data_2MI2 # _entry.id 2MI2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MI2 pdb_00002mi2 10.2210/pdb2mi2/pdb RCSB RCSB103639 ? ? BMRB 19618 ? 10.13018/BMR19618 WWPDB D_1000103639 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-04-30 2 'Structure model' 1 1 2022-08-24 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' Other 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' database_2 3 2 'Structure model' pdbx_nmr_spectrometer 4 2 'Structure model' struct_ref_seq_dif 5 3 'Structure model' pdbx_database_status 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_database_2.pdbx_DOI' 6 2 'Structure model' '_database_2.pdbx_database_accession' 7 2 'Structure model' '_pdbx_nmr_spectrometer.model' 8 2 'Structure model' '_struct_ref_seq_dif.details' 9 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 10 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MI2 _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2013-12-08 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 19618 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, Y.' 1 'Wang, L.' 2 'Hu, Y.' 3 'Jin, C.' 4 # _citation.id primary _citation.title 'Solution structure of the TatB component of the twin-arginine translocation system.' _citation.journal_abbrev Biochim.Biophys.Acta _citation.journal_volume 1838 _citation.page_first 1881 _citation.page_last 1888 _citation.year 2014 _citation.journal_id_ASTM BBACAQ _citation.country NE _citation.journal_id_ISSN 0006-3002 _citation.journal_id_CSD 0113 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24699374 _citation.pdbx_database_id_DOI 10.1016/j.bbamem.2014.03.015 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, Y.' 1 ? primary 'Wang, L.' 2 ? primary 'Hu, Y.' 3 ? primary 'Jin, C.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Sec-independent protein translocase protein TatB' _entity.formula_weight 12343.269 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 1-101' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MFDIGFSELLLVFIIGLVVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQELKLQEFQDSLKKVEKASLTNLTPELKA SMDELRQAAESMKRSYVANDPLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MFDIGFSELLLVFIIGLVVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQELKLQEFQDSLKKVEKASLTNLTPELKA SMDELRQAAESMKRSYVANDPLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PHE n 1 3 ASP n 1 4 ILE n 1 5 GLY n 1 6 PHE n 1 7 SER n 1 8 GLU n 1 9 LEU n 1 10 LEU n 1 11 LEU n 1 12 VAL n 1 13 PHE n 1 14 ILE n 1 15 ILE n 1 16 GLY n 1 17 LEU n 1 18 VAL n 1 19 VAL n 1 20 LEU n 1 21 GLY n 1 22 PRO n 1 23 GLN n 1 24 ARG n 1 25 LEU n 1 26 PRO n 1 27 VAL n 1 28 ALA n 1 29 VAL n 1 30 LYS n 1 31 THR n 1 32 VAL n 1 33 ALA n 1 34 GLY n 1 35 TRP n 1 36 ILE n 1 37 ARG n 1 38 ALA n 1 39 LEU n 1 40 ARG n 1 41 SER n 1 42 LEU n 1 43 ALA n 1 44 THR n 1 45 THR n 1 46 VAL n 1 47 GLN n 1 48 ASN n 1 49 GLU n 1 50 LEU n 1 51 THR n 1 52 GLN n 1 53 GLU n 1 54 LEU n 1 55 LYS n 1 56 LEU n 1 57 GLN n 1 58 GLU n 1 59 PHE n 1 60 GLN n 1 61 ASP n 1 62 SER n 1 63 LEU n 1 64 LYS n 1 65 LYS n 1 66 VAL n 1 67 GLU n 1 68 LYS n 1 69 ALA n 1 70 SER n 1 71 LEU n 1 72 THR n 1 73 ASN n 1 74 LEU n 1 75 THR n 1 76 PRO n 1 77 GLU n 1 78 LEU n 1 79 LYS n 1 80 ALA n 1 81 SER n 1 82 MET n 1 83 ASP n 1 84 GLU n 1 85 LEU n 1 86 ARG n 1 87 GLN n 1 88 ALA n 1 89 ALA n 1 90 GLU n 1 91 SER n 1 92 MET n 1 93 LYS n 1 94 ARG n 1 95 SER n 1 96 TYR n 1 97 VAL n 1 98 ALA n 1 99 ASN n 1 100 ASP n 1 101 PRO n 1 102 LEU n 1 103 GLU n 1 104 HIS n 1 105 HIS n 1 106 HIS n 1 107 HIS n 1 108 HIS n 1 109 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'tatB, LF82_2221' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET-21a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 TRP 35 35 35 TRP TRP A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 MET 92 92 92 MET MET A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 HIS 104 104 104 HIS HIS A . n A 1 105 HIS 105 105 ? ? ? A . n A 1 106 HIS 106 106 ? ? ? A . n A 1 107 HIS 107 107 ? ? ? A . n A 1 108 HIS 108 108 ? ? ? A . n A 1 109 HIS 109 109 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MI2 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MI2 _struct.title 'Solution structure of the E. coli TatB protein in DPC micelles' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MI2 _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' _struct_keywords.text 'transport protein' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code E2QI32_ECOLX _struct_ref.pdbx_db_accession E2QI32 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MFDIGFSELLLVFIIGLVVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQELKLQEFQDSLKKVEKASLTNLTPELKA SMDELRQAAESMKRSYVANDP ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MI2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 101 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession E2QI32 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 101 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 101 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MI2 LEU A 102 ? UNP E2QI32 ? ? 'expression tag' 102 1 1 2MI2 GLU A 103 ? UNP E2QI32 ? ? 'expression tag' 103 2 1 2MI2 HIS A 104 ? UNP E2QI32 ? ? 'expression tag' 104 3 1 2MI2 HIS A 105 ? UNP E2QI32 ? ? 'expression tag' 105 4 1 2MI2 HIS A 106 ? UNP E2QI32 ? ? 'expression tag' 106 5 1 2MI2 HIS A 107 ? UNP E2QI32 ? ? 'expression tag' 107 6 1 2MI2 HIS A 108 ? UNP E2QI32 ? ? 'expression tag' 108 7 1 2MI2 HIS A 109 ? UNP E2QI32 ? ? 'expression tag' 109 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PHE A 6 ? GLY A 21 ? PHE A 6 GLY A 21 1 ? 16 HELX_P HELX_P2 2 PRO A 22 ? ARG A 24 ? PRO A 22 ARG A 24 5 ? 3 HELX_P HELX_P3 3 LEU A 25 ? VAL A 46 ? LEU A 25 VAL A 46 1 ? 22 HELX_P HELX_P4 4 GLU A 49 ? LEU A 54 ? GLU A 49 LEU A 54 1 ? 6 HELX_P HELX_P5 5 GLN A 57 ? THR A 72 ? GLN A 57 THR A 72 1 ? 16 HELX_P HELX_P6 6 THR A 75 ? VAL A 97 ? THR A 75 VAL A 97 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 10 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 LEU _pdbx_validate_close_contact.auth_seq_id_1 50 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 LYS _pdbx_validate_close_contact.auth_seq_id_2 55 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 3 ? ? -179.81 -63.21 2 1 ILE A 4 ? ? 62.43 -83.42 3 1 PHE A 6 ? ? -176.24 -25.42 4 1 GLU A 49 ? ? -124.67 -106.00 5 1 LEU A 54 ? ? -145.46 -49.03 6 1 LYS A 55 ? ? -76.89 37.90 7 1 ASN A 73 ? ? -156.38 23.87 8 1 THR A 75 ? ? 176.93 140.06 9 1 ALA A 98 ? ? -140.71 25.82 10 1 ASN A 99 ? ? -171.22 60.00 11 1 ASP A 100 ? ? -174.99 -70.59 12 2 ASP A 3 ? ? 178.92 -66.29 13 2 ILE A 4 ? ? 63.84 -82.96 14 2 PHE A 6 ? ? -176.22 -25.35 15 2 VAL A 19 ? ? -97.43 -62.26 16 2 PRO A 22 ? ? -69.75 9.80 17 2 GLU A 49 ? ? -140.20 -93.01 18 2 GLU A 53 ? ? -145.41 -33.92 19 2 LEU A 54 ? ? -152.66 44.63 20 2 LYS A 55 ? ? -156.27 -53.53 21 2 ASN A 73 ? ? -155.64 23.36 22 2 THR A 75 ? ? 177.11 138.98 23 2 ALA A 98 ? ? -179.92 -32.87 24 2 ASN A 99 ? ? -152.42 -40.56 25 2 ASP A 100 ? ? 66.86 74.45 26 2 GLU A 103 ? ? -160.21 53.69 27 3 ASP A 3 ? ? -179.79 -63.50 28 3 ILE A 4 ? ? 62.34 -84.25 29 3 PHE A 6 ? ? -176.10 -25.67 30 3 GLU A 49 ? ? -142.51 -102.93 31 3 GLU A 53 ? ? -151.31 -43.48 32 3 LEU A 54 ? ? -136.76 -41.17 33 3 ALA A 98 ? ? -173.66 -41.08 34 3 ASN A 99 ? ? -179.12 57.30 35 3 GLU A 103 ? ? 44.11 -163.26 36 4 ASP A 3 ? ? 179.49 -66.32 37 4 ILE A 4 ? ? 63.76 -83.04 38 4 PHE A 6 ? ? -176.12 -25.40 39 4 GLU A 49 ? ? -139.31 -104.22 40 4 GLU A 53 ? ? -150.85 -43.84 41 4 LEU A 54 ? ? -135.52 -41.63 42 4 THR A 72 ? ? -26.18 -67.96 43 4 ALA A 98 ? ? 177.28 35.12 44 4 ASN A 99 ? ? 76.14 75.25 45 4 GLU A 103 ? ? -156.51 -49.53 46 5 ASP A 3 ? ? 179.25 -63.26 47 5 ILE A 4 ? ? 62.77 -83.65 48 5 PHE A 6 ? ? -175.49 -19.27 49 5 GLU A 49 ? ? -137.68 -102.22 50 5 GLU A 53 ? ? -150.53 -43.68 51 5 LEU A 54 ? ? -135.22 -41.46 52 5 LYS A 55 ? ? -87.66 30.13 53 5 ASN A 73 ? ? -154.76 23.80 54 5 THR A 75 ? ? 176.35 139.12 55 5 ALA A 98 ? ? 179.00 -48.85 56 5 ASN A 99 ? ? -150.48 71.95 57 6 ASP A 3 ? ? 178.85 -66.33 58 6 ILE A 4 ? ? 63.87 -82.86 59 6 PHE A 6 ? ? -175.44 -20.57 60 6 GLU A 49 ? ? -134.71 -102.46 61 6 GLU A 53 ? ? -152.07 -42.54 62 6 LEU A 54 ? ? -138.18 -40.68 63 6 THR A 72 ? ? -38.13 -35.03 64 6 ASN A 73 ? ? -159.42 31.24 65 6 VAL A 97 ? ? -98.28 59.06 66 6 ALA A 98 ? ? 179.85 -35.00 67 6 ASN A 99 ? ? -175.16 80.88 68 6 ASP A 100 ? ? -110.35 77.73 69 6 GLU A 103 ? ? -139.52 -60.78 70 7 ASP A 3 ? ? 178.62 -61.08 71 7 ILE A 4 ? ? 61.57 -87.31 72 7 PHE A 6 ? ? -171.38 -63.01 73 7 GLU A 49 ? ? -130.39 -102.71 74 7 GLU A 53 ? ? -152.08 -43.45 75 7 LEU A 54 ? ? -136.04 -41.99 76 7 LYS A 55 ? ? -86.89 35.41 77 7 GLN A 57 ? ? -125.67 -72.96 78 7 ASN A 73 ? ? -153.22 22.94 79 7 THR A 75 ? ? 176.53 137.99 80 7 VAL A 97 ? ? -93.50 45.22 81 7 ASN A 99 ? ? 179.84 -29.86 82 7 ASP A 100 ? ? 67.34 68.00 83 7 GLU A 103 ? ? 176.87 93.46 84 8 ASP A 3 ? ? 177.34 -63.98 85 8 ILE A 4 ? ? 61.85 -84.11 86 8 PHE A 6 ? ? -176.37 -25.70 87 8 GLU A 49 ? ? -132.20 -103.02 88 8 LEU A 54 ? ? -143.50 -49.14 89 8 LYS A 55 ? ? -78.51 42.11 90 8 THR A 72 ? ? -38.75 -35.41 91 8 ASN A 73 ? ? -157.98 30.50 92 8 VAL A 97 ? ? -92.84 47.65 93 8 ALA A 98 ? ? 175.05 -33.07 94 9 ASP A 3 ? ? -179.82 -63.14 95 9 ILE A 4 ? ? 62.48 -83.46 96 9 PHE A 6 ? ? -176.18 -25.43 97 9 GLU A 49 ? ? -130.20 -103.88 98 9 LEU A 54 ? ? -144.61 -49.26 99 9 LYS A 55 ? ? -76.64 38.50 100 9 THR A 75 ? ? -170.16 145.18 101 9 ASP A 100 ? ? -142.05 56.93 102 9 GLU A 103 ? ? 176.01 -30.79 103 10 ASP A 3 ? ? 178.57 -66.31 104 10 ILE A 4 ? ? 63.87 -82.89 105 10 PHE A 6 ? ? -176.12 -25.30 106 10 GLU A 49 ? ? -106.27 -102.06 107 10 GLU A 53 ? ? -150.55 -38.69 108 10 ASN A 73 ? ? -156.18 24.13 109 10 THR A 75 ? ? 176.87 139.59 110 10 ALA A 98 ? ? 174.56 -31.85 111 10 ASN A 99 ? ? -142.41 57.99 112 10 GLU A 103 ? ? -55.70 178.07 113 11 ASP A 3 ? ? -157.71 17.77 114 11 PHE A 6 ? ? 180.00 -41.84 115 11 GLU A 49 ? ? -113.73 -102.84 116 11 GLU A 53 ? ? -151.20 -31.72 117 11 ASN A 73 ? ? -156.28 24.62 118 11 THR A 75 ? ? 176.83 139.46 119 11 ALA A 98 ? ? -148.08 43.80 120 11 ASN A 99 ? ? -178.82 43.66 121 11 ASP A 100 ? ? -170.91 -67.41 122 11 PRO A 101 ? ? -69.70 3.81 123 11 LEU A 102 ? ? -157.52 23.85 124 11 GLU A 103 ? ? -179.71 -176.69 125 12 ASP A 3 ? ? 178.83 -67.26 126 12 PHE A 6 ? ? -160.66 -39.57 127 12 VAL A 19 ? ? -97.40 -66.34 128 12 PRO A 22 ? ? -69.76 6.27 129 12 GLU A 49 ? ? -153.53 -55.30 130 12 GLU A 53 ? ? -151.21 -32.03 131 12 ASN A 73 ? ? -155.85 23.48 132 12 THR A 75 ? ? 177.01 140.10 133 12 ALA A 98 ? ? -144.54 29.27 134 12 ASN A 99 ? ? -177.68 60.56 135 12 ASP A 100 ? ? -174.73 -71.91 136 13 ASP A 3 ? ? 173.47 -53.74 137 13 ILE A 4 ? ? 66.24 -85.44 138 13 PHE A 6 ? ? 177.92 -25.56 139 13 GLU A 49 ? ? -125.95 -104.84 140 13 LEU A 54 ? ? -143.75 -50.50 141 13 LYS A 55 ? ? -76.27 38.95 142 13 THR A 75 ? ? -173.01 143.47 143 13 ALA A 98 ? ? -141.09 26.05 144 13 ASN A 99 ? ? -171.42 59.54 145 13 ASP A 100 ? ? -174.71 -70.50 146 14 ASP A 3 ? ? -179.75 -62.71 147 14 ILE A 4 ? ? 62.57 -83.31 148 14 PHE A 6 ? ? -176.24 -25.35 149 14 GLU A 49 ? ? -112.12 -108.40 150 14 LEU A 54 ? ? -136.57 -57.26 151 14 LYS A 55 ? ? -76.83 41.29 152 14 THR A 72 ? ? -25.82 -68.11 153 14 LEU A 102 ? ? -154.08 17.39 154 15 ASP A 3 ? ? 174.99 -56.13 155 15 ILE A 4 ? ? 67.09 -84.72 156 15 PHE A 6 ? ? 177.78 -28.25 157 15 GLN A 47 ? ? -133.92 -55.24 158 15 GLU A 49 ? ? -154.35 -52.47 159 15 LEU A 54 ? ? -143.49 -45.25 160 15 ASN A 73 ? ? -154.91 26.08 161 15 THR A 75 ? ? 178.01 138.68 162 15 ALA A 98 ? ? -141.04 25.95 163 15 ASN A 99 ? ? -171.33 59.67 164 15 ASP A 100 ? ? -174.78 -70.57 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MI2 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MI2 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '1 mM [U-100% 13C; U-100% 15N] transport protein-1, 20 mM sodium acetate-2, 40 mM DPC-3, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'transport protein-1' 1 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium acetate-2' 20 ? mM ? 1 DPC-3 40 ? mM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.02 _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 313 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCO' 1 5 1 '3D HNCA' 1 6 1 '3D HNCACB' 1 7 1 '3D HBHA(CO)NH' 1 8 1 '3D HN(CO)CA' 1 9 1 '3D HCCH-TOCSY' 1 10 1 '3D HCCH-COSY' 1 11 1 '3D 1H-13C NOESY aromatic' 1 12 1 '3D 1H-13C NOESY aliphatic' 1 13 1 '3D 1H-15N NOESY' # _pdbx_nmr_refine.entry_id 2MI2 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 1 ? 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView 2 ? 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3 ? 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS 4 ? 'Laskowski and MacArthur' 'data analysis' ProcheckNMR 5 ? 'Duggan, Legge, Dyson & Wright' 'data analysis' SANE 6 ? 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 7 ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 105 ? A HIS 105 2 1 Y 1 A HIS 106 ? A HIS 106 3 1 Y 1 A HIS 107 ? A HIS 107 4 1 Y 1 A HIS 108 ? A HIS 108 5 1 Y 1 A HIS 109 ? A HIS 109 6 2 Y 1 A HIS 105 ? A HIS 105 7 2 Y 1 A HIS 106 ? A HIS 106 8 2 Y 1 A HIS 107 ? A HIS 107 9 2 Y 1 A HIS 108 ? A HIS 108 10 2 Y 1 A HIS 109 ? A HIS 109 11 3 Y 1 A HIS 105 ? A HIS 105 12 3 Y 1 A HIS 106 ? A HIS 106 13 3 Y 1 A HIS 107 ? A HIS 107 14 3 Y 1 A HIS 108 ? A HIS 108 15 3 Y 1 A HIS 109 ? A HIS 109 16 4 Y 1 A HIS 105 ? A HIS 105 17 4 Y 1 A HIS 106 ? A HIS 106 18 4 Y 1 A HIS 107 ? A HIS 107 19 4 Y 1 A HIS 108 ? A HIS 108 20 4 Y 1 A HIS 109 ? A HIS 109 21 5 Y 1 A HIS 105 ? A HIS 105 22 5 Y 1 A HIS 106 ? A HIS 106 23 5 Y 1 A HIS 107 ? A HIS 107 24 5 Y 1 A HIS 108 ? A HIS 108 25 5 Y 1 A HIS 109 ? A HIS 109 26 6 Y 1 A HIS 105 ? A HIS 105 27 6 Y 1 A HIS 106 ? A HIS 106 28 6 Y 1 A HIS 107 ? A HIS 107 29 6 Y 1 A HIS 108 ? A HIS 108 30 6 Y 1 A HIS 109 ? A HIS 109 31 7 Y 1 A HIS 105 ? A HIS 105 32 7 Y 1 A HIS 106 ? A HIS 106 33 7 Y 1 A HIS 107 ? A HIS 107 34 7 Y 1 A HIS 108 ? A HIS 108 35 7 Y 1 A HIS 109 ? A HIS 109 36 8 Y 1 A HIS 105 ? A HIS 105 37 8 Y 1 A HIS 106 ? A HIS 106 38 8 Y 1 A HIS 107 ? A HIS 107 39 8 Y 1 A HIS 108 ? A HIS 108 40 8 Y 1 A HIS 109 ? A HIS 109 41 9 Y 1 A HIS 105 ? A HIS 105 42 9 Y 1 A HIS 106 ? A HIS 106 43 9 Y 1 A HIS 107 ? A HIS 107 44 9 Y 1 A HIS 108 ? A HIS 108 45 9 Y 1 A HIS 109 ? A HIS 109 46 10 Y 1 A HIS 105 ? A HIS 105 47 10 Y 1 A HIS 106 ? A HIS 106 48 10 Y 1 A HIS 107 ? A HIS 107 49 10 Y 1 A HIS 108 ? A HIS 108 50 10 Y 1 A HIS 109 ? A HIS 109 51 11 Y 1 A HIS 105 ? A HIS 105 52 11 Y 1 A HIS 106 ? A HIS 106 53 11 Y 1 A HIS 107 ? A HIS 107 54 11 Y 1 A HIS 108 ? A HIS 108 55 11 Y 1 A HIS 109 ? A HIS 109 56 12 Y 1 A HIS 105 ? A HIS 105 57 12 Y 1 A HIS 106 ? A HIS 106 58 12 Y 1 A HIS 107 ? A HIS 107 59 12 Y 1 A HIS 108 ? A HIS 108 60 12 Y 1 A HIS 109 ? A HIS 109 61 13 Y 1 A HIS 105 ? A HIS 105 62 13 Y 1 A HIS 106 ? A HIS 106 63 13 Y 1 A HIS 107 ? A HIS 107 64 13 Y 1 A HIS 108 ? A HIS 108 65 13 Y 1 A HIS 109 ? A HIS 109 66 14 Y 1 A HIS 105 ? A HIS 105 67 14 Y 1 A HIS 106 ? A HIS 106 68 14 Y 1 A HIS 107 ? A HIS 107 69 14 Y 1 A HIS 108 ? A HIS 108 70 14 Y 1 A HIS 109 ? A HIS 109 71 15 Y 1 A HIS 105 ? A HIS 105 72 15 Y 1 A HIS 106 ? A HIS 106 73 15 Y 1 A HIS 107 ? A HIS 107 74 15 Y 1 A HIS 108 ? A HIS 108 75 15 Y 1 A HIS 109 ? A HIS 109 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' 800 Bruker AVANCE 3 'Bruker Avance' # _atom_sites.entry_id 2MI2 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_