data_2MKA # _entry.id 2MKA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MKA pdb_00002mka 10.2210/pdb2mka/pdb RCSB RCSB103715 ? ? BMRB 19764 ? ? WWPDB D_1000103715 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 19764 BMRB unspecified . 2MK9 PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MKA _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-02-04 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mineev, K.' 1 'Gonscharuk, S.A.' 2 'Arseniev, A.S.' 3 # _citation.id primary _citation.title 'Toll-like receptor 3 transmembrane domain is able to perform various homotypic interactions: An NMR structural study.' _citation.journal_abbrev 'Febs Lett.' _citation.journal_volume 588 _citation.page_first 3802 _citation.page_last 3807 _citation.year 2014 _citation.journal_id_ASTM FEBLAL _citation.country NE _citation.journal_id_ISSN 0014-5793 _citation.journal_id_CSD 0165 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25217833 _citation.pdbx_database_id_DOI 10.1016/j.febslet.2014.08.031 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mineev, K.S.' 1 ? primary 'Goncharuk, S.A.' 2 ? primary 'Arseniev, A.S.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Toll-like receptor 3' _entity.formula_weight 4089.947 _entity.pdbx_number_of_molecules 3 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'transmembrane domain (UNP residues 698-730)' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MDSAPFELFFMINTSILLIFIFIVLLIHFEGWRI _entity_poly.pdbx_seq_one_letter_code_can MDSAPFELFFMINTSILLIFIFIVLLIHFEGWRI _entity_poly.pdbx_strand_id A,B,C _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 SER n 1 4 ALA n 1 5 PRO n 1 6 PHE n 1 7 GLU n 1 8 LEU n 1 9 PHE n 1 10 PHE n 1 11 MET n 1 12 ILE n 1 13 ASN n 1 14 THR n 1 15 SER n 1 16 ILE n 1 17 LEU n 1 18 LEU n 1 19 ILE n 1 20 PHE n 1 21 ILE n 1 22 PHE n 1 23 ILE n 1 24 VAL n 1 25 LEU n 1 26 LEU n 1 27 ILE n 1 28 HIS n 1 29 PHE n 1 30 GLU n 1 31 GLY n 1 32 TRP n 1 33 ARG n 1 34 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene TLR3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'cell-free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET22b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TLR3_HUMAN _struct_ref.pdbx_db_accession O15455 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DSAPFELFFMINTSILLIFIFIVLLIHFEGWRI _struct_ref.pdbx_align_begin 698 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2MKA A 2 ? 34 ? O15455 698 ? 730 ? 2 34 2 1 2MKA B 2 ? 34 ? O15455 698 ? 730 ? 102 134 3 1 2MKA C 2 ? 34 ? O15455 698 ? 730 ? 202 234 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MKA MET A 1 ? UNP O15455 ? ? 'initiating methionine' 1 1 2 2MKA MET B 1 ? UNP O15455 ? ? 'initiating methionine' 101 2 3 2MKA MET C 1 ? UNP O15455 ? ? 'initiating methionine' 201 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCA' 1 3 1 '3D HNCO' 1 4 1 '3D HN(CO)CA' 1 5 1 '3D HCCH-TOCSY' 1 6 1 '3D 1H-15N NOESY' 1 7 1 '3D 1H-13C NOESY aliphatic' 1 8 1 '3D HCCH-COSY' 1 9 1 '13C/15N-filtered NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 318 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;0.8 mM Toll-like receptor 3, 1.2 mM [U-98% 13C; U-98% 15N] Toll-like receptor 3, 20 mM potassium phosphate, 1 mM sodium azide, 200 mM [U-99% 2H] DPC, 95% H2O/5% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2MKA _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MKA _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MKA _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin 3.0 1 'Keller and Wuthrich' 'chemical shift assignment' CARA 1.8.5 2 'Keller and Wuthrich' 'data analysis' CARA 1.8.5 3 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 4 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS + 5 'Orekhov, Mayzel' processing qMDD 2.1 6 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 7 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MKA _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MKA _struct.title 'Spatial structure of the Toll-like receptor 3 transmembrane domain in the trimeric state' _struct.pdbx_model_details 'fewest violations, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MKA _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' _struct_keywords.text 'transmembrane domain, trimer, IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 3 ? TRP A 32 ? SER A 3 TRP A 32 1 ? 30 HELX_P HELX_P2 2 SER B 3 ? TRP B 32 ? SER B 103 TRP B 132 1 ? 30 HELX_P HELX_P3 3 SER C 3 ? TRP C 32 ? SER C 203 TRP C 232 1 ? 30 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2MKA _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 ILE 34 34 34 ILE ILE A . n B 1 1 MET 1 101 101 MET MET B . n B 1 2 ASP 2 102 102 ASP ASP B . n B 1 3 SER 3 103 103 SER SER B . n B 1 4 ALA 4 104 104 ALA ALA B . n B 1 5 PRO 5 105 105 PRO PRO B . n B 1 6 PHE 6 106 106 PHE PHE B . n B 1 7 GLU 7 107 107 GLU GLU B . n B 1 8 LEU 8 108 108 LEU LEU B . n B 1 9 PHE 9 109 109 PHE PHE B . n B 1 10 PHE 10 110 110 PHE PHE B . n B 1 11 MET 11 111 111 MET MET B . n B 1 12 ILE 12 112 112 ILE ILE B . n B 1 13 ASN 13 113 113 ASN ASN B . n B 1 14 THR 14 114 114 THR THR B . n B 1 15 SER 15 115 115 SER SER B . n B 1 16 ILE 16 116 116 ILE ILE B . n B 1 17 LEU 17 117 117 LEU LEU B . n B 1 18 LEU 18 118 118 LEU LEU B . n B 1 19 ILE 19 119 119 ILE ILE B . n B 1 20 PHE 20 120 120 PHE PHE B . n B 1 21 ILE 21 121 121 ILE ILE B . n B 1 22 PHE 22 122 122 PHE PHE B . n B 1 23 ILE 23 123 123 ILE ILE B . n B 1 24 VAL 24 124 124 VAL VAL B . n B 1 25 LEU 25 125 125 LEU LEU B . n B 1 26 LEU 26 126 126 LEU LEU B . n B 1 27 ILE 27 127 127 ILE ILE B . n B 1 28 HIS 28 128 128 HIS HIS B . n B 1 29 PHE 29 129 129 PHE PHE B . n B 1 30 GLU 30 130 130 GLU GLU B . n B 1 31 GLY 31 131 131 GLY GLY B . n B 1 32 TRP 32 132 132 TRP TRP B . n B 1 33 ARG 33 133 133 ARG ARG B . n B 1 34 ILE 34 134 134 ILE ILE B . n C 1 1 MET 1 201 201 MET MET C . n C 1 2 ASP 2 202 202 ASP ASP C . n C 1 3 SER 3 203 203 SER SER C . n C 1 4 ALA 4 204 204 ALA ALA C . n C 1 5 PRO 5 205 205 PRO PRO C . n C 1 6 PHE 6 206 206 PHE PHE C . n C 1 7 GLU 7 207 207 GLU GLU C . n C 1 8 LEU 8 208 208 LEU LEU C . n C 1 9 PHE 9 209 209 PHE PHE C . n C 1 10 PHE 10 210 210 PHE PHE C . n C 1 11 MET 11 211 211 MET MET C . n C 1 12 ILE 12 212 212 ILE ILE C . n C 1 13 ASN 13 213 213 ASN ASN C . n C 1 14 THR 14 214 214 THR THR C . n C 1 15 SER 15 215 215 SER SER C . n C 1 16 ILE 16 216 216 ILE ILE C . n C 1 17 LEU 17 217 217 LEU LEU C . n C 1 18 LEU 18 218 218 LEU LEU C . n C 1 19 ILE 19 219 219 ILE ILE C . n C 1 20 PHE 20 220 220 PHE PHE C . n C 1 21 ILE 21 221 221 ILE ILE C . n C 1 22 PHE 22 222 222 PHE PHE C . n C 1 23 ILE 23 223 223 ILE ILE C . n C 1 24 VAL 24 224 224 VAL VAL C . n C 1 25 LEU 25 225 225 LEU LEU C . n C 1 26 LEU 26 226 226 LEU LEU C . n C 1 27 ILE 27 227 227 ILE ILE C . n C 1 28 HIS 28 228 228 HIS HIS C . n C 1 29 PHE 29 229 229 PHE PHE C . n C 1 30 GLU 30 230 230 GLU GLU C . n C 1 31 GLY 31 231 231 GLY GLY C . n C 1 32 TRP 32 232 232 TRP TRP C . n C 1 33 ARG 33 233 233 ARG ARG C . n C 1 34 ILE 34 234 234 ILE ILE C . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-09-17 2 'Structure model' 1 1 2014-10-01 3 'Structure model' 1 2 2014-12-17 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_nmr_spectrometer 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_pdbx_nmr_spectrometer.model' 6 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'Toll-like receptor 3-1' 0.8 ? mM ? 1 'Toll-like receptor 3-2' 1.2 ? mM '[U-98% 13C; U-98% 15N]' 1 'potassium phosphate-3' 20 ? mM ? 1 'sodium azide-4' 1 ? mM ? 1 DPC-5 200 ? mM '[U-99% 2H]' 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 3 ARG A 33 ? ? -98.91 35.80 2 4 ARG C 233 ? ? -108.32 43.27 3 5 SER A 3 ? ? -88.57 41.28 4 5 SER B 103 ? ? -93.94 39.10 5 5 SER C 203 ? ? -94.12 38.21 6 6 SER A 3 ? ? -97.01 40.31 7 6 SER B 103 ? ? -102.19 43.89 8 6 SER C 203 ? ? -95.12 37.25 9 7 ARG B 133 ? ? -104.37 41.40 10 7 ARG C 233 ? ? -99.65 41.08 11 8 ARG A 33 ? ? -167.51 89.47 12 8 ARG B 133 ? ? -170.40 86.85 13 8 ARG C 233 ? ? -165.86 87.02 14 9 ARG A 33 ? ? -94.12 36.97 15 9 ARG B 133 ? ? -92.57 41.65 16 9 ASP C 202 ? ? -170.14 127.27 17 9 ARG C 233 ? ? -92.60 39.86 18 10 SER A 3 ? ? -94.32 39.35 19 10 ARG A 33 ? ? -98.07 38.72 20 10 ASP B 102 ? ? -170.89 126.89 21 10 SER B 103 ? ? -93.18 41.82 22 10 ARG B 133 ? ? -94.27 39.60 23 10 SER C 203 ? ? -94.70 39.71 24 10 ARG C 233 ? ? -97.89 38.85 #