ? ? -165.72 -10.26 63 5 TYR A 42 ? ? -176.67 137.31 64 5 SER A 45 ? ? 175.14 86.45 65 5 LEU A 47 ? ? -96.02 -79.52 66 5 ARG A 54 ? ? -155.21 82.99 67 5 ASP A 62 ? ? -72.65 -74.35 68 5 LYS A 64 ? ? -43.65 95.63 69 5 CYS A 75 ? ? 59.27 101.93 70 5 ALA A 94 ? ? 68.82 -52.93 71 5 SER A 95 ? ? -118.96 77.64 72 5 GLU A 106 ? ? -107.95 50.72 73 5 LYS A 107 ? ? 61.79 179.21 74 6 GLU A 3 ? ? -140.95 13.11 75 6 ASP A 5 ? ? -152.12 59.98 76 6 VAL A 13 ? ? -54.46 -9.45 77 6 LYS A 19 ? ? -87.87 33.97 78 6 ASP A 25 ? ? 55.27 12.82 79 6 ASP A 36 ? ? -167.57 -7.22 80 6 ASP A 70 ? ? -103.53 -163.04 81 6 THR A 76 ? ? -93.37 -64.25 82 6 LYS A 87 ? ? -154.89 22.81 83 6 ALA A 94 ? ? 67.40 -63.71 84 6 ASP A 102 ? ? -95.16 52.82 85 6 LYS A 107 ? ? 68.12 176.65 86 7 GLU A 3 ? ? -152.25 89.11 87 7 ASP A 4 ? ? -153.54 23.96 88 7 ASP A 5 ? ? -155.55 12.99 89 7 LYS A 19 ? ? -75.36 22.45 90 7 ASP A 25 ? ? 54.97 -85.69 91 7 ASP A 26 ? ? -168.94 9.21 92 7 CYS A 30 ? ? -143.06 55.77 93 7 ASP A 36 ? ? -166.14 34.75 94 7 SER A 45 ? ? -157.42 85.09 95 7 LEU A 47 ? ? -92.00 -70.66 96 7 ASN A 49 ? ? -68.99 75.87 97 7 LEU A 82 ? ? -95.96 -63.43 98 7 ALA A 94 ? ? 62.57 -50.78 99 7 GLU A 106 ? ? -113.44 77.76 100 7 LYS A 107 ? ? 51.50 -164.57 101 7 ASN A 109 ? ? -102.01 51.65 102 8 ASP A 2 ? ? -163.09 109.17 103 8 VAL A 18 ? ? -113.79 66.04 104 8 ASP A 25 ? ? 62.49 -85.20 105 8 ASP A 26 ? ? -159.79 19.04 106 8 ASP A 36 ? ? -156.14 10.44 107 8 LYS A 37 ? ? -100.81 -75.14 108 8 SER A 45 ? ? 65.54 163.63 109 8 SER A 48 ? ? 62.59 144.96 110 8 ASN A 49 ? ? 44.88 4.12 111 8 LYS A 64 ? ? -103.11 79.15 112 8 LYS A 87 ? ? -148.10 -14.73 113 8 ALA A 94 ? ? 63.38 -47.02 114 8 TYR A 108 ? ? -59.95 104.28 115 9 VAL A 13 ? ? -56.21 -6.95 116 9 ASP A 25 ? ? 54.56 -86.31 117 9 ASP A 26 ? ? -167.74 33.47 118 9 ASP A 36 ? ? -155.28 -27.54 119 9 LEU A 47 ? ? -149.53 -48.96 120 9 SER A 48 ? ? 179.48 136.66 121 9 ASN A 49 ? ? 42.89 73.55 122 9 SER A 60 ? ? -81.65 -154.10 123 9 ASP A 62 ? ? -134.55 -87.33 124 9 ASP A 70 ? ? -110.35 -168.71 125 9 LYS A 87 ? ? -141.43 -16.70 126 9 ALA A 94 ? ? 63.55 -51.91 127 9 ASN A 100 ? ? -122.20 -157.88 128 9 LYS A 103 ? ? -75.72 -164.78 129 9 LYS A 107 ? ? 45.19 -164.29 130 9 TYR A 108 ? ? -115.99 71.76 131 10 ASP A 5 ? ? -142.74 57.12 132 10 LYS A 19 ? ? -80.15 41.80 133 10 GLU A 20 ? ? -168.29 101.21 134 10 ASP A 36 ? ? -165.79 -22.04 135 10 THR A 38 ? ? -178.62 -177.55 136 10 SER A 45 ? ? 44.12 72.76 137 10 LEU A 47 ? ? -64.60 -76.17 138 10 CYS A 75 ? ? 44.12 80.92 139 10 SER A 86 ? ? -52.71 -7.96 140 10 LYS A 87 ? ? -156.94 -7.71 141 10 ALA A 94 ? ? 58.82 -7.88 142 10 SER A 101 ? ? 70.11 -162.53 143 10 GLU A 106 ? ? -117.03 54.07 144 10 LYS A 107 ? ? 57.97 -169.74 145 10 ASN A 109 ? ? -96.43 36.37 146 11 GLU A 3 ? ? 71.59 76.13 147 11 VAL A 13 ? ? -46.95 -12.94 148 11 LEU A 23 ? ? -86.53 -154.81 149 11 ASP A 25 ? ? 61.23 -83.66 150 11 ASP A 26 ? ? -160.61 6.43 151 11 ASP A 36 ? ? -168.54 -2.76 152 11 LYS A 37 ? ? -93.70 -76.35 153 11 LEU A 47 ? ? -116.53 -83.18 154 11 ASN A 49 ? ? -55.39 92.53 155 11 ASP A 62 ? ? -152.06 -86.76 156 11 LYS A 64 ? ? -63.58 -165.55 157 11 CYS A 75 ? ? 69.82 111.17 158 11 TRP A 91 ? ? -114.82 76.98 159 11 ALA A 94 ? ? 60.70 -24.25 160 11 LYS A 107 ? ? 56.61 -164.57 161 12 GLU A 3 ? ? -151.70 75.61 162 12 LYS A 19 ? ? -69.65 17.83 163 12 ASP A 36 ? ? -168.82 -23.17 164 12 TYR A 42 ? ? -171.01 103.26 165 12 SER A 48 ? ? 46.33 96.66 166 12 ILE A 81 ? ? 55.49 150.62 167 12 LEU A 82 ? ? -132.83 -61.80 168 12 ALA A 94 ? ? 69.74 -58.60 169 12 ASP A 102 ? ? -106.86 43.94 170 12 GLU A 106 ? ? -110.65 66.30 171 12 LYS A 107 ? ? 56.28 -174.98 172 13 ASP A 2 ? ? 66.26 93.69 173 13 GLU A 3 ? ? -165.75 48.34 174 13 ASP A 5 ? ? -146.83 40.22 175 13 GLU A 8 ? ? -163.69 98.38 176 13 LYS A 19 ? ? -80.62 49.53 177 13 GLU A 20 ? ? -164.24 96.07 178 13 CYS A 30 ? ? -107.12 79.60 179 13 ASP A 36 ? ? -172.26 66.47 180 13 LYS A 37 ? ? -153.06 -29.81 181 13 TYR A 42 ? ? 176.45 128.72 182 13 SER A 45 ? ? 64.83 72.04 183 13 SER A 48 ? ? 178.62 168.55 184 13 ASN A 49 ? ? -105.18 58.22 185 13 GLU A 63 ? ? 174.60 -43.56 186 13 GLU A 73 ? ? 47.87 29.22 187 13 CYS A 75 ? ? -64.35 99.95 188 13 LYS A 87 ? ? -140.58 21.31 189 13 ALA A 94 ? ? 62.94 -51.77 190 13 ASP A 102 ? ? -94.71 36.06 191 13 LYS A 107 ? ? 66.41 -177.35 192 13 ASN A 109 ? ? 53.95 85.53 193 14 ASP A 4 ? ? -146.62 16.58 194 14 VAL A 13 ? ? -45.87 -15.59 195 14 LEU A 23 ? ? -79.72 -160.25 196 14 ASP A 26 ? ? 60.31 65.75 197 14 ASP A 36 ? ? -159.17 -13.57 198 14 SER A 45 ? ? 44.96 79.72 199 14 PRO A 46 ? ? -69.04 5.43 200 14 SER A 48 ? ? 58.99 106.86 201 14 GLU A 63 ? ? -167.61 -49.47 202 14 LYS A 71 ? ? 49.16 -81.61 203 14 GLU A 72 ? ? -152.92 79.67 204 14 LYS A 87 ? ? -146.98 29.77 205 14 ALA A 94 ? ? 60.37 -66.23 206 14 LYS A 107 ? ? 72.15 172.45 207 15 ASP A 2 ? ? -87.23 35.27 208 15 GLU A 3 ? ? -116.93 79.84 209 15 ASP A 4 ? ? -168.40 64.59 210 15 LYS A 6 ? ? 63.53 175.04 211 15 LYS A 19 ? ? -57.56 17.75 212 15 LEU A 23 ? ? -91.94 -154.06 213 15 VAL A 28 ? ? 72.42 124.51 214 15 THR A 29 ? ? 175.22 11.07 215 15 CYS A 30 ? ? -151.18 72.02 216 15 ASP A 36 ? ? -169.35 3.94 217 15 LYS A 37 ? ? -117.19 -82.94 218 15 PRO A 46 ? ? -61.03 2.72 219 15 LEU A 47 ? ? -82.01 -85.06 220 15 SER A 48 ? ? -176.35 111.55 221 15 ARG A 54 ? ? -173.69 127.21 222 15 GLU A 63 ? ? -149.04 -54.07 223 15 LYS A 87 ? ? -154.29 25.96 224 15 ALA A 94 ? ? 65.02 -50.15 225 15 GLU A 106 ? ? -116.14 51.99 226 15 LYS A 107 ? ? 61.37 -164.96 227 16 LYS A 6 ? ? 56.01 168.63 228 16 LYS A 19 ? ? -82.22 42.94 229 16 GLU A 20 ? ? -158.56 88.21 230 16 LEU A 23 ? ? -73.46 -168.50 231 16 ASP A 25 ? ? 67.86 -85.74 232 16 ASP A 26 ? ? -169.62 49.70 233 16 ASP A 36 ? ? -156.48 -26.81 234 16 LEU A 47 ? ? -147.37 -58.30 235 16 ASN A 49 ? ? -57.13 75.43 236 16 ASP A 70 ? ? -112.51 -167.25 237 16 CYS A 75 ? ? 66.78 148.68 238 16 HIS A 80 ? ? -56.55 -162.11 239 16 LYS A 87 ? ? -153.53 -3.93 240 16 GLU A 92 ? ? -65.13 -163.55 241 16 ALA A 94 ? ? 63.04 -42.00 242 16 LYS A 103 ? ? -103.36 -165.86 243 16 GLU A 106 ? ? -102.20 41.38 244 16 LYS A 107 ? ? 55.67 -167.26 245 16 ASN A 109 ? ? -69.88 87.53 246 17 ASP A 5 ? ? -142.18 31.19 247 17 VAL A 7 ? ? -59.27 103.30 248 17 LEU A 23 ? ? -88.36 -155.99 249 17 ASP A 25 ? ? 54.98 7.36 250 17 ASP A 36 ? ? -140.44 -69.79 251 17 LYS A 37 ? ? -167.16 -29.26 252 17 SER A 45 ? ? -114.30 71.23 253 17 LEU A 47 ? ? -153.63 -85.14 254 17 ASP A 62 ? ? -95.52 -67.53 255 17 LYS A 71 ? ? -67.30 2.54 256 17 ALA A 94 ? ? 66.01 -59.15 257 17 ASP A 102 ? ? -97.20 41.89 258 17 LYS A 103 ? ? -74.91 -168.28 259 17 GLU A 106 ? ? -110.71 60.83 260 17 LYS A 107 ? ? 58.17 176.71 261 18 GLU A 3 ? ? 65.54 93.89 262 18 ASP A 4 ? ? -162.84 32.42 263 18 ASP A 5 ? ? -155.59 17.06 264 18 LYS A 19 ? ? -75.92 20.36 265 18 ASP A 25 ? ? 58.35 12.50 266 18 ASP A 36 ? ? 179.23 54.06 267 18 LYS A 37 ? ? -132.83 -74.63 268 18 LEU A 47 ? ? -145.54 -71.88 269 18 ASP A 62 ? ? -122.15 -85.50 270 18 GLU A 72 ? ? -141.39 11.50 271 18 GLU A 73 ? ? -65.48 29.14 272 18 CYS A 75 ? ? 47.10 111.20 273 18 ALA A 94 ? ? 56.61 -55.07 274 18 LYS A 107 ? ? 57.67 -173.88 275 19 GLU A 3 ? ? -164.97 89.44 276 19 ASP A 4 ? ? -140.39 32.45 277 19 LEU A 23 ? ? -69.80 -173.71 278 19 ASP A 25 ? ? 54.60 -85.76 279 19 ASP A 26 ? ? -162.12 8.17 280 19 PHE A 27 ? ? -61.38 97.71 281 19 ASP A 36 ? ? -170.39 -14.82 282 19 LYS A 37 ? ? -88.23 -70.58 283 19 LEU A 47 ? ? -123.43 -65.91 284 19 SER A 48 ? ? -167.10 -168.49 285 19 GLU A 63 ? ? -147.80 13.42 286 19 CYS A 75 ? ? 44.32 74.95 287 19 LYS A 87 ? ? -142.15 -16.97 288 19 TRP A 91 ? ? -65.34 89.25 289 19 ALA A 94 ? ? 63.12 -30.26 290 19 GLU A 106 ? ? -104.66 49.92 291 19 LYS A 107 ? ? 58.65 -174.19 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 4 GLY A 1 ? ? ASP A 2 ? ? 145.19 2 6 ALA A 35 ? ? ASP A 36 ? ? 145.42 3 8 VAL A 41 ? ? TYR A 42 ? ? 149.15 4 10 SER A 101 ? ? ASP A 102 ? ? -148.25 5 19 LYS A 90 ? ? TRP A 91 ? ? -148.87 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 39 ? ? 0.077 'SIDE CHAIN' 2 1 TYR A 42 ? ? 0.124 'SIDE CHAIN' 3 1 TYR A 57 ? ? 0.110 'SIDE CHAIN' 4 1 TYR A 79 ? ? 0.096 'SIDE CHAIN' 5 3 PHE A 33 ? ? 0.081 'SIDE CHAIN' 6 3 TYR A 69 ? ? 0.075 'SIDE CHAIN' 7 3 TYR A 79 ? ? 0.079 'SIDE CHAIN' 8 4 ARG A 104 ? ? 0.082 'SIDE CHAIN' 9 6 TYR A 108 ? ? 0.083 'SIDE CHAIN' 10 7 TYR A 31 ? ? 0.069 'SIDE CHAIN' 11 8 ARG A 104 ? ? 0.078 'SIDE CHAIN' 12 10 TYR A 42 ? ? 0.072 'SIDE CHAIN' 13 10 TYR A 57 ? ? 0.074 'SIDE CHAIN' 14 10 ARG A 104 ? ? 0.093 'SIDE CHAIN' 15 11 TYR A 79 ? ? 0.079 'SIDE CHAIN' 16 12 PHE A 33 ? ? 0.077 'SIDE CHAIN' 17 12 TYR A 42 ? ? 0.088 'SIDE CHAIN' 18 12 TYR A 79 ? ? 0.099 'SIDE CHAIN' 19 15 TYR A 42 ? ? 0.075 'SIDE CHAIN' 20 16 TYR A 79 ? ? 0.087 'SIDE CHAIN' 21 17 TYR A 79 ? ? 0.064 'SIDE CHAIN' 22 18 TYR A 69 ? ? 0.096 'SIDE CHAIN' 23 19 TYR A 42 ? ? 0.073 'SIDE CHAIN' 24 19 TYR A 57 ? ? 0.067 'SIDE CHAIN' 25 19 ARG A 104 ? ? 0.089 'SIDE CHAIN' # _pdbx_SG_project.full_name_of_center 'Joint Center for Structural Genomics' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center JCSG _pdbx_SG_project.project_name PSI:Biology # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 80 _pdbx_nmr_ensemble.conformers_submitted_total_number 19 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MHD _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MHD _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.contents '20 mM sodium phosphate, 50 mM sodium chloride, 5 mM sodium azide, 1.2 mM [U-99% 13C; U-99% 15N] protein, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sodium phosphate-1' 20 ? mM ? 1 'sodium chloride-2' 50 ? mM ? 1 'sodium azide-3' 5 ? mM ? 1 entity-4 1.2 ? mM '[U-99% 13C; U-99% 15N]' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.0798 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '4D HACANH APSY' 1 3 1 '5D HACACONH APSY' 1 4 1 '5D CBCACONH APSY' 1 5 1 '3D 1H-15N NOESY' 1 6 1 '3D 1H-13C NOESY aliphatic' 1 7 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MHD _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1733 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 469 _pdbx_nmr_constraints.NOE_long_range_total_count 603 _pdbx_nmr_constraints.NOE_medium_range_total_count 168 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 493 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2MHD _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin 2.1 1 'Bruker Biospin' processing TopSpin 2.1 2 'Bruker Biospin' 'data analysis' TopSpin 2.1 3 'Bartels et al.' collection TopSpin 2.1 4 'Bartels et al.' processing TopSpin 2.1 5 'Bartels et al.' 'data analysis' TopSpin 2.1 6 'Bruker Biospin' collection TopSpin 2.1 7 'Bruker Biospin' processing TopSpin 2.1 8 'Bruker Biospin' 'data analysis' TopSpin 2.1 9 'Bartels et al.' collection TopSpin 2.1 10 'Bartels et al.' processing TopSpin 2.1 11 'Bartels et al.' 'data analysis' TopSpin 2.1 12 'Keller and Wuthrich' 'chemical shift assignment' CARA ? 13 'Keller and Wuthrich' 'data analysis' CARA ? 14 'Keller and Wuthrich' 'peak picking' CARA ? 15 'Herrmann, Guntert and Wuthrich' 'chemical shift assignment' j-UNIO ? 16 'Herrmann, Guntert and Wuthrich' 'peak picking' j-UNIO ? 17 'Herrmann, Guntert and Wuthrich' 'structure solution' j-UNIO ? 18 'Luginbuhl, Guntert, Billeter and Wuthrich' refinement OPALp ? 19 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 20 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2MHD _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_