data_2MKX # _entry.id 2MKX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MKX pdb_00002mkx 10.2210/pdb2mkx/pdb RCSB RCSB103738 ? ? BMRB 19799 ? 10.13018/BMR19799 WWPDB D_1000103738 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-06-18 2 'Structure model' 1 1 2014-07-16 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' struct_ref_seq_dif 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_struct_ref_seq_dif.details' 6 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MKX _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-02-14 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 19799 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Baxter, N.J.' 1 'Williamson, M.P.' 2 # _citation.id primary _citation.title 'Molecular basis for bacterial peptidoglycan recognition by LysM domains.' _citation.journal_abbrev 'Nat Commun' _citation.journal_volume 5 _citation.page_first 4269 _citation.page_last 4269 _citation.year 2014 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 2041-1723 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24978025 _citation.pdbx_database_id_DOI 10.1038/ncomms5269 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mesnage, S.' 1 ? primary 'Dellarole, M.' 2 ? primary 'Baxter, N.J.' 3 ? primary 'Rouget, J.B.' 4 ? primary 'Dimitrov, J.D.' 5 ? primary 'Wang, N.' 6 ? primary 'Fujimoto, Y.' 7 ? primary 'Hounslow, A.M.' 8 ? primary 'Lacroix-Desmazes, S.' 9 ? primary 'Fukase, K.' 10 ? primary 'Foster, S.J.' 11 ? primary 'Williamson, M.P.' 12 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Autolysin _entity.formula_weight 6400.250 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.2.1.- _entity.pdbx_mutation ? _entity.pdbx_fragment 'LysM peptidoglycan binding domain of autolysin AtlA' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Beta-glycosidase, Peptidoglycan hydrolase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MGTNTYYTVKSGDTLNKIAAQYGVSVANLRSWNGISGDLIFVGQKLIVKKGSHHHHHH _entity_poly.pdbx_seq_one_letter_code_can MGTNTYYTVKSGDTLNKIAAQYGVSVANLRSWNGISGDLIFVGQKLIVKKGSHHHHHH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 THR n 1 4 ASN n 1 5 THR n 1 6 TYR n 1 7 TYR n 1 8 THR n 1 9 VAL n 1 10 LYS n 1 11 SER n 1 12 GLY n 1 13 ASP n 1 14 THR n 1 15 LEU n 1 16 ASN n 1 17 LYS n 1 18 ILE n 1 19 ALA n 1 20 ALA n 1 21 GLN n 1 22 TYR n 1 23 GLY n 1 24 VAL n 1 25 SER n 1 26 VAL n 1 27 ALA n 1 28 ASN n 1 29 LEU n 1 30 ARG n 1 31 SER n 1 32 TRP n 1 33 ASN n 1 34 GLY n 1 35 ILE n 1 36 SER n 1 37 GLY n 1 38 ASP n 1 39 LEU n 1 40 ILE n 1 41 PHE n 1 42 VAL n 1 43 GLY n 1 44 GLN n 1 45 LYS n 1 46 LEU n 1 47 ILE n 1 48 VAL n 1 49 LYS n 1 50 LYS n 1 51 GLY n 1 52 SER n 1 53 HIS n 1 54 HIS n 1 55 HIS n 1 56 HIS n 1 57 HIS n 1 58 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene EF_0799 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 700802 / V583' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterococcus faecalis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 226185 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'C43(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pML520 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 GLY 2 1 1 GLY GLY A . n A 1 3 THR 3 2 2 THR THR A . n A 1 4 ASN 4 3 3 ASN ASN A . n A 1 5 THR 5 4 4 THR THR A . n A 1 6 TYR 6 5 5 TYR TYR A . n A 1 7 TYR 7 6 6 TYR TYR A . n A 1 8 THR 8 7 7 THR THR A . n A 1 9 VAL 9 8 8 VAL VAL A . n A 1 10 LYS 10 9 9 LYS LYS A . n A 1 11 SER 11 10 10 SER SER A . n A 1 12 GLY 12 11 11 GLY GLY A . n A 1 13 ASP 13 12 12 ASP ASP A . n A 1 14 THR 14 13 13 THR THR A . n A 1 15 LEU 15 14 14 LEU LEU A . n A 1 16 ASN 16 15 15 ASN ASN A . n A 1 17 LYS 17 16 16 LYS LYS A . n A 1 18 ILE 18 17 17 ILE ILE A . n A 1 19 ALA 19 18 18 ALA ALA A . n A 1 20 ALA 20 19 19 ALA ALA A . n A 1 21 GLN 21 20 20 GLN GLN A . n A 1 22 TYR 22 21 21 TYR TYR A . n A 1 23 GLY 23 22 22 GLY GLY A . n A 1 24 VAL 24 23 23 VAL VAL A . n A 1 25 SER 25 24 24 SER SER A . n A 1 26 VAL 26 25 25 VAL VAL A . n A 1 27 ALA 27 26 26 ALA ALA A . n A 1 28 ASN 28 27 27 ASN ASN A . n A 1 29 LEU 29 28 28 LEU LEU A . n A 1 30 ARG 30 29 29 ARG ARG A . n A 1 31 SER 31 30 30 SER SER A . n A 1 32 TRP 32 31 31 TRP TRP A . n A 1 33 ASN 33 32 32 ASN ASN A . n A 1 34 GLY 34 33 33 GLY GLY A . n A 1 35 ILE 35 34 34 ILE ILE A . n A 1 36 SER 36 35 35 SER SER A . n A 1 37 GLY 37 36 36 GLY GLY A . n A 1 38 ASP 38 37 37 ASP ASP A . n A 1 39 LEU 39 38 38 LEU LEU A . n A 1 40 ILE 40 39 39 ILE ILE A . n A 1 41 PHE 41 40 40 PHE PHE A . n A 1 42 VAL 42 41 41 VAL VAL A . n A 1 43 GLY 43 42 42 GLY GLY A . n A 1 44 GLN 44 43 43 GLN GLN A . n A 1 45 LYS 45 44 44 LYS LYS A . n A 1 46 LEU 46 45 45 LEU LEU A . n A 1 47 ILE 47 46 46 ILE ILE A . n A 1 48 VAL 48 47 47 VAL VAL A . n A 1 49 LYS 49 48 48 LYS LYS A . n A 1 50 LYS 50 49 49 LYS LYS A . n A 1 51 GLY 51 50 50 GLY GLY A . n A 1 52 SER 52 51 51 SER SER A . n A 1 53 HIS 53 52 ? ? ? A . n A 1 54 HIS 54 53 ? ? ? A . n A 1 55 HIS 55 54 ? ? ? A . n A 1 56 HIS 56 55 ? ? ? A . n A 1 57 HIS 57 56 ? ? ? A . n A 1 58 HIS 58 57 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details '1H, 15N, 13C chemical shift assignments and solution structure' _exptl.entry_id 2MKX _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MKX _struct.title 'Solution structure of LysM the peptidoglycan binding domain of autolysin AtlA from Enterococcus faecalis' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MKX _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'protein, Hydrolase' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ALYS_ENTFA _struct_ref.pdbx_db_accession P37710 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GTNTYYTVKSGDTLNKIAAQYGVSVANLRSWNGISGDLIFVGQKLIVKKG _struct_ref.pdbx_align_begin 358 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MKX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 51 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P37710 _struct_ref_seq.db_align_beg 358 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 407 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 50 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MKX MET A 1 ? UNP P37710 ? ? 'expression tag' 0 1 1 2MKX SER A 52 ? UNP P37710 ? ? 'expression tag' 51 2 1 2MKX HIS A 53 ? UNP P37710 ? ? 'expression tag' 52 3 1 2MKX HIS A 54 ? UNP P37710 ? ? 'expression tag' 53 4 1 2MKX HIS A 55 ? UNP P37710 ? ? 'expression tag' 54 5 1 2MKX HIS A 56 ? UNP P37710 ? ? 'expression tag' 55 6 1 2MKX HIS A 57 ? UNP P37710 ? ? 'expression tag' 56 7 1 2MKX HIS A 58 ? UNP P37710 ? ? 'expression tag' 57 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 14 ? GLY A 23 ? THR A 13 GLY A 22 1 ? 10 HELX_P HELX_P2 2 SER A 25 ? GLY A 34 ? SER A 24 GLY A 33 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 5 ? THR A 8 ? THR A 4 THR A 7 A 2 LYS A 45 ? VAL A 48 ? LYS A 44 VAL A 47 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 7 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 6 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LEU _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 46 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 45 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 12 ? ? -52.93 -3.34 2 2 ASP A 37 ? ? -115.71 65.41 3 3 ASN A 3 ? ? -171.51 126.49 4 3 SER A 10 ? ? -44.04 -18.35 5 4 SER A 10 ? ? -42.82 -17.77 6 4 ASP A 37 ? ? -115.50 60.34 7 5 SER A 10 ? ? -43.87 -17.69 8 5 ASP A 12 ? ? -57.58 -3.43 9 5 LEU A 38 ? ? -96.78 35.56 10 6 ASP A 12 ? ? -59.27 -1.30 11 7 ASP A 12 ? ? -59.84 0.09 12 8 ASP A 12 ? ? -52.93 -2.64 13 8 LEU A 38 ? ? -96.24 38.44 14 9 ASP A 12 ? ? -53.79 -1.88 15 9 LYS A 48 ? ? 178.51 118.21 16 10 SER A 10 ? ? -57.56 68.41 17 10 ASP A 12 ? ? -52.58 -0.26 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MKX _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 0.1 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 10.1 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.3 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.037 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.001 _pdbx_nmr_ensemble_rms.entry_id 2MKX _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MKX _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '0.6 mM [U-100% 13C; U-100% 15N] lysm, 40 mM potassium phosphate, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id lysm-1 0.6 ? mM '[U-100% 13C; U-100% 15N]' 1 'potassium phosphate-2' 40 ? mM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 40 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCA' 1 3 1 '3D HN(CO)CA' 1 4 1 '3D HNCO' 1 5 1 '3D HN(CA)CO' 1 6 1 '3D HNCACB' 1 7 1 '3D CBCA(CO)NH' 1 8 1 '3D 1H-15N TOCSY' 1 9 1 '2D 1H-13C HSQC' 1 10 1 '3D HCCH-TOCSY' 1 11 1 '3D CCH-TOCSY' 1 12 1 '3D 1H-15N/13C NOESY aliphatic' 1 13 1 '2D 1H-13C HSQC aromatic' 1 14 1 '2D H(N)CO' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MKX _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 32 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 430 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 14 _pdbx_nmr_constraints.NOE_long_range_total_count 142 _pdbx_nmr_constraints.NOE_medium_range_total_count 106 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 168 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 19 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 41 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 38 # _pdbx_nmr_refine.entry_id 2MKX _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'in explicit waters using ARIA protocol' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Accelrys Software Inc.' 'chemical shift assignment' Felix 2007 1 'Accelrys Software Inc.' 'peak picking' Felix 2007 2 'Accelrys Software Inc.' processing Felix 2007 3 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.21 4 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 1.21 5 'Bruker Biospin' collection TopSpin 1.3 6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A HIS 52 ? A HIS 53 3 1 Y 1 A HIS 53 ? A HIS 54 4 1 Y 1 A HIS 54 ? A HIS 55 5 1 Y 1 A HIS 55 ? A HIS 56 6 1 Y 1 A HIS 56 ? A HIS 57 7 1 Y 1 A HIS 57 ? A HIS 58 8 2 Y 1 A MET 0 ? A MET 1 9 2 Y 1 A HIS 52 ? A HIS 53 10 2 Y 1 A HIS 53 ? A HIS 54 11 2 Y 1 A HIS 54 ? A HIS 55 12 2 Y 1 A HIS 55 ? A HIS 56 13 2 Y 1 A HIS 56 ? A HIS 57 14 2 Y 1 A HIS 57 ? A HIS 58 15 3 Y 1 A MET 0 ? A MET 1 16 3 Y 1 A HIS 52 ? A HIS 53 17 3 Y 1 A HIS 53 ? A HIS 54 18 3 Y 1 A HIS 54 ? A HIS 55 19 3 Y 1 A HIS 55 ? A HIS 56 20 3 Y 1 A HIS 56 ? A HIS 57 21 3 Y 1 A HIS 57 ? A HIS 58 22 4 Y 1 A MET 0 ? A MET 1 23 4 Y 1 A HIS 52 ? A HIS 53 24 4 Y 1 A HIS 53 ? A HIS 54 25 4 Y 1 A HIS 54 ? A HIS 55 26 4 Y 1 A HIS 55 ? A HIS 56 27 4 Y 1 A HIS 56 ? A HIS 57 28 4 Y 1 A HIS 57 ? A HIS 58 29 5 Y 1 A MET 0 ? A MET 1 30 5 Y 1 A HIS 52 ? A HIS 53 31 5 Y 1 A HIS 53 ? A HIS 54 32 5 Y 1 A HIS 54 ? A HIS 55 33 5 Y 1 A HIS 55 ? A HIS 56 34 5 Y 1 A HIS 56 ? A HIS 57 35 5 Y 1 A HIS 57 ? A HIS 58 36 6 Y 1 A MET 0 ? A MET 1 37 6 Y 1 A HIS 52 ? A HIS 53 38 6 Y 1 A HIS 53 ? A HIS 54 39 6 Y 1 A HIS 54 ? A HIS 55 40 6 Y 1 A HIS 55 ? A HIS 56 41 6 Y 1 A HIS 56 ? A HIS 57 42 6 Y 1 A HIS 57 ? A HIS 58 43 7 Y 1 A MET 0 ? A MET 1 44 7 Y 1 A HIS 52 ? A HIS 53 45 7 Y 1 A HIS 53 ? A HIS 54 46 7 Y 1 A HIS 54 ? A HIS 55 47 7 Y 1 A HIS 55 ? A HIS 56 48 7 Y 1 A HIS 56 ? A HIS 57 49 7 Y 1 A HIS 57 ? A HIS 58 50 8 Y 1 A MET 0 ? A MET 1 51 8 Y 1 A HIS 52 ? A HIS 53 52 8 Y 1 A HIS 53 ? A HIS 54 53 8 Y 1 A HIS 54 ? A HIS 55 54 8 Y 1 A HIS 55 ? A HIS 56 55 8 Y 1 A HIS 56 ? A HIS 57 56 8 Y 1 A HIS 57 ? A HIS 58 57 9 Y 1 A MET 0 ? A MET 1 58 9 Y 1 A HIS 52 ? A HIS 53 59 9 Y 1 A HIS 53 ? A HIS 54 60 9 Y 1 A HIS 54 ? A HIS 55 61 9 Y 1 A HIS 55 ? A HIS 56 62 9 Y 1 A HIS 56 ? A HIS 57 63 9 Y 1 A HIS 57 ? A HIS 58 64 10 Y 1 A MET 0 ? A MET 1 65 10 Y 1 A HIS 52 ? A HIS 53 66 10 Y 1 A HIS 53 ? A HIS 54 67 10 Y 1 A HIS 54 ? A HIS 55 68 10 Y 1 A HIS 55 ? A HIS 56 69 10 Y 1 A HIS 56 ? A HIS 57 70 10 Y 1 A HIS 57 ? A HIS 58 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLY N N N N 94 GLY CA C N N 95 GLY C C N N 96 GLY O O N N 97 GLY OXT O N N 98 GLY H H N N 99 GLY H2 H N N 100 GLY HA2 H N N 101 GLY HA3 H N N 102 GLY HXT H N N 103 HIS N N N N 104 HIS CA C N S 105 HIS C C N N 106 HIS O O N N 107 HIS CB C N N 108 HIS CG C Y N 109 HIS ND1 N Y N 110 HIS CD2 C Y N 111 HIS CE1 C Y N 112 HIS NE2 N Y N 113 HIS OXT O N N 114 HIS H H N N 115 HIS H2 H N N 116 HIS HA H N N 117 HIS HB2 H N N 118 HIS HB3 H N N 119 HIS HD1 H N N 120 HIS HD2 H N N 121 HIS HE1 H N N 122 HIS HE2 H N N 123 HIS HXT H N N 124 ILE N N N N 125 ILE CA C N S 126 ILE C C N N 127 ILE O O N N 128 ILE CB C N S 129 ILE CG1 C N N 130 ILE CG2 C N N 131 ILE CD1 C N N 132 ILE OXT O N N 133 ILE H H N N 134 ILE H2 H N N 135 ILE HA H N N 136 ILE HB H N N 137 ILE HG12 H N N 138 ILE HG13 H N N 139 ILE HG21 H N N 140 ILE HG22 H N N 141 ILE HG23 H N N 142 ILE HD11 H N N 143 ILE HD12 H N N 144 ILE HD13 H N N 145 ILE HXT H N N 146 LEU N N N N 147 LEU CA C N S 148 LEU C C N N 149 LEU O O N N 150 LEU CB C N N 151 LEU CG C N N 152 LEU CD1 C N N 153 LEU CD2 C N N 154 LEU OXT O N N 155 LEU H H N N 156 LEU H2 H N N 157 LEU HA H N N 158 LEU HB2 H N N 159 LEU HB3 H N N 160 LEU HG H N N 161 LEU HD11 H N N 162 LEU HD12 H N N 163 LEU HD13 H N N 164 LEU HD21 H N N 165 LEU HD22 H N N 166 LEU HD23 H N N 167 LEU HXT H N N 168 LYS N N N N 169 LYS CA C N S 170 LYS C C N N 171 LYS O O N N 172 LYS CB C N N 173 LYS CG C N N 174 LYS CD C N N 175 LYS CE C N N 176 LYS NZ N N N 177 LYS OXT O N N 178 LYS H H N N 179 LYS H2 H N N 180 LYS HA H N N 181 LYS HB2 H N N 182 LYS HB3 H N N 183 LYS HG2 H N N 184 LYS HG3 H N N 185 LYS HD2 H N N 186 LYS HD3 H N N 187 LYS HE2 H N N 188 LYS HE3 H N N 189 LYS HZ1 H N N 190 LYS HZ2 H N N 191 LYS HZ3 H N N 192 LYS HXT H N N 193 MET N N N N 194 MET CA C N S 195 MET C C N N 196 MET O O N N 197 MET CB C N N 198 MET CG C N N 199 MET SD S N N 200 MET CE C N N 201 MET OXT O N N 202 MET H H N N 203 MET H2 H N N 204 MET HA H N N 205 MET HB2 H N N 206 MET HB3 H N N 207 MET HG2 H N N 208 MET HG3 H N N 209 MET HE1 H N N 210 MET HE2 H N N 211 MET HE3 H N N 212 MET HXT H N N 213 PHE N N N N 214 PHE CA C N S 215 PHE C C N N 216 PHE O O N N 217 PHE CB C N N 218 PHE CG C Y N 219 PHE CD1 C Y N 220 PHE CD2 C Y N 221 PHE CE1 C Y N 222 PHE CE2 C Y N 223 PHE CZ C Y N 224 PHE OXT O N N 225 PHE H H N N 226 PHE H2 H N N 227 PHE HA H N N 228 PHE HB2 H N N 229 PHE HB3 H N N 230 PHE HD1 H N N 231 PHE HD2 H N N 232 PHE HE1 H N N 233 PHE HE2 H N N 234 PHE HZ H N N 235 PHE HXT H N N 236 SER N N N N 237 SER CA C N S 238 SER C C N N 239 SER O O N N 240 SER CB C N N 241 SER OG O N N 242 SER OXT O N N 243 SER H H N N 244 SER H2 H N N 245 SER HA H N N 246 SER HB2 H N N 247 SER HB3 H N N 248 SER HG H N N 249 SER HXT H N N 250 THR N N N N 251 THR CA C N S 252 THR C C N N 253 THR O O N N 254 THR CB C N R 255 THR OG1 O N N 256 THR CG2 C N N 257 THR OXT O N N 258 THR H H N N 259 THR H2 H N N 260 THR HA H N N 261 THR HB H N N 262 THR HG1 H N N 263 THR HG21 H N N 264 THR HG22 H N N 265 THR HG23 H N N 266 THR HXT H N N 267 TRP N N N N 268 TRP CA C N S 269 TRP C C N N 270 TRP O O N N 271 TRP CB C N N 272 TRP CG C Y N 273 TRP CD1 C Y N 274 TRP CD2 C Y N 275 TRP NE1 N Y N 276 TRP CE2 C Y N 277 TRP CE3 C Y N 278 TRP CZ2 C Y N 279 TRP CZ3 C Y N 280 TRP CH2 C Y N 281 TRP OXT O N N 282 TRP H H N N 283 TRP H2 H N N 284 TRP HA H N N 285 TRP HB2 H N N 286 TRP HB3 H N N 287 TRP HD1 H N N 288 TRP HE1 H N N 289 TRP HE3 H N N 290 TRP HZ2 H N N 291 TRP HZ3 H N N 292 TRP HH2 H N N 293 TRP HXT H N N 294 TYR N N N N 295 TYR CA C N S 296 TYR C C N N 297 TYR O O N N 298 TYR CB C N N 299 TYR CG C Y N 300 TYR CD1 C Y N 301 TYR CD2 C Y N 302 TYR CE1 C Y N 303 TYR CE2 C Y N 304 TYR CZ C Y N 305 TYR OH O N N 306 TYR OXT O N N 307 TYR H H N N 308 TYR H2 H N N 309 TYR HA H N N 310 TYR HB2 H N N 311 TYR HB3 H N N 312 TYR HD1 H N N 313 TYR HD2 H N N 314 TYR HE1 H N N 315 TYR HE2 H N N 316 TYR HH H N N 317 TYR HXT H N N 318 VAL N N N N 319 VAL CA C N S 320 VAL C C N N 321 VAL O O N N 322 VAL CB C N N 323 VAL CG1 C N N 324 VAL CG2 C N N 325 VAL OXT O N N 326 VAL H H N N 327 VAL H2 H N N 328 VAL HA H N N 329 VAL HB H N N 330 VAL HG11 H N N 331 VAL HG12 H N N 332 VAL HG13 H N N 333 VAL HG21 H N N 334 VAL HG22 H N N 335 VAL HG23 H N N 336 VAL HXT H N N 337 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLY N CA sing N N 89 GLY N H sing N N 90 GLY N H2 sing N N 91 GLY CA C sing N N 92 GLY CA HA2 sing N N 93 GLY CA HA3 sing N N 94 GLY C O doub N N 95 GLY C OXT sing N N 96 GLY OXT HXT sing N N 97 HIS N CA sing N N 98 HIS N H sing N N 99 HIS N H2 sing N N 100 HIS CA C sing N N 101 HIS CA CB sing N N 102 HIS CA HA sing N N 103 HIS C O doub N N 104 HIS C OXT sing N N 105 HIS CB CG sing N N 106 HIS CB HB2 sing N N 107 HIS CB HB3 sing N N 108 HIS CG ND1 sing Y N 109 HIS CG CD2 doub Y N 110 HIS ND1 CE1 doub Y N 111 HIS ND1 HD1 sing N N 112 HIS CD2 NE2 sing Y N 113 HIS CD2 HD2 sing N N 114 HIS CE1 NE2 sing Y N 115 HIS CE1 HE1 sing N N 116 HIS NE2 HE2 sing N N 117 HIS OXT HXT sing N N 118 ILE N CA sing N N 119 ILE N H sing N N 120 ILE N H2 sing N N 121 ILE CA C sing N N 122 ILE CA CB sing N N 123 ILE CA HA sing N N 124 ILE C O doub N N 125 ILE C OXT sing N N 126 ILE CB CG1 sing N N 127 ILE CB CG2 sing N N 128 ILE CB HB sing N N 129 ILE CG1 CD1 sing N N 130 ILE CG1 HG12 sing N N 131 ILE CG1 HG13 sing N N 132 ILE CG2 HG21 sing N N 133 ILE CG2 HG22 sing N N 134 ILE CG2 HG23 sing N N 135 ILE CD1 HD11 sing N N 136 ILE CD1 HD12 sing N N 137 ILE CD1 HD13 sing N N 138 ILE OXT HXT sing N N 139 LEU N CA sing N N 140 LEU N H sing N N 141 LEU N H2 sing N N 142 LEU CA C sing N N 143 LEU CA CB sing N N 144 LEU CA HA sing N N 145 LEU C O doub N N 146 LEU C OXT sing N N 147 LEU CB CG sing N N 148 LEU CB HB2 sing N N 149 LEU CB HB3 sing N N 150 LEU CG CD1 sing N N 151 LEU CG CD2 sing N N 152 LEU CG HG sing N N 153 LEU CD1 HD11 sing N N 154 LEU CD1 HD12 sing N N 155 LEU CD1 HD13 sing N N 156 LEU CD2 HD21 sing N N 157 LEU CD2 HD22 sing N N 158 LEU CD2 HD23 sing N N 159 LEU OXT HXT sing N N 160 LYS N CA sing N N 161 LYS N H sing N N 162 LYS N H2 sing N N 163 LYS CA C sing N N 164 LYS CA CB sing N N 165 LYS CA HA sing N N 166 LYS C O doub N N 167 LYS C OXT sing N N 168 LYS CB CG sing N N 169 LYS CB HB2 sing N N 170 LYS CB HB3 sing N N 171 LYS CG CD sing N N 172 LYS CG HG2 sing N N 173 LYS CG HG3 sing N N 174 LYS CD CE sing N N 175 LYS CD HD2 sing N N 176 LYS CD HD3 sing N N 177 LYS CE NZ sing N N 178 LYS CE HE2 sing N N 179 LYS CE HE3 sing N N 180 LYS NZ HZ1 sing N N 181 LYS NZ HZ2 sing N N 182 LYS NZ HZ3 sing N N 183 LYS OXT HXT sing N N 184 MET N CA sing N N 185 MET N H sing N N 186 MET N H2 sing N N 187 MET CA C sing N N 188 MET CA CB sing N N 189 MET CA HA sing N N 190 MET C O doub N N 191 MET C OXT sing N N 192 MET CB CG sing N N 193 MET CB HB2 sing N N 194 MET CB HB3 sing N N 195 MET CG SD sing N N 196 MET CG HG2 sing N N 197 MET CG HG3 sing N N 198 MET SD CE sing N N 199 MET CE HE1 sing N N 200 MET CE HE2 sing N N 201 MET CE HE3 sing N N 202 MET OXT HXT sing N N 203 PHE N CA sing N N 204 PHE N H sing N N 205 PHE N H2 sing N N 206 PHE CA C sing N N 207 PHE CA CB sing N N 208 PHE CA HA sing N N 209 PHE C O doub N N 210 PHE C OXT sing N N 211 PHE CB CG sing N N 212 PHE CB HB2 sing N N 213 PHE CB HB3 sing N N 214 PHE CG CD1 doub Y N 215 PHE CG CD2 sing Y N 216 PHE CD1 CE1 sing Y N 217 PHE CD1 HD1 sing N N 218 PHE CD2 CE2 doub Y N 219 PHE CD2 HD2 sing N N 220 PHE CE1 CZ doub Y N 221 PHE CE1 HE1 sing N N 222 PHE CE2 CZ sing Y N 223 PHE CE2 HE2 sing N N 224 PHE CZ HZ sing N N 225 PHE OXT HXT sing N N 226 SER N CA sing N N 227 SER N H sing N N 228 SER N H2 sing N N 229 SER CA C sing N N 230 SER CA CB sing N N 231 SER CA HA sing N N 232 SER C O doub N N 233 SER C OXT sing N N 234 SER CB OG sing N N 235 SER CB HB2 sing N N 236 SER CB HB3 sing N N 237 SER OG HG sing N N 238 SER OXT HXT sing N N 239 THR N CA sing N N 240 THR N H sing N N 241 THR N H2 sing N N 242 THR CA C sing N N 243 THR CA CB sing N N 244 THR CA HA sing N N 245 THR C O doub N N 246 THR C OXT sing N N 247 THR CB OG1 sing N N 248 THR CB CG2 sing N N 249 THR CB HB sing N N 250 THR OG1 HG1 sing N N 251 THR CG2 HG21 sing N N 252 THR CG2 HG22 sing N N 253 THR CG2 HG23 sing N N 254 THR OXT HXT sing N N 255 TRP N CA sing N N 256 TRP N H sing N N 257 TRP N H2 sing N N 258 TRP CA C sing N N 259 TRP CA CB sing N N 260 TRP CA HA sing N N 261 TRP C O doub N N 262 TRP C OXT sing N N 263 TRP CB CG sing N N 264 TRP CB HB2 sing N N 265 TRP CB HB3 sing N N 266 TRP CG CD1 doub Y N 267 TRP CG CD2 sing Y N 268 TRP CD1 NE1 sing Y N 269 TRP CD1 HD1 sing N N 270 TRP CD2 CE2 doub Y N 271 TRP CD2 CE3 sing Y N 272 TRP NE1 CE2 sing Y N 273 TRP NE1 HE1 sing N N 274 TRP CE2 CZ2 sing Y N 275 TRP CE3 CZ3 doub Y N 276 TRP CE3 HE3 sing N N 277 TRP CZ2 CH2 doub Y N 278 TRP CZ2 HZ2 sing N N 279 TRP CZ3 CH2 sing Y N 280 TRP CZ3 HZ3 sing N N 281 TRP CH2 HH2 sing N N 282 TRP OXT HXT sing N N 283 TYR N CA sing N N 284 TYR N H sing N N 285 TYR N H2 sing N N 286 TYR CA C sing N N 287 TYR CA CB sing N N 288 TYR CA HA sing N N 289 TYR C O doub N N 290 TYR C OXT sing N N 291 TYR CB CG sing N N 292 TYR CB HB2 sing N N 293 TYR CB HB3 sing N N 294 TYR CG CD1 doub Y N 295 TYR CG CD2 sing Y N 296 TYR CD1 CE1 sing Y N 297 TYR CD1 HD1 sing N N 298 TYR CD2 CE2 doub Y N 299 TYR CD2 HD2 sing N N 300 TYR CE1 CZ doub Y N 301 TYR CE1 HE1 sing N N 302 TYR CE2 CZ sing Y N 303 TYR CE2 HE2 sing N N 304 TYR CZ OH sing N N 305 TYR OH HH sing N N 306 TYR OXT HXT sing N N 307 VAL N CA sing N N 308 VAL N H sing N N 309 VAL N H2 sing N N 310 VAL CA C sing N N 311 VAL CA CB sing N N 312 VAL CA HA sing N N 313 VAL C O doub N N 314 VAL C OXT sing N N 315 VAL CB CG1 sing N N 316 VAL CB CG2 sing N N 317 VAL CB HB sing N N 318 VAL CG1 HG11 sing N N 319 VAL CG1 HG12 sing N N 320 VAL CG1 HG13 sing N N 321 VAL CG2 HG21 sing N N 322 VAL CG2 HG22 sing N N 323 VAL CG2 HG23 sing N N 324 VAL OXT HXT sing N N 325 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DRX' # _atom_sites.entry_id 2MKX _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_